Prosecution Insights
Last updated: April 19, 2026
Application No. 16/759,200

Drug and Method for Treating Liver Diseases Related to Hepatitis B Viruses in Full-Dose Condition

Final Rejection §103§DP
Filed
Apr 24, 2020
Examiner
COFFA, SERGIO
Art Unit
1658
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
Shanghai Hep Pharmaceutical Co. Ltd.
OA Round
11 (Final)
61%
Grant Probability
Moderate
12-13
OA Rounds
2y 11m
To Grant
94%
With Interview

Examiner Intelligence

Grants 61% of resolved cases
61%
Career Allow Rate
436 granted / 719 resolved
+0.6% vs TC avg
Strong +34% interview lift
Without
With
+33.6%
Interview Lift
resolved cases with interview
Typical timeline
2y 11m
Avg Prosecution
61 currently pending
Career history
780
Total Applications
across all art units

Statute-Specific Performance

§101
3.5%
-36.5% vs TC avg
§103
32.1%
-7.9% vs TC avg
§102
20.5%
-19.5% vs TC avg
§112
27.0%
-13.0% vs TC avg
Black line = Tech Center average estimate • Based on career data from 719 resolved cases

Office Action

§103 §DP
Notice of Pre-AIA or AIA Status The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . DETAILED ACTION Claim Status Claims 1, 3, 6, 8, 15-16, 18, 22, 29 and 32-34 are pending. Claims 23-24 have been canceled. Claims 1, 29 and 32-34 have been amended. Claims 1, 3, 6, 8, 15-16, 18, 22, 29 and 32-34 are being examined in this application. In the response to the restriction requirement, Applicants elected Group I, SEQ ID NO: 3 and chronic hepatitis B virus infection. Claim Rejections - 35 USC § 103 The following is a quotation of 35 U.S.C. 103 which forms the basis for all obviousness rejections set forth in this Office action: A patent for a claimed invention may not be obtained, notwithstanding that the claimed invention is not identically disclosed as set forth in section 102, if the differences between the claimed invention and the prior art are such that the claimed invention as a whole would have been obvious before the effective filing date of the claimed invention to a person having ordinary skill in the art to which the claimed invention pertains. Patentability shall not be negated by the manner in which the invention was made. This rejection has been modified. Claims 1, 3, 6, 8, 15-16, 18, 22, 29 and 32-34 are rejected under 35 U.S.C. 103 as being unpatentable over Liu (WO 2015/000371). With respect to claims 1 and 3, Liu teaches a drug formulation comprising SEQ ID NO: 1 (claim 1). As evidenced by Liu (US 2017/0112898), SEQ ID NO: 1 consists of the amino acid sequence GTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVG, which corresponds to instantly claimed SEQ ID Nos: 3 and 23. Liu further teaches that the drug formulation is for treating a HBV infectious disease (claim 32). Liu also teaches that the pharmacodynamical dose in an animal was determined as 0.4mg/kg. As calculated by body surface area, the effective dose for an adult human (60kg) is 4.2mg (para [0060]). Liu additionally teaches administering at day 0, 1, 2, 3, 5, 7, 9, 11 and 13 after infection (para [0059]). Liu also teaches that fifty adult tree shrews were grouped randomly into 5 groups, which included PBS control group, high dose group (hepalatide, 2mg/kg), middle dose group (0.4mg/kg), low dose group (0.08mg/kg) and HBIG blocking group (60IU/kg) (para [0059]). Liu also teaches that the average weight of the patients is 60kg (para [0060]). Thus, Liu teaches administering 120mg, 24mg, and 4.8mg. Liu does not teach administering for at least 7 consecutive days. However, the MPEP 2144.05 A states that "[G]enerally, differences in concentration or temperature will not support the patentability of subject matter encompassed by the prior art unless there is evidence indicating such concentration or temperature is critical. "[W]here the general conditions of a claim are disclosed in the prior art, it is not inventive to discover the optimum or workable ranges by routine experimentation." In re Aller, 220 F.2d 454, 456, 105 USPQ 233, 235 (CCPA 1955) (Claimed process which was performed at a temperature between 40°C and 80°C and an acid concentration between 25% and 70% was held to be prima facie obvious over a reference process which differed from the claims only in that the reference process was performed at a temperature of 100°C and an acid concentration of 10%.); see also Peterson, 315 F.3d at 1330, 65 USPQ2d at 1382 ("The normal desire of scientists or artisans to improve upon what is already generally known provides the motivation to determine where in a disclosed set of percentage ranges is the optimum combination of percentages."); In re Hoeschele, 406 F.2d 1403, 160 USPQ 809 (CCPA 1969) (Claimed elastomeric polyurethanes which fell within the broad scope of the references were held to be unpatentable thereover because, among other reasons, there was no evidence of the criticality of the claimed ranges of molecular weight or molar proportions.). For more recent cases applying this principle, see Merck & Co. Inc. v. Biocraft Laboratories Inc., 874 F.2d 804, 10 USPQ2d 1843 (Fed. Cir.), cert. denied, 493 U.S. 975 (1989); In re Kulling, 897 F.2d 1147, 14 USPQ2d 1056 (Fed. Cir. 1990); and In re Geisler, 116 F.3d 1465, 43 USPQ2d 1362 (Fed. Cir. 1997)". Since Applicant has not disclosed that the specific limitations recited in the instant claims are for any particular purpose or solve any stated problem, absent unexpected results, it would have been obvious for one of ordinary skill to discover the optimum dosage and time of administration by normal optimization procedures known in the pharmaceutical art. With respect to the limitation “reaching a saturation level of a polypeptide in the liver target organ”, it is noted that said limitation is inherent to the polypeptide and to the amount of said polypeptide being administered. As discussed above. The skilled artisan would have administered the same amount instantly administered, thus reaching a saturating level of a polypeptide in the liver target organ. With respect to claims 6, 15-16 and 18, Liu teaches that the N-terminus of the polypeptide is modified by myristic acid and the C-terminus is modified by amidation (claim 1). With respect to claim 8, Liu teaches that the HBV infectious disease comprises chronic hepatitis, HBV related liver transplantation and blockage of HBV maternal neonatal transmission (claim 33). With respect to claim 22, Liu teaches that the HBV infectious disease comprises HBV related liver transplantation (claim 33). Thus, reading on the limitations "selecting a patient having a hepatitis B-related disorder" and "the administration is before, during or after transplantation". With respect to claim 29, Liu teaches administering at day 0, 1, 2, 3, 5, 7, 9, 11 and 13 after infection (para [0059]). Furthermore, since Applicant has not disclosed that the specific limitations recited in the instant claims are for any particular purpose or solve any stated problem, absent unexpected results, it would have been obvious for one of ordinary skill to discover the optimum dosage by normal optimization procedures known in the pharmaceutical art. Response to Arguments Applicant's arguments filed on 11/12/2025 have been fully considered but they are not persuasive. Applicant argues that "[L]iu does not disclose a saturating level of its polypeptide in the liver of a human. In fact, Liu is totally silent in this concept and, thus, the skilled artisan would not have been motivated to determine, nor could a skilled artisan have reasonably expected, the dose at which administration would reach such a saturating level in the liver of a human subject”. Applicant also argues that “[t]he skilled artisan would not use a dosage of 6.3-10.5 mg, based on the disclosure of Liu '371, nor would the skilled artisan have a reasonable expectation of success in reaching a saturating level of a polypeptide in the liver of a human. Further, as disclosed in paragraph [0145] of this application, single administration of 0.525 mg - 4.2 mg does not saturate the liver. The apparent distribution volume of 135 L was shown after a single subcutaneous injection of 5 mg Myrcludex B, which did not reach liver target organ saturation. Therefore, even though Liu discloses a dosage form of 4.2 mg, Liu '371 does not indicate with what dosage form a saturating level of its polypeptide in liver could reach by a single administration. As a single dosage that produces a saturating level of the claimed polypeptide in the liver of a human subject having or suffering from hepatitis B virus-related liver diseases was not disclosed in the prior art, each of the elements of claim 1, let alone the "general conditions" of claim 1 was not disclosed in the prior art”. Applicant's arguments are not persuasive. Liu clearly teaches administering 0.08mg/kg, 0.4mg/kg, or 2mg/kg, which corresponds to 4.8 mg, 24 mg, or 120mg in a human weighting 60kg. Therefore, it is clear that the dosage of Liu can be adjusted depending on the weight of the patient. Since Liu teaches that the effective dose for an adult human of 60Kg is 4.2 mg, one of ordinary skill in the art following the teachings of Liu would have administered 6.3 mg to a patient weighting 90Kg. Even assuming arguendo, that one of ordinary skill in the art would have calculated the dosage based on body surface, the MPEP 2144.05 A states that "[G]enerally, differences in concentration or temperature will not support the patentability of subject matter encompassed by the prior art unless there is evidence indicating such concentration or temperature is critical. "[W]here the general conditions of a claim are disclosed in the prior art, it is not inventive to discover the optimum or workable ranges by routine experimentation." In re Aller, 220 F.2d 454, 456, 105 USPQ 233, 235 (CCPA 1955) (Claimed process which was performed at a temperature between 40°C and 80°C and an acid concentration between 25% and 70% was held to be prima facie obvious over a reference process which differed from the claims only in that the reference process was performed at a temperature of 100°C and an acid concentration of 10%.); see also Peterson, 315 F.3d at 1330, 65 USPQ2d at 1382 ("The normal desire of scientists or artisans to improve upon what is already generally known provides the motivation to determine where in a disclosed set of percentage ranges is the optimum combination of percentages."); In re Hoeschele, 406 F.2d 1403, 160 USPQ 809 (CCPA 1969) (Claimed elastomeric polyurethanes which fell within the broad scope of the references were held to be unpatentable thereover because, among other reasons, there was no evidence of the criticality of the claimed ranges of molecular weight or molar proportions.). For more recent cases applying this principle, see Merck & Co. Inc. v. Biocraft Laboratories Inc., 874 F.2d 804, 10 USPQ2d 1843 (Fed. Cir.), cert. denied, 493 U.S. 975 (1989); In re Kulling, 897 F.2d 1147, 14 USPQ2d 1056 (Fed. Cir. 1990); and In re Geisler, 116 F.3d 1465, 43 USPQ2d 1362 (Fed. Cir. 1997)". Since Applicant has not disclosed that the specific limitations recited in the instant claims are for any particular purpose or solve any stated problem, absent unexpected results, it would have been obvious for one of ordinary skill to discover the optimum workable dosage and time interval between dosages by normal optimization procedures known in the pharmaceutical art. With respect to Applicant's alleged unexpected results (i.e. the polypeptides to reach a saturating level in a liver target organ without dose-limiting toxicity), the MPEP 716.02(e) states that the claimed subject matter must be compared with the closest prior art to be effective to rebut a prima facie case of obviousness. Therefore, since the Office does not have the facilities for examining and comparing applicants' dosage with the dosage of the prior art, the burden is on the applicant to show a novel or unobvious difference between the claimed method and the method of the prior art. See In re Best, 562 F.2d 1252, 195 USPQ 430 (CCPA 1977) and In re Fitzgerald et al., 205 USPQ 594. For the reasons stated above the rejection is maintained. Double Patenting The nonstatutory double patenting rejection is based on a judicially created doctrine grounded in public policy (a policy reflected in the statute) so as to prevent the unjustified or improper timewise extension of the “right to exclude” granted by a patent and to prevent possible harassment by multiple assignees. A nonstatutory double patenting rejection is appropriate where the conflicting claims are not identical, but at least one examined application claim is not patentably distinct from the reference claim(s) because the examined application claim is either anticipated by, or would have been obvious over, the reference claim(s). See, e.g., In re Berg, 140 F.3d 1428, 46 USPQ2d 1226 (Fed. Cir. 1998); In re Goodman, 11 F.3d 1046, 29 USPQ2d 2010 (Fed. Cir. 1993); In re Longi, 759 F.2d 887, 225 USPQ 645 (Fed. Cir. 1985); In re Van Ornum, 686 F.2d 937, 214 USPQ 761 (CCPA 1982); In re Vogel, 422 F.2d 438, 164 USPQ 619 (CCPA 1970); In re Thorington, 418 F.2d 528, 163 USPQ 644 (CCPA 1969). A timely filed terminal disclaimer in compliance with 37 CFR 1.321(c) or 1.321(d) may be used to overcome an actual or provisional rejection based on nonstatutory double patenting provided the reference application or patent either is shown to be commonly owned with the examined application, or claims an invention made as a result of activities undertaken within the scope of a joint research agreement. See MPEP § 717.02 for applications subject to examination under the first inventor to file provisions of the AIA as explained in MPEP § 2159. See MPEP § 2146 et seq. for applications not subject to examination under the first inventor to file provisions of the AIA . A terminal disclaimer must be signed in compliance with 37 CFR 1.321(b). The filing of a terminal disclaimer by itself is not a complete reply to a nonstatutory double patenting (NSDP) rejection. A complete reply requires that the terminal disclaimer be accompanied by a reply requesting reconsideration of the prior Office action. Even where the NSDP rejection is provisional the reply must be complete. See MPEP § 804, subsection I.B.1. For a reply to a non-final Office action, see 37 CFR 1.111(a). For a reply to final Office action, see 37 CFR 1.113(c). A request for reconsideration while not provided for in 37 CFR 1.113(c) may be filed after final for consideration. See MPEP §§ 706.07(e) and 714.13. The USPTO Internet website contains terminal disclaimer forms which may be used. Please visit www.uspto.gov/patent/patents-forms. The actual filing date of the application in which the form is filed determines what form (e.g., PTO/SB/25, PTO/SB/26, PTO/AIA /25, or PTO/AIA /26) should be used. A web-based eTerminal Disclaimer may be filled out completely online using web-screens. An eTerminal Disclaimer that meets all requirements is auto-processed and approved immediately upon submission. For more information about eTerminal Disclaimers, refer to www.uspto.gov/patents/apply/applying-online/eterminal-disclaimer. This rejection is maintained. Claims 1, 3, 6, 8, 15-16, 18 and 32-34 are rejected on the ground of nonstatutory double patenting as being unpatentable over claims 1-18 of U.S. Patent No. 10603352. With respect to claims 1 and 3, '352 teaches a drug formulation comprising SEQ ID NO: 1 (claim 1), which corresponds to instantly claimed SEQ ID Nos: 3 and 23. '352 further teaches that the drug formulation is for treating a HBV infectious disease (column 2, lines 14-15; column 5, lines 48-50). Please note that it is proper to turn to and rely on the disclosure of a patent application to ascertain what constitutes an obvious modification. This position is supported by the courts. See In re Vogel, 422 F.2d 438, 164 USPQ 619 (CCPA 1970). The skilled artisan would have been motivated to use the drug formulation of '352 to treat a HBV infectious disease. '352 also teaches that the formulations contain 0.25, 0.5, 1 .0, 2.0, 2.1, 4.0, 4.2, 5 or 8 mg of the polypeptide (claim 10), and further teaches the pharmacodynamical dose in an animal was determined as 0.4mg/kg. As calculated by body surface area, the effective dose for an adult human (60kg) is 4.2mg (Examples 4 and 13; column 6, lines 57-59; column 7, lines 25-27). '352 further teaches that fifty adult tree shrews were grouped randomly into 5 groups, which included PBS control group, high dose group (hepalatide, 2mg/kg), middle dose group (0.4mg/kg), low dose group (0.08mg/kg) and HBIG blocking group (60IU/kg) (Example 4), and further teaches that the average weight of the patients is 60kg (Example 4). Thus, '352 teaches administering 120mg, 24mg, and 4.8mg. '352 does not teach administering for at least 7 consecutive days. However, the MPEP 2144.05 A states that "[G]enerally, differences in concentration or temperature will not support the patentability of subject matter encompassed by the prior art unless there is evidence indicating such concentration or temperature is critical. "[W]here the general conditions of a claim are disclosed in the prior art, it is not inventive to discover the optimum or workable ranges by routine experimentation." In re Aller, 220 F.2d 454, 456, 105 USPQ 233, 235 (CCPA 1955) (Claimed process which was performed at a temperature between 40°C and 80°C and an acid concentration between 25% and 70% was held to be prima facie obvious over a reference process which differed from the claims only in that the reference process was performed at a temperature of 100°C and an acid concentration of 10%.); see also Peterson, 315 F.3d at 1330, 65 USPQ2d at 1382 ("The normal desire of scientists or artisans to improve upon what is already generally known provides the motivation to determine where in a disclosed set of percentage ranges is the optimum combination of percentages."); In re Hoeschele, 406 F.2d 1403, 160 USPQ 809 (CCPA 1969) (Claimed elastomeric polyurethanes which fell within the broad scope of the references were held to be unpatentable thereover because, among other reasons, there was no evidence of the criticality of the claimed ranges of molecular weight or molar proportions.). For more recent cases applying this principle, see Merck & Co. Inc. v. Biocraft Laboratories Inc., 874 F.2d 804, 10 USPQ2d 1843 (Fed. Cir.), cert. denied, 493 U.S. 975 (1989); In re Kulling, 897 F.2d 1147, 14 USPQ2d 1056 (Fed. Cir. 1990); and In re Geisler, 116 F.3d 1465, 43 USPQ2d 1362 (Fed. Cir. 1997)". Since Applicant has not disclosed that the specific limitations recited in the instant claims are for any particular purpose or solve any stated problem, absent unexpected results, it would have been obvious for one of ordinary skill to discover the optimum time of administration by normal optimization procedures known in the pharmaceutical art. With respect to claims 6, 15-16 and 18, '352 teaches that the N-terminus of the polypeptide is modified by myristic acid and the C-terminus is modified by amidation (claim 1). With respect to claim 8, '352 teaches treating HBV chronic infection (Example 4). Response to Arguments Applicant's arguments filed on 11/12/2025 have been fully considered but they are not persuasive. Applicant arguments have been addressed above under "Response to Arguments" on pages 5-8. For the reasons stated above, the rejection is maintained. Conclusion THIS ACTION IS MADE FINAL. Applicant is reminded of the extension of time policy as set forth in 37 CFR 1.136(a). A shortened statutory period for reply to this final action is set to expire THREE MONTHS from the mailing date of this action. In the event a first reply is filed within TWO MONTHS of the mailing date of this final action and the advisory action is not mailed until after the end of the THREE-MONTH shortened statutory period, then the shortened statutory period will expire on the date the advisory action is mailed, and any nonprovisional extension fee (37 CFR 1.17(a)) pursuant to 37 CFR 1.136(a) will be calculated from the mailing date of the advisory action. In no event, however, will the statutory period for reply expire later than SIX MONTHS from the mailing date of this final action. Any inquiry concerning this communication or earlier communications from the examiner should be directed to SERGIO COFFA whose telephone number is (571)270-3022. The examiner can normally be reached M-F: 6AM-4PM. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, MELISSA FISHER can be reached at 571-270-7430. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /SERGIO COFFA Ph.D./ Primary Examiner Art Unit 1658 /SERGIO COFFA/Primary Examiner, Art Unit 1658
Read full office action

Prosecution Timeline

Apr 24, 2020
Application Filed
Apr 24, 2020
Response after Non-Final Action
Mar 02, 2021
Non-Final Rejection — §103, §DP
Jun 08, 2021
Response Filed
Jun 21, 2021
Final Rejection — §103, §DP
Sep 27, 2021
Request for Continued Examination
Oct 04, 2021
Response after Non-Final Action
Feb 13, 2022
Non-Final Rejection — §103, §DP
Jul 28, 2022
Response Filed
Aug 14, 2022
Final Rejection — §103, §DP
Nov 18, 2022
Request for Continued Examination
Nov 30, 2022
Response after Non-Final Action
Feb 26, 2023
Final Rejection — §103, §DP
Jun 30, 2023
Request for Continued Examination
Jul 10, 2023
Response after Non-Final Action
Sep 24, 2023
Non-Final Rejection — §103, §DP
Jan 29, 2024
Response Filed
Feb 12, 2024
Final Rejection — §103, §DP
Jun 14, 2024
Request for Continued Examination
Jun 20, 2024
Response after Non-Final Action
Sep 16, 2024
Non-Final Rejection — §103, §DP
Feb 18, 2025
Response Filed
Mar 03, 2025
Final Rejection — §103, §DP
Jun 06, 2025
Request for Continued Examination
Jun 09, 2025
Response after Non-Final Action
Aug 11, 2025
Non-Final Rejection — §103, §DP
Nov 12, 2025
Response Filed
Nov 30, 2025
Final Rejection — §103, §DP (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12595283
POLYPEPTIDE TAG AND APPLICATION THEREOF IN IN VITRO PROTEIN SYNTHESIS
2y 5m to grant Granted Apr 07, 2026
Patent 12590119
PEPTIDE SYNTHESIS AND SYSTEM THEREOF
2y 5m to grant Granted Mar 31, 2026
Patent 12582924
METHODS FOR OBTAINING LIQUID FROM A SOLID PHASE
2y 5m to grant Granted Mar 24, 2026
Patent 12569574
PROTEINS WITH CARDIOPROTECTIVE ACTIVITY
2y 5m to grant Granted Mar 10, 2026
Patent 12569435
Ocular Compositions and Methods Thereof
2y 5m to grant Granted Mar 10, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

AI Strategy Recommendation

Get an AI-powered prosecution strategy using examiner precedents, rejection analysis, and claim mapping.
Powered by AI — typically takes 5-10 seconds

Prosecution Projections

12-13
Expected OA Rounds
61%
Grant Probability
94%
With Interview (+33.6%)
2y 11m
Median Time to Grant
High
PTA Risk
Based on 719 resolved cases by this examiner. Grant probability derived from career allow rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month