Prosecution Insights
Last updated: April 19, 2026
Application No. 17/056,103

Adoptive T-Cell Therapy for CMV Infection and CMV-Associated Diseases

Non-Final OA §101§102§103§DP
Filed
Jul 01, 2021
Examiner
GILL, RACHEL B
Art Unit
1671
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
The Queensland Institute of Medical Research
OA Round
4 (Non-Final)
66%
Grant Probability
Favorable
4-5
OA Rounds
2y 7m
To Grant
93%
With Interview

Examiner Intelligence

Grants 66% — above average
66%
Career Allow Rate
556 granted / 848 resolved
+5.6% vs TC avg
Strong +28% interview lift
Without
With
+27.8%
Interview Lift
resolved cases with interview
Typical timeline
2y 7m
Avg Prosecution
48 currently pending
Career history
896
Total Applications
across all art units

Statute-Specific Performance

§101
8.8%
-31.2% vs TC avg
§103
22.5%
-17.5% vs TC avg
§102
21.7%
-18.3% vs TC avg
§112
27.4%
-12.6% vs TC avg
Black line = Tech Center average estimate • Based on career data from 848 resolved cases

Office Action

§101 §102 §103 §DP
DETAILED ACTION Continued Examination Under 37 CFR 1.114 A request for continued examination under 37 CFR 1.114, including the fee set forth in 37 CFR 1.17(e), was filed in this application after final rejection. Since this application is eligible for continued examination under 37 CFR 1.114, and the fee set forth in 37 CFR 1.17(e) has been timely paid, the finality of the previous Office action has been withdrawn pursuant to 37 CFR 1.114. Applicant's submission filed on 10/21/2025 has been entered. Disposition of Claims Claims 1-2, 4, 7, 9, 14-15, 17-18, 20-21, 23, 28, 33, 38, 43, 47, 93-95, and 99 were pending. Claims 3-6, 8, 10-13, 16, 19, 22, 24-27, 29-32, 34-37, 39-42, 44-46, 48-92, and 96-98 are cancelled. Amendments to claims 1, 2, and 15 are acknowledged and entered. Claims 1-2, 7, 9, 14-15, 17-18, 20-21, 23, 28, 33, 38, 43, 47, 93-95, and 99 will be examined on their merits. Examiner’s Note All paragraph numbers (¶) throughout this office action, unless otherwise noted, are from the US PGPub of this application US20210393684A1, Published 12/23/2021. Amendments to the specification presented on 06/13/2024 are acknowledged and entered. Applicant is encouraged to utilize the new web-based Automated Interview Request (AIR) tool for submitting interview requests; more information can be found at https://www.uspto.gov/patent/laws-and-regulations/interview-practice. Response to Arguments Applicant's arguments filed 10/21/2025 regarding the previous Office action dated 04/21/2025 have been fully considered. If they have been found to be persuasive, the objection/rejection has been withdrawn below. Likewise, if a rejection/objection has not been recited, said rejection/objection has been withdrawn. If the arguments have not been found to be persuasive, or if there are arguments presented over art that has been utilized in withdrawn rejections but utilized in new rejections, the arguments will be addressed fully with the objection/rejection below. Claim Rejections - 35 USC § 101 The text of those sections of Title 35, U.S. Code not included in this action can be found in a prior Office action. (Rejection withdrawn.) The rejection of Claims 1-2, 4, and 20 under 35 U.S.C. 101 is withdrawn in light of the amendments to the claims. Claim Interpretation The claims in this application are given their broadest reasonable interpretation using the plain meaning of the claim language in light of the specification as it would be understood by one of ordinary skill in the art. Claim 1 is drawn to a pool of immunogenic peptides comprising HLA class I and class II- restricted Cytomegalovirus (CMV) peptide epitopes, wherein the peptide pool comprises each of the epitope amino acid sequences set forth in SEQ ID NOs. 25 to 29 and an adjuvant. Claim 2 is drawn to a pool of immunogenic peptides comprising HLA class I and class II- restricted CMV peptide epitopes, and wherein the peptide pool comprises at least one peptide epitope derived from each of the CMV antigens pp50, pp65, IE-1, gB and gH and an adjuvant. Claim 7 is drawn to a method of producing a preparation of polyfunctional cytotoxic T cells (CTLs), comprising: a) isolating a sample comprising CTLs; b) exposing said sample to the pool of immunogenic peptides of claim 1; and c) harvesting the CTLs. Further limitations on the method of claim 7 are wherein the sample comprising CTLs comprises peripheral blood mononuclear cells (PBMCs) from a healthy donor or an immunocompromised donor (claim 9), wherein the immunocompromised donor is undergoing immunosuppressive therapy, a solid organ transplant recipient, or receiving anti-viral therapy (claim 99); wherein at step b), the sample comprising CTLs is incubated with the pool of immunogenic peptides for at least 14 days (claim 14), further comprising incubating the exposed sample of step b) with IL-21 on day 0 and/or IL-2 on day 2 (claim 15), further comprising adding IL-2 during step b) every three days (claim 17); further comprising administering the CTLs harvested from step c) to a subject suffering from a CMV infection (claim 18); and isolated CTLs prepared by the method of claim 7, wherein said isolated CTLs are those which are harvested in step c) of the method (claim 20). Claim 21 is drawn to a method of treating CMV infection in a subject, comprising administering to the subject the CTLs of claim 20. Further limitations on the method of claim 21 are wherein the CTLs administered to the subject are autologous (claim 23); wherein at least 5%, at least 10%, at least 20%, at least 60%, or at least 90% of the CTLs express CD107a (claim 28); wherein at least 5%, at least 10%, at least 20%, at least 60%, or at least 90%, of the CTLs express IFN-gamma (claim 33); wherein at least 5%, at least 10%, at least 20%, at least 60%, or at least 90% of the CTLs express TNF (claim 38); wherein at least 1%, at least 5%, at least 10%, or at least 20% of the CTLs express IL-2 (claim 43); and wherein at least 20%, at least 43%, at least 55%, or at least 90% of the CTLs express CD107a, IFN-gamma, and TNF (claim 47). Claim 93 is drawn to a method of reducing CMV viral load in a subject that has received a solid organ transplant by administering to the subject the CTLs of claim 20. Claim 94 is drawn to a method of treating or preventing CMV-associated end organ disease in a subject that has received a solid organ transplant by administering to the subject the CTLs of claim 20. Claim 95 is drawn to a method of reducing or eliminating the need for anti-viral therapy in a subject that has received a solid organ transplant by administering to the subject the CTLs of claim 20. Claim Rejections - 35 USC § 102 The text of those sections of Title 35, U.S. Code not included in this action can be found in a prior Office action. (Rejection withdrawn.) The rejection of Claim 2 under 35 U.S.C. 102(a)(1) as being anticipated by Cobbold et. al. (US20140004081A1, Pub. 01/02/2014; CITED ART OF RECORD; hereafter “Cobbold”) is withdrawn in light of the amendments to the claims. (New rejection – necessitated by amendment.) Claim 2 is rejected under 35 U.S.C. 102(a)(1) as being anticipated by Khanna-2005 et. al. (US20050019344A1; Pub. 04/28/2009; hereafter “Khanna-2005”.) The Prior Art Khanna-2005 teaches cytotoxic T cell (CTL) epitope peptides and polyepitope peptides from 14 distinct antigens of human cytomegalovirus (HCMV)(entire document; see abstract.) Said epitopes would preferentially have HLA class I (CTL/CD8+ T cell) epitopes, but may also have both CD4+ and CD8+ epitopes to have both CTL and helper T cell epitope stimulation ability (¶[0192]). Khanna-2005 teaches the peptides may be from known CMV antigens, such as pp50 (UL44)(¶[0143-0145]), pp65 (UL83)(¶[0146-0147]), glycoprotein B (gB or UL55)(¶[0152-0154]), glycoprotein H (gH or UL75)(¶[0155-0157]), and IE-1 (UL123)(¶[0158-0159]). Khanna-2005 teaches peptides from each of these antigens which align with 100% identity to instant peptide sequences (see table infra). Said peptides may comprise adjuvants (¶[0217][0261]). Therefore, Khanna-2005 teaches the limitations of instant claim 2. Khanna-2005 teaches methods of producing CTLs through exposure of isolated peripheral blood mononuclear cells (PBMCs) isolated from healthy seropositive donors, followed by stimulating, expanding, and harvesting said CMV-specific CTLs (¶[0322-0326][0343]). Khanna-2005 teaches the T cells are cultured in the presence of a cytokine, such as IL-2 (¶[0088][0285]). The stimulated CTLs may be used to treat CMV infection in a subject (¶[0080]), such as a subject who has an HIV infection, is undergoing drug-induced immunosuppression (¶[0029]), or has undergone an organ transplant (¶[0030][0089][0332]), and may be autologous (¶[0105]) or allogenic (¶[0124]). The stimulated CTLs can have their activity measured through the expression of such markers as IFN-gamma (¶[0068]) or IL-2 (¶[0285]). For at least these reasons, Khanna-2005 teaches the limitations of instant claim 2 and anticipates the invention encompassed by said claim. (New rejection – necessitated by amendment.) Claim 2 is rejected under 35 U.S.C. 102(a)(1) as being anticipated by Sampson et. al. (US20160213771A1; Pub. 07/28/2016; hereafter “Sampson”) as evidenced by Khanna-2005 et. al. (US20050019344A1; Pub. 04/28/2009; hereafter “Khanna-2005”.) The Prior Art Sampson teaches compositions, methods, and kits for eliciting an immune response to at least one CMV antigen expressed by a cancer cell, in particular for treating and preventing cancer (entire document; see abstract.) Sampson teaches the peptides would be 800 amino acids or fewer, and would range in size from 800 amino acids to 6 amino acids (¶[0120]). Sampson teaches the CMV peptide epitopes would comprise a mix of HLA class I and II peptides, as the immunologically active peptides would be useful to stimulate both CD8+ T cells and CD4+ T cells (¶[0094]). Sampson teaches the CMV epitopes would be derived from CMV proteins such as gB (UL55), IE1 (UL123), pp65 (UL83), and gH (UL75)(¶[0091-0093]), and would further include those antigens taught by Khanna-2005, which is incorporated by reference in its entirety (¶[0095]). Khanna-2005 teaches the peptide pools may comprise adjuvants (¶[0102]). As Khanna-2005 teaches that the CMV peptide pool may comprise adjuvants and peptides from gB, IE1, pp65, gH, and UL44 (pp50)(see detailed teachings supra of Khanna-2005), Sampson, as evidenced by the teachings of Khanna-2005, teaches the limitations of instant claim 2. As shown in the table below, Sampson or Khanna-2005 teach all except 7 of the epitopes of instant SEQ ID NOs: 1-31. Instant SEQ ID NO: CMV Protein Sequence Sampson SEQ ID NO: Khanna-2005 SEQ ID NO: 1 pp50 (UL44) VTEHDTLLY 140 165 2 pp65 YSEHPTFTSQY N/A 70 3 pp65 NLVPMVATV 132 5 4 IE1 VLEETSVML 180 101 5 IE1 YILEETSVML N/A YILEETSVM (SEQ ID NO: 18) 6 IE1 AYAQKIFKIL 187 116 7 Pp65 QYDPVAALF 141 33 8 Pp65 TPRVTGGGAM 151 88 9 Pp65 RPHERNGFTVL N/A 89 10 IE1 ELRRKMMYM N/A 112 11 IE1 ELKRKMIYM N/A N/A 12 IE1 QIKVRVDMV 194 113 13 IE1 DELRRKMMY N/A N/A 14 Pp65 IPSINVHHY 158 67 15 Pp65 CPSQEPMSIYVY N/A 66 16 Pp65 CEDVPSGKL N/A 48 17 Pp65 HERNGFTVL N/A 9 18 IE1 EEAIVAYTL N/A N/A 19 Pp65 QEFFWDANDIY N/A 56 20 Pp65 TRATKMQVI N/A 62 21 gB YAYIYTTYL N/A 189 22 Pp65 QAIRETVEL 145 80 23 IE1 CRVLCCYVL 190 N/A 24 gH HELLVLVKKAQL N/A 249 25 gB DYSNTHSTRYV N/A 191 26 Pp65 QEFFWDANDIYRIFA N/A 107 27 gB CMLTITTARSKYPYH N/A N/A 28 Pp65 PLKMLNIPSINVHHY 163 N/A 29 Pp65 EHPTFTSQYRIQGKL N/A 70 30 Pp65 AGILARNLVPMVATV 135 N/A 31 IE1 KARAKKDELR N/A N/A Sampson teaches wherein samples from a patient comprising CTLs are isolated, exposed to the peptide pools, resulting stimulated CTLs are harvested and then re-infused back into the same or different subject (¶[0102]). Sampson teaches the dosage will depend on the health of the subject (¶[0153-0154]), and PBMCs can be harvested and stimulated from healthy patients, immunosuppressed patients undergoing transplants, and those with cancer (¶[0041][0045][0308][0321][0357]). Sampson teaches the CTLs can be expanded within 14 days (¶[0308]) and that said cells could be incubated with IL-2 on day 3 for 48 hours (¶[0044][0302]). The CTLs can be given to a patient with an active or latent CMV infection (¶[0101][0352]) and can be an autologous lymphocyte transfer (ALT) (¶[0359][0362]) or an allogenic transfer (¶[0102]). The cells after ex vivo stimulation would be analyzed for IFN-gamma production, TNF-alpha production, IL-2 production, and polyfunctionality through analysis of granzyme activation marker CD107a (¶[0041]; Fig. 7). The CTLs can also be used in transplant recipients to reduce their susceptibility to CMV infection (¶[0096][0230][0346-0350]; Table 2). For at least these reasons, Sampson, as evidenced by Khanna-2005, teaches the limitations of instant claim 2 and anticipates the invention encompassed by said claim. Claim Rejections - 35 USC § 103 The text of those sections of Title 35, U.S. Code not included in this action can be found in a prior Office action. (Rejection withdrawn.) The rejection of Claims 1, 4, 7, 9, 14-15, 17-18, 20-21, 23, 33 under 35 U.S.C. 103 as being unpatentable Cobbold as applied to claim 2 above, and further in view of Sylwester et. al. (Sylwester AW, et. al. J Exp Med. 2005 Sep 5;202(5):673-85.; hereafter “Sylwester”), Dander et. al. (Dander E, et. al. Exp Hematol. 2008 Apr;36(4):473-85. Epub 2008 Feb 8.; CITED ART OF RECORD; hereafter “Dander”), Sijmons et. al. (Sijmons S, et. al. PLoS One. 2014 Apr 22;9(4):e95501. and associated deposit Sijmons S, et. al. Regulatory protein IE1 [Human betaherpesvirus 5]. GenBank: AHB19584.1. Dep. 29 Apr 2014.; hereafter “Sijmons”); and Hall et. al. (Hall CE, et. al. PLoS One. 2017 Aug 11;12(8):e0178763.; hereafter “Hall”) is withdrawn in light of the amendments to the claims. (Rejection withdrawn.) The rejection of Claims 21, 23, 28, 33, 38, 43, 47, 93-95, and 99 under 35 U.S.C. 103 as being unpatentable over Sylwester, Cobbold, Dander, Sijmons, and Hall as applied to claims 1-2, 4, 7, 9, 14-15, 17-18, 20-21, 23, 33 above, and further in view of Khanna et. al. (US20150273051A1, Pub. 10/01/2015; hereafter “Khanna”) is withdrawn in light of the amendments to the claims. (New rejection – necessitated by amendment.) Claims 1, 7, 9, 14-15, 17-18, 20-21, 23, 33 are rejected under 35 U.S.C. 103 as being unpatentable over Sampson and Khanna-2005 as applied to claim 2 above, and further in view of Sylwester et. al. (Sylwester AW, et. al. J Exp Med. 2005 Sep 5;202(5):673-85.; CITED ART OF RECORD; hereafter “Sylwester”), Sijmons et. al. (Sijmons S, et. al. PLoS One. 2014 Apr 22;9(4):e95501. and associated deposit Sijmons S, et. al. Regulatory protein IE1 [Human betaherpesvirus 5]. GenBank: AHB19584.1. Dep. 29 Apr 2014.; CITED ART OF RECORD; hereafter “Sijmons”); Cobbold et. al. (US20140004081A1, Pub. 01/02/2014; CITED ART OF RECORD; hereafter “Cobbold”); Dander et. al. (Dander E, et. al. Exp Hematol. 2008 Apr;36(4):473-85. Epub 2008 Feb 8.; CITED ART OF RECORD; hereafter “Dander”); and Hall et. al. (Hall CE, et. al. PLoS One. 2017 Aug 11;12(8):e0178763.; CITED ART OF RECORD; hereafter “Hall”.) The Prior Art The teachings of Khanna-2005 and Sampson have been set forth supra. While Khanna-2005 and Sampson teach the generation of CMV peptide pools which comprise peptides from the CMV proteins UL44, pp65, gB, gH, and IE-1, as well as said peptide pools further comprising adjuvants, and while Khanna-2005 and Sampson teach many of the same peptides of the instant claims, neither Khanna-2005 nor Sampson teach every peptide as comprised within instant SEQ ID NOs: 1-31. However, important epitopes from CMV were known and described in the art, as evidenced by the further teachings of Sijmons, Cobbold, Sylwester, Dander, and Hall. Cobbold teaches T cell antigens, especially T cell antigens from cytomegalovirus (entire document; see esp. reference claims 1, 10-12; ¶[0040][0069-0070]). Cobbold teaches the antigens from CMV (aka HHV5) can be from IE-1, UL55 (gB), UL83 (pp65), pp50, and UL75 (gH), and that short peptides from said antigens may be used (¶[0070-0073]). Cobbold teaches HLA Class II-restricted CMV epitope sequences that are 100% identical to instant SEQ ID NOs: 24, 25, 27 and 30, and peptides identical to instant SEQ ID NOs: 1-4, 8-15, 18, and 23 as HLA class I-restricted CMV epitopes (¶[0072-0075]). Cobbold teaches compositions which comprise one or more of these peptides, and that the compositions may be pharmaceutical compositions comprising pharmaceutically acceptable carriers, diluents, or excipients, such as sterile or pyrogen free water or saline (¶[0070][0153-0156][0160-0175]). Cobbold teaches peptide pools of CMV antigens, which are 15-mers from such CMV proteins as gB, IE1, and pp65, and teaches the predominant CD4+ and CD8+ T cell responses for each CMV ORF (¶[0070]). Cobbold teaches these peptides may be used in methods of adoptive or re-directed immunotherapy (entire document; see ¶[0002][0006-0008][0076-0078]). Instant SEQ ID NO: Cobbold SEQ ID NO: Peptide CMV Protein 1 44 VTEHDTLLY pp50 2 20 YSEHPTFTSQY pp65 3 21 NLVPMVATV pp65 4 4 VLEETSVML IE-1 8 31 TPRVTGGGAM pp65 9 32 RPHERNGFTVL pp65 10 9 ELRRKMMYM IE-1 11 10 ELKRKMIYM IE-1 12 11 QIKVRVDMV IE-1 13 16 DELRRKMMY IE-1 14 33 IPSINVHHY pp65 15 35 CPSQEPMSIYVY pp65 18 18 EEAIVAYTL IE-1 23 8 CRVLCCYVL pp65 24 60 HELLVLVKKAQL gH 25 55 DYSNTHSTRYV gB 27 56 CMLTITTARSKYPYH gH 30 53 AGILARNLVPMVATV pp65 Sylwester teaches that they generated a CMV peptide pool for every CMV ORF (entire document; see abstract.) Sylwester teaches that they generated a CMV peptide pool to determine an overall response to CMV infection, and included overlapping 15-mer peptides from open reading frames (ORFs) UL55 (gB), UL83 (pp65), UL86, UL99, UL153, and UL32 (p. 682, left col., ¶2). Sylwester teaches the sequences for UL55 and UL83 used in their studies (Supp. Table 1; see below); a search of said sequences notes that SEQ ID NOs: 25-29 were all present at 100% identity. Consecutive 15mer peptides, overlapping by 10 amino acids, were designed for each ORF (p. 683, left col., ¶3). Therefore, Sylwester teaches the peptide pools may comprise peptides from an individual ORF, such as gB or pp65, or a peptide pool comprised of peptides from multiple CMV ORFs. pp65 (UL83): (underlined in order SEQ ID NO: 28, SEQ ID NO: 29, and SEQ ID NO: 26) MESRGRRCPEMISVLGPISGHVLKAVFSRGDTPVLPHETRLLQTGIHVRVSQPSLILVSQYTPDSTPCHRGDNQLQVQHTYFTGSEVENVSVNVHNPTGRSICPSQEPMSIYVYALPLKMLNIPSINVHHYPSAAERKHRHLPVADAVIHASGKQMWQARLTVSGLAWTRQQNQWKEPDVYYTSAFVFPTKDVALRHVVCAHELVCSMENTRATKMQVIGDQYVKVYLESFCEDVPSGKLFMHVTLGSDVEEDLTMTRNPQPFMRPHERNGFTVLCPKNMIIKPGKISHIMLDVAFTSHEHFGLLCPKSIPGLSISGNLLMNGQQIFLEVQAIRETVELRQYDPVAALFFFDIDLLLQRGPQYSEHPTFTSQYRIQGKLEYRHTWDRHDEGAAQGDDDVWTSGSDSDEELVTTERKTPRVTGGGAMAGASTSAGRKRKSASSATACTSGVMTRGRLKAESTVAPEEDTDEDSDNEIHNPAVFTWPPWQAGILARNLVPMVATVQGQNLKYQEFFWDANDIYRIFAELEGVWQPAAQPKRRRHRQDALPGPCIASTPKKHRG gB (UL55): (underlined in order SEQ ID NO: 25, SEQ ID NO: 27) MESRIWCLVVCVNLCIVCLGAAVSSSSTSHATSSTHNGSHTSRTTSAQTRSVYSQHVTSSEAVSHRANETIYNTTLKYGDVVGVNTTKYPYRVCSMAQGTDLIRFERNIICTSMKPINEDLDEGIMVVYKRNIVAHTFKVRVYQKVLTFRRSYAYIYTTYLLGSNTEYVAPPMWEIHHINKFAQCYSSYSRVIGGTVFVAYHRDSYENKTMQLIPDDYSNTHSTRYVTVKDQWHSRGSTWLYRETCNLNCMLTITTARSKYPYHFFATSTGDVVYISPFYNGTNRNASYFGENADKFFIFPNYTIVSDFGRPNAAPETHRLVAFLERADSVISWDIQDEKNVTCQLTFWEASERTIRSEAEDSYHFSSAKMTATFLSKKQEVNMSDSALDCVRDEAINKLQQIFNTSYNQTYEKYGNVSVFETSGGLVVFWQGIKQKSLVELERLANRSSLNITHRTRRSTSDNNTTHLSSMESVHNLVYAQLQFTYDTLRGYINRALAQIAEAWCVDQRRTLEVFKELSKINPSAILSAIYNKPIAARFMGDVLGLASCVTINQTSVKVLRDMNVKESPGRCYSRPVVIFNFANSSYVQYGQLGEDNEILLGNHRTEECQLPSLKIFIAGNSAYEYVDYLFKRMIDLSSISTVDSMIALDIDPLENTDFRVLELYSQKELRSSNVFDLEEIMREFNSYKQRVKYVEDKVVDPLPPYLKGLDDLMSGLGAAGKAVGVAIGAVGGAVASVVEGVATFLKNPFGAFTIILVAIA VVIITYLIYTRQRRLCTQPLQNLFPYLVSADGTTVTSGSTKDTSLQAPPSYEESVYNSGRKGPGPPSSDASTAAPPYTNEQAYQMLLALARLDAEQRAQQNGTDSLDGQTGTQDKGQKPNLLDRLRHRKNGYRHLKDSDEEENV Both Cobbold and Sylwester teach CMV compositions comprising 15mer peptides, and teach that said peptides may be from any CMV ORF, including gB, pp65, IE1, gH (UL75), and pp50. Cobbold teaches peptides which are 100% identical to instant SEQ ID NOs: 24, 25, 27 and 30, and peptides identical to instant SEQ ID NOs: 1-4, 8-15, 18, and 23 as HLA class I-restricted CMV epitopes. Sylwester teach ORFs which comprise SEQ ID NOs: 25-29 at 100% identity, however, said 15mers of Sylwester do not all appear to comprise the claimed sequences in full (e.g. overlapping 15mers of the pp65 sequence would mean SEQ ID NO: 28 would be truncated at the C-terminus by 1 aa). Dander teaches T cell epitopes from CMV proteins that align with 100% identity to those of the instant invention, and at least one that is 100% identical save for a 2aa deletion (SEQ ID NOs: 26, 28-29, See Table 1, See table below). Dander teaches peptides from CMV proteins, such as pp65, pp50, and IE1 (Table 1). Dander teaches collection of leukocytapheresis products from 13 CMV-seropositive donors, wherein said products are separated into monocytes or lymphocytes, and then CMV-specific T-cell lines were generated (p. 476, left col., “Generation of CMV-specific T-cell lines”), wherein said CMV-specific T-cell lines were incubated with a pooled peptide library identified as immunogenic for CD4 and CD8 responses with HLA class I and II antigens from CMV proteins pp65, pp50, pp150, and IE1 for 24 days, and CD8+ stimulated T cells were isolated and analyzed for their bioactivity (pp. 474-6, “Materials and Methods”, See esp. “Peptide library”, “Preparation of CMV-specific T-cell lines”, “Flow cytometric analysis”, and “Staining with MHC-peptide multimers”; instant claims 7, 9, 14, 20). Said T-cells were incubated with IL-2 starting at day +7 and was added at 50 U/mL until the end of the culture (instant claims 15 and 17.) Dander teaches their experiments allow for the use of said expanded T cells in vivo as they were expanded under GMP conditions and did not use virus-infected or CMV lysate pulsed antigen presenting cells (p. 474, left col., ¶3) and that adoptive transfer of CMV-specific T cells can be used upon isolation of those T cells which express the correct pattern of adhesion molecules which allow them to migrate to the infected cell sites (p. 474, left col., ¶2; instant claim 18, 21). Dander teaches the T cells administered were autologous (p. 477, left col., ¶2; instant claim 23). Dander teaches analysis of IFN-gamma production, wherein anywhere from 36-66% of the CD8+ T cells produced IFN-gamma (Fig. 4B; instant claim 33). Instant SEQ ID NO: Dander CMV Protein Sequence 25 N/A gB DYSNTHSTRYV 26 KYqeffwdandiyri pp65 qeffwdandiyrifa 27 N/A gH CMLTITTARSKYPYH 28 100% pp65 PLKMLNIPSINVHHY 29 100% gH EHPTFTSQYRIQGKL Sylwester at Supplemental Table 1 teaches full-length sequences for IE1, pp50 (UL44), gB, gH, and pp65 which comprise SEQ ID NOs: 1-4, 6-10, and 12-31 at 100% identity (see table below) and comprise SEQ ID NOs: 5 and 11 with 1 aa change (YVLEETSVML) and 2 aa change (ELRRKMMYM), respectively (see table below; See attached appendix for full length sequences of IE1, pp50, gB, gH, and pp65). Sylwester only utilized sequences from laboratory strains of CMV known at the time of publication, and highlighted the importance of looking at different ORFs and strain-specific sequences (p. 680, ¶ bridging cols.) Sylwester also notes the broad T cell response to CMV infection is beyond the previously noted pp65 and IE-1 antigens, and directly teaches that a variety of CMV antigens stimulate a variety of T cell responses (p. 681, rt. Col.) Sijmons teaches that further clinical and laboratory isolates have been sequenced, and teaches further techniques for high-throughput sequencing of CMV clinical isolates (entire document; see abstract.) Sijmons teaches AHB19584.1, which is an IE1 sequence that comprises mutations compared to Sylwester’s AD169 sequence, and teaches a sequence that comprises SEQ ID NO:5 at 100%. Instant SEQ ID NO: CMV Protein Sequence Taught with 100% Identity by: 1 pp50 VTEHDTLLY Sylwester 2 pp65 YSEHPTFTSQY Sylwester 3 pp65 NLVPMVATV Sylwester 4 IE1 VLEETSVML Sylwester 5 IE1 YILEETSVML Sijmons 6 IE1 AYAQKIFKIL Sylwester 7 Pp65 QYDPVAALF Sylwester 8 Pp65 TPRVTGGGAM Sylwester 9 Pp65 RPHERNGFTVL Sylwester 10 IE1 ELRRKMMYM Sylwester 11 IE1 ELKRKMIYM Cobbold 12 IE1 QIKVRVDMV Sylwester 13 IE1 DELRRKMMY Sylwester 14 Pp65 IPSINVHHY Sylwester 15 Pp65 CPSQEPMSIYVY Sylwester 16 Pp65 CEDVPSGKL Sylwester 17 Pp65 HERNGFTVL Sylwester 18 IE1 EEAIVAYTL Sylwester 19 Pp65 QEFFWDANDIY Sylwester 20 Pp65 TRATKMQVI Sylwester 21 gB YAYIYTTYL Sylwester 22 Pp65 QAIRETVEL Sylwester 23 IE1 CRVLCCYVL Sylwester 24 gH HELLVLVKKAQL Sylwester 25 gB DYSNTHSTRYV Sylwester 26 Pp65 QEFFWDANDIYRIFA Sylwester 27 gB CMLTITTARSKYPYH Sylwester 28 Pp65 PLKMLNIPSINVHHY Sylwester 29 Pp65 EHPTFTSQYRIQGKL Sylwester 30 Pp65 AGILARNLVPMVATV Sylwester 31 IE1 KARAKKDELR Sylwester Hall teaches analysis of CMV peptides that also have human peptide matches (entire document; see abstract), and teaches that the entire set of known CMV sequences and ORFs was input into a database to cross match relevant HLA class I bound CMV peptides and determine which peptides had a corresponding peptide in the human genome (p. 4, ¶3). Hall therefore teaches that there were bioinformatics tools and programs available to determine peptide antigens from all known CMV sequences. Given that generation of CMV peptide pools to stimulate CD4 and CD8 T cells were known in the art at the time of filing, as evidenced by Khanna-2005 and Sampson and further evidenced by Sylwester and Cobbold, and given that Khanna-2005 and Sampson teach generation of CMV peptide pools comprising the known important CMV antigens pp65, UL44, gH, IE-1, and gB, given that bioinformatics to identify important CMV antigens were known in the art, as evidenced by Hall, and given that CMV sequences and antigens were known in the art, as evidenced by Khanna-2005, Sampson, Sylwester, Sijmons, Cobbold, Dander, and Hall, one of skill in the art would have found it obvious to arrive at the combination of peptides of instant claim 1, namely peptide pools that included the sequences of SEQ ID NOs: 1-31. Further, as both Sampson and Khanna-2005 teach generation of peptide pools comprising HLA class I and II epitopes from UL44, gB, gH, IE-1, and pp65, and teach methods of expanding CTLs from CMV seropositive individuals, and given that protocols for this CTL stimulation were known in the art, as evidenced by the teachings of Sampson, Khanna-2005, and Dander, one of skill would find it obvious to arrive at the methods and products of instant claims 7, 9, 14-15, 17-18, 20-21, 23, 28, 33, 38, 43, 47, 93-95, and 99. It would have been obvious to one of ordinary skill in the art to modify the methods and compositions taught by Khanna-2005 or Sampson in order to add specific CMV peptide antigens to their CMV antigen pools, thereby providing a pool of peptides that would theoretically target a larger swath of antigens important within different HLA populations, especially given that bioinformatics tools to prevent alloreactivity were known in the art, as taught by Hall. One would have been motivated to do so, given the suggestion by Dander, Cobbold, Khanna-2005, Sampson, Sylwester, and Sijmons as to the antigens to use from the specific CMV proteins. There would have been a reasonable expectation of success, given the knowledge that there were known sequence variants for CMV proteins, as taught by Sylwester and Sijmons, and also given the knowledge that these sequences could be easily determined and analyzed, as taught by Sijmons and Hall. There would have been further reasonable expectation of success in arriving at the claimed methods and CTL populations, as protocols for CTL stimulation and expansion were known in the art, as evidenced by the teachings of Khanna-2005, Sampson, and Dander. Thus, the invention as a whole was clearly prima facie obvious to one of ordinary skill in the art at the time the invention was made. Response to Arguments Applicant's arguments filed 10/21/2025 have been fully considered but they are not entirely persuasive. It should be noted that while the anticipation rejection regarding Cobbold was withdrawn, the teachings of Cobbold were still relevant to the obviousness rejections, and were therefore utilized in the new obviousness rejection herein. Likewise, the original obviousness rejection was withdrawn, but the same art references utilized in the prior obviousness rejection were utilized in the new obviousness rejection. In the interest of compact prosecution, the arguments regarding the teachings of Cobbold, Khanna-2005, Sampson, Sylwester, Sijmons, Dander, and Hall will be addressed as applicable to the new rejection herein. In response to applicant's arguments against the references individually, one cannot show nonobviousness by attacking references individually where the rejections are based on combinations of references. See In re Keller, 642 F.2d 413, 208 USPQ 871 (CCPA 1981); In re Merck & Co., 800 F.2d 1091, 231 USPQ 375 (Fed. Cir. 1986). With respect to the anticipation teachings over Cobbold, as Cobbold fails to teach the inclusion of an adjuvant in the peptide pool, the anticipation rejection was withdrawn. Applicant argues that Cobbold fails to teach the presence of both HLA class I and class II epitopes in the same peptide pool. Cobbold nowhere specifically excludes the presence of one class when another is present, and at ¶[0060] notes that when they refer to “T cell”, they are including all types of T cells, including CD4+ and CD8+. At ¶[0061-0064], the language continues to include eliciting a response from both T cell types, and notes at ¶[0064] the antigen may bind to both class I and class II. While Cobbold is no longer the primary reference, and Khanna-2005 and Sampson clearly teach peptide pools which comprise mixtures of MHC class I and II antigens, it is not entirely convincing that Cobbold fails to teach peptide compositions with only one class of antigen. Applicant also argues that while Cobbold teaches antigens from CMV, Cobbold fails to teach each within the same composition. Again, as Cobbold is no longer the primary reference, and Khanna-2005 and Sampson clearly cure this deficiency, Cobbold is not relied upon for this teaching, but for the rationale above, and that Cobbold teaches compositions which “comprise” the noted antigens, it is unconvincing that Cobbold teaches away from or fails to teach compositions which could comprise multiple antigens. Applicant then argues that the remaining references fail to cure the deficiencies of Cobbold. As Cobbold is no longer the primary reference, this general argument is moot. Applicant argues that while Sylwester teaches generation of overlapping CMV peptides to determine the immune response to each known CMV ORF, that Sylwester fails to provide motivation to generate the peptide pool of claim 1 or 2, and fails to teach all of SEQ ID NOs: 1-31. With respect to the new obviousness rejection, it should be noted that the obvious nature of claim 1 is not solely in view of Sylwester, Dander, Sijmons, or Hall and Khanna-2005 and Sampson, but the combination of all references - Khanna-2005, Sampson, Sylwester, Cobbold, Sijmons, Dander, and Hall. Applicant additionally argues surprising and unexpected results. Applicant points to the data in Fig. 1A-E and Table 3, in that CMV-specific T cells were successfully expanded from 20 out of the 21 patient blood samples, and the T cells were predominantly CD3+CD8+ with a median specificity of 51.2%. Applicant argues enhanced functionality with in vitro expansion, with clinical responses showing improved responsiveness to antiviral therapy and reduction or resolution of active CMV infection. However, such an argument is not commensurate in scope with the breadth of the claimed invention. The peptide pool was that which only consisted of those CMV peptides which consisted of SEQ ID NOs: 1-31, with at least one patient receiving a supplement of the IE-1 epitope HLA-B*31:01 KARAKKDELR (KAR) (Table 1, ¶[0033-0034]). The stimulation was done in the presence of IL-21, using a specific stimulation method that comprised further IL-2 supplementation (¶[0121]). The specific CMV peptide pools were exposed to patients who had undergone solid organ transplantation (SOT) and were CMV seropositive, with active or persistent CMV disease or replication (¶[0113]). It is not clear if healthy CMV seropositive patients were tested for their ability to stimulate CD4+ and/or CD8+ T cells in the presence of the peptide pools. It is not clear if the stimulated peptides were tested in allogenic T cell therapy for their usefulness. It is not clear if other adjuvants would have the same effect on the T cell stimulation as IL-21. It is not clear if the peptides could include additional amino acids beyond those used in Table 1 (e.g. if said peptides could be a part of a longer, multi-epitope polypeptide or comprised within longer native peptide sequences) or if the compositions could include/comprise peptides beyond SEQ ID NOs: 1-31. There is nothing surprising or unexpected about the pools of peptides claimed in instant claims 1 or 2, and the methods are not surprising in light of the prior art and the breadth of the instant claims. Khanna-2005 and Sampson teach the majority of the peptides comprised in the peptide pool of instant claims 1 and 2, and the art either taught those which were not present or provided motivation, teachings, and skills as to how to generate CMV peptide pools of HLA class I and II antigens with immunogenic importance. One suggestion to overcome the obvious nature is to claim compositions which consist of peptide sequences and adjuvants which provided the surprising/unexpected results, wherein said peptides consist of the sequences of SEQ ID NOs: 1-31. As the criticality of parameters to arrive at the unexpected or surprising results is not identified, specifically with regards to the claimed methods, and there is no functional language in the product claims that would aid in an argument of surprising or unexpected results, such an argument is unpersuasive in light of the prior art. For at least these reasons, Applicants arguments are not persuasive, and the claims remain rejected as being anticipated or obvious for the reasons outlined above. Double Patenting The text regarding nonstatutory double patenting was presented in a previous Office action. (Rejection maintained in part – necessitated by amendment.) Claims 1-2, 7, 9, 14-15, 17-18, 20-21, 23, 28, 33, 38, 43, 47, 93-95, and 99 remain provisionally rejected on the ground of nonstatutory double patenting as being unpatentable over claims 1-51 and 56-57 of copending Application No. 18/798,113 (reference application) in view of Sylwester and Khanna (supra). The rejection of instant claim 4 is withdrawn in light of the cancellation of said claim. The rationale behind this rejection was set forth in a previous Office action and will not be repeated herein. Response to Arguments Applicant has requested that the non-statutory obviousness-type double patenting rejection be held in abeyance until allowable subject matter is indicated in the present application. However, said rejection must be maintained as a matter of record until the appropriate terminal disclaimers have been filed, or until the claims have been amended in such a way as to not claim patently identical subject matter. Conclusion No claims are allowed. Any inquiry concerning this communication or earlier communications from the examiner should be directed to RACHEL B GILL whose telephone number is (571)272-3129. The examiner can normally be reached on M to F 8:00 AM to 5:00 PM Eastern. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, JANET ANDRES can be reached on 571-272-0867. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of an application may be obtained from the Patent Application Information Retrieval (PAIR) system. Status information for published applications may be obtained from either Private PAIR or Public PAIR. Status information for unpublished applications is available through Private PAIR only. For more information about the PAIR system, see http://pair-direct.uspto.gov. Should you have questions on access to the Private PAIR system, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative or access to the automated information system, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /RACHEL B GILL/Primary Examiner, Art Unit 1671
Read full office action

Prosecution Timeline

Jul 01, 2021
Application Filed
Feb 09, 2024
Non-Final Rejection — §101, §102, §103
Jun 13, 2024
Response Filed
Oct 02, 2024
Non-Final Rejection — §101, §102, §103
Apr 04, 2025
Response Filed
Apr 16, 2025
Final Rejection — §101, §102, §103
Oct 21, 2025
Request for Continued Examination
Oct 22, 2025
Response after Non-Final Action
Oct 24, 2025
Non-Final Rejection — §101, §102, §103 (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12600751
MODIFIED S2 SUBUNIT OF THE CORONAVIRUS SPIKE PROTEIN
2y 5m to grant Granted Apr 14, 2026
Patent 12584918
MULTIPLEXED LATERAL FLOW ASSAY FOR DETECTION OF HPV ASSOCIATED CANCER
2y 5m to grant Granted Mar 24, 2026
Patent 12582684
COMPOSITIONS AND METHODS FOR THE TREATMENT OF WOUNDS, DISORDERS, AND DISEASES OF THE SKIN
2y 5m to grant Granted Mar 24, 2026
Patent 12584146
SYNTHETIC MODIFIED VACCINIA ANKARA (SMVA) BASED CORONAVIRUS VACCINES
2y 5m to grant Granted Mar 24, 2026
Patent 12564628
EPSTEIN-BARR VIRUS NUCLEIC ACID CONSTRUCTS AND VACCINES MADE THEREFROM, AND METHODS OF USING SAME
2y 5m to grant Granted Mar 03, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

AI Strategy Recommendation

Get an AI-powered prosecution strategy using examiner precedents, rejection analysis, and claim mapping.
Powered by AI — typically takes 5-10 seconds

Prosecution Projections

4-5
Expected OA Rounds
66%
Grant Probability
93%
With Interview (+27.8%)
2y 7m
Median Time to Grant
High
PTA Risk
Based on 848 resolved cases by this examiner. Grant probability derived from career allow rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month