Prosecution Insights
Last updated: April 19, 2026
Application No. 17/139,232

Production of Omega-3 Long Chain Polyunsaturated Fatty Acids

Non-Final OA §112
Filed
Dec 31, 2020
Examiner
ZHONG, WAYNESHAOBIN
Art Unit
1662
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
Rothamsted Research Ltd.
OA Round
7 (Non-Final)
72%
Grant Probability
Favorable
7-8
OA Rounds
3y 0m
To Grant
94%
With Interview

Examiner Intelligence

Grants 72% — above average
72%
Career Allow Rate
377 granted / 524 resolved
+11.9% vs TC avg
Strong +22% interview lift
Without
With
+22.3%
Interview Lift
resolved cases with interview
Typical timeline
3y 0m
Avg Prosecution
28 currently pending
Career history
552
Total Applications
across all art units

Statute-Specific Performance

§101
8.0%
-32.0% vs TC avg
§103
29.4%
-10.6% vs TC avg
§102
13.6%
-26.4% vs TC avg
§112
34.3%
-5.7% vs TC avg
Black line = Tech Center average estimate • Based on career data from 524 resolved cases

Office Action

§112
DETAILED ACTION Notice of Pre-AIA or AIA Status The present application is being examined under the pre-AIA first to invent provisions. Status of claims Claims 1-42, 45, 47, 51-52, 54-65, 66, 68-69 had/have been canceled. Claims 43, 67 have been amended. New claims 70-80 are added. Note: On 12/22/2021, applicant elected Group I, claims 43-53, 60-62, without traverse. The non-elected claimed had been canceled by the applicant. Applicant elected species Δ6-desaturase (SEQ ID NO: 2), Δ6-elongase (SEQ ID NO: 4), and Δ5-desaturase (SEQ ID NO: 6), without traverse. New claim 72 and dependent claims are drawn to a different subject matter from the elected claims. The claims require different oil composition and different transgenes. For example, GLA is required by the elected claim 43, but is optional in new claim 72; delta5 elongase and delta4-desaturase are not required by the elected claim 43, but are required by the new claim 72. In addition, new claim 72 does not require “from a single oilseed plant”. Furthermore, new claim 72 was not in any of the previous claim set. Thus, claims 72-80 would have been restricted, thus, are withdrawn. In summary, claims 43-44, 46, 48-50, 53, 67, and new claims 70-71 are examined in the office action. Non-elected species are withdrawn. New claims 72-80 are withdrawn. All previous objections and rejections not set forth below have been withdrawn in view of Applicant’s amendment and/or upon further consideration. See “Response to Arguments” at the end of office action. The following rejections are repeated, modified and/or added for the reasons of record as set forth in the last Office action of 9/24/2024, and/or necessitated by the applicant’s amendments. Applicant’s arguments filed 3/24/2025 have been thoroughly considered but are not deemed fully persuasive. Claim Objections The amended claim 43 is objected to because of the following informality: In the last line, the “a Δ6-desatuase, a Δ6-elongase and, a Δ5-desatuase” is grammatically in correct, should be --- a Δ6-desatuase, a Δ6-elongase, and a Δ5-desatuase ---, instead. See the requirement of 37 CFR 1.71(a) for “full, clear, and exact terms”. Appropriate correction is required. Claim Rejections - 35 USC § 112 Lacking written description The following is a quotation of the first paragraph of 35 U.S.C. 112(a): (a) IN GENERAL—The specification shall contain a written description of the invention, and of the manner and process of making and using it, in such full, clear, concise, and exact terms as to enable any person skilled in the art to which it pertains, or with which it is most nearly connected, to make and use the same, and shall set forth the best mode contemplated by the inventor or joint inventor of carrying out the invention. Claims 43-44, 46, 48-50, 53, 67, 70-71 are rejected under 35 U.S.C. 112(a), as failing to comply with the written description requirement. The claim(s) contains subject matter which was not described in the specification in such a way as to reasonably convey to one skilled in the relevant art that the inventor or a joint inventor, or for pre-AIA the inventor(s), at the time the application was filed, had possession of the claimed invention. To claim a genus under the written description requirement, the applicant is required to describe a representative number of species to reflect the variation within the genus or structures sufficient to define the genus. The factors to be considered include disclosure of complete or partial structure, physical and/or chemical properties, functional characteristics, structure/function correlation, methods of making the claimed product, or any combinations thereof. By court’s statement in Regents of the Univ. of Cal. v. Eli Lilly, 119 F.3d 1559, 1566, 43 USPQ2d 1398, 1404 (Fed. Cir. 1997), a written description of an invention “requires a precise definition, such as a structure, formula, or chemical name, of the claimed subject matter sufficient to distinguish it from other materials”; further, a written description of a claimed genus requires a description of a representative number of species of the claimed genus, and one of skill in the art should be able to “visualize or recognize the identity of the members of the genus”. Claim 43 is broadly drawn to recombinant oilseed plant seed oils, said recombinant oilseed plants comprise a genus of polynucleotides encoding a genus of Δ6-desaturases, a genus of Δ6-elongases, and a genus of Δ5-desaturases. The claimed function is that said recombinant oilseed plant seed oils comprise a specific oil composition, EPA constituting at least 10% (mol %) of the total fatty acid content of said oils, and comprises GLA constituting less than 10% (mol %) of the total fatty acid content of said oils, wherein said recombinant oilseed plant seed oils are obtained from a single oilseed plant by pressing or extracting it from the seed of said recombinant oilseed plant. Note: very long chain fatty acids (like EPA) are only produced in genetically modified plants expressing exogenous desaturase(s) and elongase(s). The specification (Examples 2-3, pages 40-46, table 5, lower panel), describes that the claimed recombinant seed oil with the oil composition (at least 10% EPA; at least 5% DHA, and less than 10% GLA) was obtained from transgenic camelina seed over-expressing the 2 specific constructs (BC construct and MC contract). See fig 2 below: PNG media_image1.png 200 400 media_image1.png Greyscale Recently, Han et al (High level accumulation of EPA and DHA in field-grown transgenic Camelina – a multi-territory evaluation of TAG accumulation and heterogeneity, Plant Biotechnology Journal, 18, pp. 2280–2291, 2020) teach a recombinant seed oil composition of at least 10% EPA and less than 10% GLA (p2283, fig 3). The oil was produced by genetically modifying camelina plant with three specific constructs. All three constructs contained a D6-desaturase gene from O. tauri (OtD6), a D6 fatty acid elongase gene from Physcomitrella patens (PSE1), a D5-desaturase gene from Thraustochytrium sp. (TcD5), a D12-desaturase gene from Phytophthora sojae (PsD12), an x3-desaturase from Phytophthora infestans (Piw3) and an O. tauri D5 fatty acid elongase gene (OtElo5). The only difference between the three constructs was as a consequence of varying the D4-desaturase gene (p2288, right col, “Vector construction”). Thus, the claimed recombinant plant seed oil must be from a genetically modified oil seed plant overexpressing specific desaturases and elongases. However, the specification does not describe the common structure feature of the genus of oilseed plant seed oils that comprise the claimed oil composition. In the claims, the genus of Δ6-desaturases, the genus of Δ6-elongases, and the genus of Δ5-desaturases, are generic not specific. The art does not describe a genetically modified oilseed plant comprising a generic Δ6-desaturases, a generic Δ6-elongases, and a generic Δ5-desaturases, produces an oil comprising at least 10% EPA and less than 10% GLA. For example, Bauer et al (US 20110162105, published 6/30/2011, filed 8/25/2009) teach making transgenic plant seed comprising the Napin-A construct, which contained genes encoding a Δ5 and Δ6 desaturases and a Δ6-elongase (as instant claim 43 requires, in [0154], [0169]). However, while the resultant the composition of recombinant plant seed oil comprises 20.2% EPA, but does not comprise less than 10% GLA ([0170], table 8). Thus, over-expressing the combination of Δ5 and Δ6 desaturases and a Δ6-elongase is not sufficient to obtain the claimed seed oil composition. For another example, Petrie et al (USPGPUB 20120016144) teach using a construct comprising genes encoding a Δ5-desaturase, a Δ6-desaturase, a Δ6-elongase (as instant claim 43 requires) and more (Example 10, [0837]). The resultant seed oil comprises 0.7-1.9% GLA, but the EPA is only 0.8% (Example 10, [0841], table 14). Please note that the claims encompass seed oils produced exclusively from a single type of plant seed. Such seed oils are reasonably expected to contain trace components specific to each plant seed type, and each type of oil is reasonably expected to be structurally distinct. Essential to the production of these seed oils are the seeds from which the oils are derived. The genus of said seeds is not described by the specification nor by the prior art. Regarding the representative number of species, 2 specific constructs (BC construct and MC contract) both comprising specific gene sequences encoding specific delta-6-desaturase, delta-5-desaturase, and delta-6-elongase, plus delta-12-desatuase, delta-4-desaturase and delta-4elongase are the only species that are described to leads to the claimed recombinant plant seed oil with the claimed oil composition. Furthermore, proteins like acyl-CoA-dependent delta-6-desaturase have been recently discovered in prior art. As research progresses, more will be disclosed and characterized. Applicant certainly does not have possession of the genus. Accordingly, the 2 specific constructs and the comprised specific gene combinations are not sufficient to represent the genus of transgenes or gene modifications. Therefore, the application has not met either of the two elements of the written description requirement as set forth in the court’s decision in Eli Lilly, and has not shown her/his possession of the claimed genus. Dependent claims, including claim 67 and new claims 70-71, do not cure the deficiency, thus, are included. Remarks Prior art teaches a recombinant oil seed plant comprising exogenous genes encoding a Δ6-desaturases, a Δ6-elongases, and a Δ5-desaturases, but does not teach, suggest or describe the claimed recombinant plant seed oil comprising the combination of EPA (at least 10%) and GLA (less than 10%). Sequence Matches Against instant SEQ ID NO: 2 Q4JDG7_OSTTA ID Q4JDG7_OSTTA Unreviewed; 456 AA. AC Q4JDG7; DT 02-AUG-2005, integrated into UniProtKB/TrEMBL. DT 02-AUG-2005, sequence version 1. DT 02-JUN-2021, entry version 101. DE SubName: Full=Cytochrome b5-like heme/steroid binding domain {ECO:0000313|EMBL:CAL56435.1}; DE SubName: Full=Delta-6-desaturase {ECO:0000313|EMBL:AAW70159.1}; GN Name=d6 {ECO:0000313|EMBL:AAW70159.1}; GN ORFNames=OT_ostta13g01040 {ECO:0000313|EMBL:CAL56435.1}; OS Ostreococcus tauri. OC Eukaryota; Viridiplantae; Chlorophyta; Mamiellophyceae; Mamie; OC Bathycoccaceae; Ostreococcus. OX NCBI_TaxID=70448 {ECO:0000313|EMBL:AAW70159.1}; RN [1] {ECO:0000313|EMBL:AAW70159.1} RP NUCLEOTIDE SEQUENCE. RC STRAIN=OTTH0595 {ECO:0000313|EMBL:AAW70159.1}; RX PubMed=15769252; DOI=10.1042/BJ20050111; RA Domergue F., Abbadi A., Zahringer U., Moreau H., Heinz E.; RT "In vivo characterization of the first acyl-CoA Delta6-desaturase from a RT member of the plant kingdom, the microalga Ostreococcus tauri."; RL Biochem. J. 389:483-490(2005). RN [2] {ECO:0000313|Proteomes:UP000009170} RP NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. RC STRAIN=OTTH0595 {ECO:0000313|Proteomes:UP000009170}; RX PubMed=16868079; DOI=10.1073/pnas.0604795103; RA Derelle E., Ferraz C., Rombauts S., Rouze P., Worden A.Z., Robbens S., RA Partensky F., Degroeve S., Echeynie S., Cooke R., Saeys Y., Wuyts J., RA Jabbari K., Bowler C., Panaud O., Piegu B., Ball S.G., Ral J.-P., RA Bouget F.-Y., Piganeau G., De Baets B., Picard A., Delseny M., Demaille J., RA Van de Peer Y., Moreau H.; RT "Genome analysis of the smallest free-living eukaryote Ostreococcus tauri RT unveils many unique features."; RL Proc. Natl. Acad. Sci. U.S.A. 103:11647-11652(2006). RN [3] {ECO:0000313|EMBL:CAL56435.1} RP NUCLEOTIDE SEQUENCE. RC STRAIN=RCC4221 {ECO:0000313|EMBL:CAL56435.1}; RA Derelle E., Ferraz C., Rombauts S., Rouze P., Worden A.Z., Robbens S., RA Partensky F., Degroeve S., Echeynie S., Cooke R., Saeys Y., Wuyts J., RA Jabbari K., Bowler C., Panaud O., Piegu B., Ball S., Ral J.P., Bouget F.Y., RA Piganeau G., De Baets B., Picard A., Delseny M., Demaille J., RA Van de Peer Y., Moreau H.; RT "Genome analysis of the smallest free-living eukaryote Ostreococcus tauri RT unveils many unique features."; RL Proc. Natl. Acad. Sci. U.S.A. 131:11647-11652(2006). RN [4] {ECO:0000313|EMBL:CAL56435.1} RP NUCLEOTIDE SEQUENCE. RC STRAIN=RCC4221 {ECO:0000313|EMBL:CAL56435.1}; RX PubMed=25494611; DOI=10.1186/1471-2164-15-1103; RA Blanc-Mathieu R., Verhelst B., Derelle E., Rombauts S., Bouget F.Y., RA Carre I., Chateau A., Eyre-Walker A., Grimsley N., Moreau H., Piegu B., RA Rivals E., Schackwitz W., Van de Peer Y., Piganeau G.; RT "An improved genome of the model marine alga Ostreococcus tauri unfolds by RT assessing Illumina de novo assemblies."; RL BMC Genomics 15:1103-1103(2014). CC --------------------------------------------------------------------------- CC Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms CC Distributed under the Creative Commons Attribution (CC BY 4.0) License CC --------------------------------------------------------------------------- DR EMBL; AY746357; AAW70159.1; -; Genomic_DNA. DR EMBL; CAID01000013; CAL56435.1; -; Genomic_DNA. DR RefSeq; XP_003082578.1; XM_003082530.1. DR GeneID; 9837459; -. DR KEGG; ota:OT_ostta13g01040; -. DR OMA; HFSTSHT; -. DR OrthoDB; 1060606at2759; -. DR BRENDA; 1.14.19.3; 7749. DR Proteomes; UP000009170; Chromosome 13. DR GO; GO:0016021; C:integral component of membrane; IEA:UniProtKB-KW. DR GO; GO:0016491; F:oxidoreductase activity; IEA:InterPro. DR GO; GO:0006629; P:lipid metabolic process; IEA:InterPro. DR Gene3D; 3.10.120.10; -; 1. DR InterPro; IPR001199; Cyt_B5-like_heme/steroid-bd. DR InterPro; IPR036400; Cyt_B5-like_heme/steroid_sf. DR InterPro; IPR005804; FA_desaturase_dom. DR InterPro; IPR012171; Fatty_acid_desaturase. DR Pfam; PF00173; Cyt-b5; 1. DR Pfam; PF00487; FA_desaturase; 1. DR PIRSF; PIRSF015921; FA_sphinglp_des; 1. DR SMART; SM01117; Cyt-b5; 1. DR SUPFAM; SSF55856; SSF55856; 1. PE 4: Predicted; KW Membrane {ECO:0000256|SAM:Phobius}; KW Reference proteome {ECO:0000313|Proteomes:UP000009170}; KW Transmembrane {ECO:0000256|SAM:Phobius}; KW Transmembrane helix {ECO:0000256|SAM:Phobius}. FT TRANSMEM 265..286 FT /note="Helical" FT /evidence="ECO:0000256|SAM:Phobius" FT DOMAIN 36..113 FT /note="Cytochrome b5 heme-binding" FT /evidence="ECO:0000259|SMART:SM01117" SQ SEQUENCE 456 AA; 51750 MW; 3829CDD50F425859 CRC64; Query Match 100.0%; Score 2473; DB 66; Length 456; Best Local Similarity 100.0%; Matches 456; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 MCVETENNDGIPTVEIAFDGERERAEANVKLSAEKMEPAALAKTFARRYVVIEGVEYDVT 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MCVETENNDGIPTVEIAFDGERERAEANVKLSAEKMEPAALAKTFARRYVVIEGVEYDVT 60 Qy 61 DFKHPGGTVIFYALSNTGADATEAFKEFHHRSRKARKALAALPSRPAKTAKVDDAEMLQD 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 DFKHPGGTVIFYALSNTGADATEAFKEFHHRSRKARKALAALPSRPAKTAKVDDAEMLQD 120 Qy 121 FAKWRKELERDGFFKPSPAHVAYRFAELAAMYALGTYLMYARYVVSSVLVYACFFGARCG 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 FAKWRKELERDGFFKPSPAHVAYRFAELAAMYALGTYLMYARYVVSSVLVYACFFGARCG 180 Qy 181 WVQHEGGHSSLTGNIWWDKRIQAFTAGFGLAGSGDMWNSMHNKHHATPQKVRHDMDLDTT 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 WVQHEGGHSSLTGNIWWDKRIQAFTAGFGLAGSGDMWNSMHNKHHATPQKVRHDMDLDTT 240 Qy 241 PAVAFFNTAVEDNRPRGFSKYWLRLQAWTFIPVTSGLVLLFWMFFLHPSKALKGGKYEEL 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 PAVAFFNTAVEDNRPRGFSKYWLRLQAWTFIPVTSGLVLLFWMFFLHPSKALKGGKYEEL 300 Qy 301 VWMLAAHVIRTWTIKAVTGFTAMQSYGLFLATSWVSGCYLFAHFSTSHTHLDVVPADEHL 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 VWMLAAHVIRTWTIKAVTGFTAMQSYGLFLATSWVSGCYLFAHFSTSHTHLDVVPADEHL 360 Qy 361 SWVRYAVDHTIDIDPSQGWVNWLMGYLNCQVIHHLFPSMPQFRQPEVSRRFVAFAKKWNL 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 SWVRYAVDHTIDIDPSQGWVNWLMGYLNCQVIHHLFPSMPQFRQPEVSRRFVAFAKKWNL 420 Qy 421 NYKVMTYAGAWKATLGNLDNVGKHYYVHGQHSGKTA 456 |||||||||||||||||||||||||||||||||||| Db 421 NYKVMTYAGAWKATLGNLDNVGKHYYVHGQHSGKTA 456 US-13-060-458-20 ; Sequence 20, Application US/13060458 ; Publication No. US20110162105A1 ; GENERAL INFORMATION ; APPLICANT: Bauer, Joerg ; APPLICANT:Senger, Toralf ; APPLICANT:Zank, Thorsten ; APPLICANT:Qiu, Xiao ; APPLICANT:Wu, Guohai ; TITLE OF INVENTION: NUCLEIC ACIDS ENCODING DESATURASES AND MODIFIED PLANT OIL ; FILE REFERENCE: 17418-00064-US ; CURRENT APPLICATION NUMBER: US/13/060,458 ; CURRENT FILING DATE: 2011-02-24 ; PRIOR APPLICATION NUMBER: PCT/EP2009/060923 ; PRIOR FILING DATE: 2009-08-25 ; PRIOR APPLICATION NUMBER: EP 08162988.3 ; PRIOR FILING DATE: 2008-08-26 ; NUMBER OF SEQ ID NOS: 140 ; SOFTWARE: PatentIn version 3.5 ; SEQ ID NO 20 ; LENGTH: 456 ; TYPE: PRT ; ORGANISM: Ostreococcus tauri US-13-060-458-20 Query Match 100.0%; Score 2473; DB 10; Length 456; Best Local Similarity 100.0%; Matches 456; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 MCVETENNDGIPTVEIAFDGERERAEANVKLSAEKMEPAALAKTFARRYVVIEGVEYDVT 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MCVETENNDGIPTVEIAFDGERERAEANVKLSAEKMEPAALAKTFARRYVVIEGVEYDVT 60 Qy 61 DFKHPGGTVIFYALSNTGADATEAFKEFHHRSRKARKALAALPSRPAKTAKVDDAEMLQD 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 DFKHPGGTVIFYALSNTGADATEAFKEFHHRSRKARKALAALPSRPAKTAKVDDAEMLQD 120 Qy 121 FAKWRKELERDGFFKPSPAHVAYRFAELAAMYALGTYLMYARYVVSSVLVYACFFGARCG 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 FAKWRKELERDGFFKPSPAHVAYRFAELAAMYALGTYLMYARYVVSSVLVYACFFGARCG 180 Qy 181 WVQHEGGHSSLTGNIWWDKRIQAFTAGFGLAGSGDMWNSMHNKHHATPQKVRHDMDLDTT 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 WVQHEGGHSSLTGNIWWDKRIQAFTAGFGLAGSGDMWNSMHNKHHATPQKVRHDMDLDTT 240 Qy 241 PAVAFFNTAVEDNRPRGFSKYWLRLQAWTFIPVTSGLVLLFWMFFLHPSKALKGGKYEEL 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 PAVAFFNTAVEDNRPRGFSKYWLRLQAWTFIPVTSGLVLLFWMFFLHPSKALKGGKYEEL 300 Qy 301 VWMLAAHVIRTWTIKAVTGFTAMQSYGLFLATSWVSGCYLFAHFSTSHTHLDVVPADEHL 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 VWMLAAHVIRTWTIKAVTGFTAMQSYGLFLATSWVSGCYLFAHFSTSHTHLDVVPADEHL 360 Qy 361 SWVRYAVDHTIDIDPSQGWVNWLMGYLNCQVIHHLFPSMPQFRQPEVSRRFVAFAKKWNL 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 SWVRYAVDHTIDIDPSQGWVNWLMGYLNCQVIHHLFPSMPQFRQPEVSRRFVAFAKKWNL 420 Qy 421 NYKVMTYAGAWKATLGNLDNVGKHYYVHGQHSGKTA 456 |||||||||||||||||||||||||||||||||||| Db 421 NYKVMTYAGAWKATLGNLDNVGKHYYVHGQHSGKTA 456 US-10-566-944A-90 ; Sequence 90, Application US/10566944A ; Publication No. US20080155705A1 ; GENERAL INFORMATION ; APPLICANT: Zank, Thorsten ; APPLICANT:Bauer, Jorg ; APPLICANT:Cirpus, Petra ; APPLICANT:Abbadi, Amine ; APPLICANT:Heinz, Ernst ; APPLICANT:Qiu, Xiao ; APPLICANT:Vrinten, Patricia ; APPLICANT:Sperling, Petra ; APPLICANT:Domergue, Frederic ; APPLICANT:Meyer, Astrid ; APPLICANT:Kirsch, Jelena ; TITLE OF INVENTION: METHOD FOR THE PRODUCTION OF MULTIPLE-UNSATURATED FATTY ACIDS IN ; TITLE OF INVENTION:TRANSGENIC ORGANISMS ; FILE REFERENCE: 12810-00193-US ; CURRENT APPLICATION NUMBER: US/10/566,944A ; CURRENT FILING DATE: 2006-02-01 ; PRIOR APPLICATION NUMBER: DE 103 35 992.3 ; PRIOR FILING DATE: 2003-08-01 ; PRIOR APPLICATION NUMBER: DE 103 44 557.9 ; PRIOR FILING DATE: 2003-09-24 ; PRIOR APPLICATION NUMBER: DE 103 47 869.8 ; PRIOR FILING DATE: 2003-10-10 ; PRIOR APPLICATION NUMBER: DE 103 59 593.7 ; PRIOR FILING DATE: 2003-12-18 ; PRIOR APPLICATION NUMBER: DE 10 2004 009 457.8 ; PRIOR FILING DATE: 2004-02-27 ; PRIOR APPLICATION NUMBER: DE 10 2004 012 370.5 ; PRIOR FILING DATE: 2004-03-13 ; PRIOR APPLICATION NUMBER: DE 10 2004 024 014.0 ; PRIOR FILING DATE: 2004-05-14 ; NUMBER OF SEQ ID NOS: 192 ; SOFTWARE: PatentIn version 3.1 ; SEQ ID NO 90 ; LENGTH: 456 ; TYPE: PRT ; ORGANISM: Ostreococcus tauri US-10-566-944A-90 Query Match 100.0%; Score 2473; DB 5; Length 456; Best Local Similarity 100.0%; Matches 456; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 MCVETENNDGIPTVEIAFDGERERAEANVKLSAEKMEPAALAKTFARRYVVIEGVEYDVT 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MCVETENNDGIPTVEIAFDGERERAEANVKLSAEKMEPAALAKTFARRYVVIEGVEYDVT 60 Qy 61 DFKHPGGTVIFYALSNTGADATEAFKEFHHRSRKARKALAALPSRPAKTAKVDDAEMLQD 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 DFKHPGGTVIFYALSNTGADATEAFKEFHHRSRKARKALAALPSRPAKTAKVDDAEMLQD 120 Qy 121 FAKWRKELERDGFFKPSPAHVAYRFAELAAMYALGTYLMYARYVVSSVLVYACFFGARCG 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 FAKWRKELERDGFFKPSPAHVAYRFAELAAMYALGTYLMYARYVVSSVLVYACFFGARCG 180 Qy 181 WVQHEGGHSSLTGNIWWDKRIQAFTAGFGLAGSGDMWNSMHNKHHATPQKVRHDMDLDTT 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 WVQHEGGHSSLTGNIWWDKRIQAFTAGFGLAGSGDMWNSMHNKHHATPQKVRHDMDLDTT 240 Qy 241 PAVAFFNTAVEDNRPRGFSKYWLRLQAWTFIPVTSGLVLLFWMFFLHPSKALKGGKYEEL 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 PAVAFFNTAVEDNRPRGFSKYWLRLQAWTFIPVTSGLVLLFWMFFLHPSKALKGGKYEEL 300 Qy 301 VWMLAAHVIRTWTIKAVTGFTAMQSYGLFLATSWVSGCYLFAHFSTSHTHLDVVPADEHL 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 VWMLAAHVIRTWTIKAVTGFTAMQSYGLFLATSWVSGCYLFAHFSTSHTHLDVVPADEHL 360 Qy 361 SWVRYAVDHTIDIDPSQGWVNWLMGYLNCQVIHHLFPSMPQFRQPEVSRRFVAFAKKWNL 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 SWVRYAVDHTIDIDPSQGWVNWLMGYLNCQVIHHLFPSMPQFRQPEVSRRFVAFAKKWNL 420 Qy 421 NYKVMTYAGAWKATLGNLDNVGKHYYVHGQHSGKTA 456 |||||||||||||||||||||||||||||||||||| Db 421 NYKVMTYAGAWKATLGNLDNVGKHYYVHGQHSGKTA 456 US-13-129-940-30 ; Sequence 30, Application US/13129940 ; Publication No. US20120016144A1 ; GENERAL INFORMATION ; APPLICANT: PETRIE, James Robertson ; APPLICANT:MACKENZIE, Anne Maree ; APPLICANT:LIU, Qing ; APPLICANT:SHRESTHA, Pushkar ; APPLICANT:NICHOLS, Peter David ; APPLICANT:BLACKBURN, Susan Irene Ellis ; APPLICANT:MANSOUR, Maged Peter ; APPLICANT:ROBERT, Stanley Suresh ; APPLICANT:FRAMPTON, Dion Matthew Frederick ; APPLICANT:ZHOU, Xue-Rong ; APPLICANT:SINGH, Surinder Pal ; APPLICANT:WOOD, Craig Christopher ; TITLE OF INVENTION: Enzymes and methods for producing omega-3 fatty acids ; FILE REFERENCE: 510837 ; CURRENT APPLICATION NUMBER: US/13/129,940 ; CURRENT FILING DATE: 2011-05-18 ; PRIOR APPLICATION NUMBER: PCT/AU09/01488 ; PRIOR FILING DATE: 2009-11-17 ; PRIOR APPLICATION NUMBER: US 61/199,669 ; PRIOR FILING DATE: 2008-11-18 ; PRIOR APPLICATION NUMBER: US 61/270,710 ; PRIOR FILING DATE: 2009-07-09 ; NUMBER OF SEQ ID NOS: 129 ; SOFTWARE: PatentIn version 3.5 ; SEQ ID NO 30 ; LENGTH: 456 ; TYPE: PRT ; ORGANISM: Ostreococcus tauri US-13-129-940-30 Query Match 100.0%; Score 2473; DB 10; Length 456; Best Local Similarity 100.0%; Matches 456; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 MCVETENNDGIPTVEIAFDGERERAEANVKLSAEKMEPAALAKTFARRYVVIEGVEYDVT 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MCVETENNDGIPTVEIAFDGERERAEANVKLSAEKMEPAALAKTFARRYVVIEGVEYDVT 60 Qy 61 DFKHPGGTVIFYALSNTGADATEAFKEFHHRSRKARKALAALPSRPAKTAKVDDAEMLQD 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 DFKHPGGTVIFYALSNTGADATEAFKEFHHRSRKARKALAALPSRPAKTAKVDDAEMLQD 120 Qy 121 FAKWRKELERDGFFKPSPAHVAYRFAELAAMYALGTYLMYARYVVSSVLVYACFFGARCG 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 FAKWRKELERDGFFKPSPAHVAYRFAELAAMYALGTYLMYARYVVSSVLVYACFFGARCG 180 Qy 181 WVQHEGGHSSLTGNIWWDKRIQAFTAGFGLAGSGDMWNSMHNKHHATPQKVRHDMDLDTT 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 WVQHEGGHSSLTGNIWWDKRIQAFTAGFGLAGSGDMWNSMHNKHHATPQKVRHDMDLDTT 240 Qy 241 PAVAFFNTAVEDNRPRGFSKYWLRLQAWTFIPVTSGLVLLFWMFFLHPSKALKGGKYEEL 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 PAVAFFNTAVEDNRPRGFSKYWLRLQAWTFIPVTSGLVLLFWMFFLHPSKALKGGKYEEL 300 Qy 301 VWMLAAHVIRTWTIKAVTGFTAMQSYGLFLATSWVSGCYLFAHFSTSHTHLDVVPADEHL 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 VWMLAAHVIRTWTIKAVTGFTAMQSYGLFLATSWVSGCYLFAHFSTSHTHLDVVPADEHL 360 Qy 361 SWVRYAVDHTIDIDPSQGWVNWLMGYLNCQVIHHLFPSMPQFRQPEVSRRFVAFAKKWNL 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 SWVRYAVDHTIDIDPSQGWVNWLMGYLNCQVIHHLFPSMPQFRQPEVSRRFVAFAKKWNL 420 Qy 421 NYKVMTYAGAWKATLGNLDNVGKHYYVHGQHSGKTA 456 |||||||||||||||||||||||||||||||||||| Db 421 NYKVMTYAGAWKATLGNLDNVGKHYYVHGQHSGKTA 456 Against instant SEQ ID NO: 4 US-10-566-944A-28 ; Sequence 28, Application US/10566944A ; Publication No. US20080155705A1 ; GENERAL INFORMATION ; APPLICANT: Zank, Thorsten ; APPLICANT:Bauer, Jorg ; APPLICANT:Cirpus, Petra ; APPLICANT:Abbadi, Amine ; APPLICANT:Heinz, Ernst ; APPLICANT:Qiu, Xiao ; APPLICANT:Vrinten, Patricia ; APPLICANT:Sperling, Petra ; APPLICANT:Domergue, Frederic ; APPLICANT:Meyer, Astrid ; APPLICANT:Kirsch, Jelena ; TITLE OF INVENTION: METHOD FOR THE PRODUCTION OF MULTIPLE-UNSATURATED FATTY ACIDS IN ; TITLE OF INVENTION:TRANSGENIC ORGANISMS ; FILE REFERENCE: 12810-00193-US ; CURRENT APPLICATION NUMBER: US/10/566,944A ; CURRENT FILING DATE: 2006-02-01 ; PRIOR APPLICATION NUMBER: DE 103 35 992.3 ; PRIOR FILING DATE: 2003-08-01 ; PRIOR APPLICATION NUMBER: DE 103 44 557.9 ; PRIOR FILING DATE: 2003-09-24 ; PRIOR APPLICATION NUMBER: DE 103 47 869.8 ; PRIOR FILING DATE: 2003-10-10 ; PRIOR APPLICATION NUMBER: DE 103 59 593.7 ; PRIOR FILING DATE: 2003-12-18 ; PRIOR APPLICATION NUMBER: DE 10 2004 009 457.8 ; PRIOR FILING DATE: 2004-02-27 ; PRIOR APPLICATION NUMBER: DE 10 2004 012 370.5 ; PRIOR FILING DATE: 2004-03-13 ; PRIOR APPLICATION NUMBER: DE 10 2004 024 014.0 ; PRIOR FILING DATE: 2004-05-14 ; NUMBER OF SEQ ID NOS: 192 ; SOFTWARE: PatentIn version 3.1 ; SEQ ID NO 28 ; LENGTH: 290 ; TYPE: PRT ; ORGANISM: Physcomitrella patens US-10-566-944A-28 Query Match 100.0%; Score 1539; DB 5; Length 290; Best Local Similarity 100.0%; Matches 290; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 MEVVERFYGELDGKVSQGVNALLGSFGVELTDTPTTKGLPLVDSPTPIVLGVSVYLTIVI 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MEVVERFYGELDGKVSQGVNALLGSFGVELTDTPTTKGLPLVDSPTPIVLGVSVYLTIVI 60 Qy 61 GGLLWIKARDLKPRASEPFLLQALVLVHNLFCFALSLYMCVGIAYQAITWRYSLWGNAYN 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 GGLLWIKARDLKPRASEPFLLQALVLVHNLFCFALSLYMCVGIAYQAITWRYSLWGNAYN 120 Qy 121 PKHKEMAILVYLFYMSKYVEFMDTVIMILKRSTRQISFLHVYHHSSISLIWWAIA HHAPG 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 PKHKEMAILVYLFYMSKYVEFMDTVIMILKRSTRQISFLHVYHHSSISLIWWAIA HHAPG 180 Qy 181 GEAYWSAALNSGVHVLMYAYYFLAACLRSSPKLKNKYLFWGRYLTQFQMFQFMLNLVQAY 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 GEAYWSAALNSGVHVLMYAYYFLAACLRSSPKLKNKYLFWGRYLTQFQMFQFMLNLVQAY 240 Qy 241 YDMKTNAPYPQWLIKILFYYMISLLFLFGNFYVQKYIKPSDGKQKGAKTE 290 |||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 YDMKTNAPYPQWLIKILFYYMISLLFLFGNFYVQKYIKPSDGKQKGAKTE 290 Against instant SEQ ID NO: 6 US-10-566-944A-12 ; Sequence 12, Application US/10566944A ; Publication No. US20080155705A1 ; GENERAL INFORMATION ; APPLICANT: Zank, Thorsten ; APPLICANT:Bauer, Jorg ; APPLICANT:Cirpus, Petra ; APPLICANT:Abbadi, Amine ; APPLICANT:Heinz, Ernst ; APPLICANT:Qiu, Xiao ; APPLICANT:Vrinten, Patricia ; APPLICANT:Sperling, Petra ; APPLICANT:Domergue, Frederic ; APPLICANT:Meyer, Astrid ; APPLICANT:Kirsch, Jelena ; TITLE OF INVENTION: METHOD FOR THE PRODUCTION OF MULTIPLE-UNSATURATED FATTY ACIDS IN ; TITLE OF INVENTION:TRANSGENIC ORGANISMS ; FILE REFERENCE: 12810-00193-US ; CURRENT APPLICATION NUMBER: US/10/566,944A ; CURRENT FILING DATE: 2006-02-01 ; PRIOR APPLICATION NUMBER: DE 103 35 992.3 ; PRIOR FILING DATE: 2003-08-01 ; PRIOR APPLICATION NUMBER: DE 103 44 557.9 ; PRIOR FILING DATE: 2003-09-24 ; PRIOR APPLICATION NUMBER: DE 103 47 869.8 ; PRIOR FILING DATE: 2003-10-10 ; PRIOR APPLICATION NUMBER: DE 103 59 593.7 ; PRIOR FILING DATE: 2003-12-18 ; PRIOR APPLICATION NUMBER: DE 10 2004 009 457.8 ; PRIOR FILING DATE: 2004-02-27 ; PRIOR APPLICATION NUMBER: DE 10 2004 012 370.5 ; PRIOR FILING DATE: 2004-03-13 ; PRIOR APPLICATION NUMBER: DE 10 2004 024 014.0 ; PRIOR FILING DATE: 2004-05-14 ; NUMBER OF SEQ ID NOS: 192 ; SOFTWARE: PatentIn version 3.1 ; SEQ ID NO 12 ; LENGTH: 439 ; TYPE: PRT ; ORGANISM: Thraustrochytrium US-10-566-944A-12 Query Match 100.0%; Score 2360; DB 5; Length 439; Best Local Similarity 100.0%; Matches 439; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 MGKGSEGRSAAREMTAEANGDKRKTILIEGVLYDATNFKHPGGSIINFLTEGEAGVDATQ 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MGKGSEGRSAAREMTAEANGDKRKTILIEGVLYDATNFKHPGGSIINFLTEGEAGVDATQ 60 Qy 61 AYREFHQRSGKADKYLKSLPKLDASKVESRFSAKEQARRDAMTRDYAAFREELVAEGYFD 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 AYREFHQRSGKADKYLKSLPKLDASKVESRFSAKEQARRDAMTRDYAAFREELVAEGYFD 120 Qy 121 PSIPHMIYRVVEIVALFALSFWLMSKASPTSLVLGVVMNGIAQGRCGWVMHEMGHGSFTG 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 PSIPHMIYRVVEIVALFALSFWLMSKASPTSLVLGVVMNGIAQGRCGWVMHEMGHGSFTG 180 Qy 181 VIWLDDRMCEFFYGVGCGMSGHYWKNQHSKHHAAPNRLEHDVDLNTLPLVAFNERVVRKV 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 VIWLDDRMCEFFYGVGCGMSGHYWKNQHSKHHAAPNRLEHDVDLNTLPLVAFNERVVRKV 240 Qy 241 KPGSLLALWLRVQAYLFAPVSCLLIGLGWTLYLHPRYMLRTKRHMEFVWIFARYIGWFSL 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 KPGSLLALWLRVQAYLFAPVSCLLIGLGWTLYLHPRYMLRTKRHMEFVWIFARYIGWFSL 300 Qy 301 MGALGYSPGTSVGMYLCSFGLGCIYIFLQFAVSHTHLPVTNPEDQLHWLEYAADHTVNIS 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 MGALGYSPGTSVGMYLCSFGLGCIYIFLQFAVSHTHLPVTNPEDQLHWLEYAADHTVNIS 360 Qy 361 TKSWLVTWWMSNLNFQIEHHLFPTAPQFRFKEISPRVEALFKRHNLPYYDLPYTSAVSTT 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 TKSWLVTWWMSNLNFQIEHHLFPTAPQFRFKEISPRVEALFKRHNLPYYDLPYTSAVSTT 420 Qy 421 FANLYSVGHSVGADTKKQD 439 ||||||||||||||||||| Db 421 FANLYSVGHSVGADTKKQD 439 Response to Arguments The claims are significantly amended. All of the objections and rejections are newly made by the examiner in view of the amendments, citing new references. Accordingly, the arguments regarding the previous rejections are no longer applicable. Conclusion No claim is allowed. Applicant's amendment necessitated the new ground(s) of rejection presented in this Office action. Accordingly, THIS ACTION IS MADE FINAL. See MPEP § 706.07(a). Applicant is reminded of the extension of time policy as set forth in 37 CFR 1.136(a). A shortened statutory period for reply to this final action is set to expire THREE MONTHS from the mailing date of this action. In the event a first reply is filed within TWO MONTHS of the mailing date of this final action and the advisory action is not mailed until after the end of the THREE-MONTH shortened statutory period, then the shortened statutory period will expire on the date the advisory action is mailed, and any extension fee pursuant to 37 CFR 1.136(a) will be calculated from the mailing date of the advisory action. In no event, however, will the statutory period for reply expire later than SIX MONTHS from the date of this final action. Contact information Any inquiry concerning this communication or earlier communications from the examiner should be directed to WAYNE ZHONG whose telephone number is (571)270-0311. The examiner can normally be reached 8:30am to 5:00pm EST. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Shubo (Joe) Zhou can be reached on 571-272-0724. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /Wayne Zhong/ Examiner, Art Unit 1662 /SHUBO (JOE) ZHOU/Supervisory Patent Examiner, Art Units 1661 and 1662
Read full office action

Prosecution Timeline

Dec 31, 2020
Application Filed
Mar 26, 2022
Non-Final Rejection — §112
Aug 30, 2022
Response Filed
Nov 01, 2022
Final Rejection — §112
Feb 14, 2023
Examiner Interview Summary
Feb 14, 2023
Applicant Interview (Telephonic)
Apr 10, 2023
Request for Continued Examination
Apr 13, 2023
Response after Non-Final Action
Jun 15, 2023
Non-Final Rejection — §112
Oct 23, 2023
Response Filed
Dec 27, 2023
Final Rejection — §112
Jun 04, 2024
Request for Continued Examination
Jun 04, 2024
Response after Non-Final Action
Jun 10, 2024
Response after Non-Final Action
Sep 15, 2024
Non-Final Rejection — §112
Mar 24, 2025
Response Filed
Apr 02, 2025
Final Rejection — §112
Jul 30, 2025
Applicant Interview (Telephonic)
Jul 30, 2025
Examiner Interview Summary
Sep 09, 2025
Request for Continued Examination
Oct 02, 2025
Response after Non-Final Action
Dec 19, 2025
Non-Final Rejection — §112 (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12600978
PROCESS FOR PRODUCING LIPIDS
2y 5m to grant Granted Apr 14, 2026
Patent 12599072
PLANTS AND SEEDS OF HYBRID CORN VARIETY CH010552
2y 5m to grant Granted Apr 14, 2026
Patent 12600976
MAIZE GENE KRN2 AND USES THEREOF
2y 5m to grant Granted Apr 14, 2026
Patent 12593767
PROTOPLAST ISOLATION AND REGENERATION OF PLANTS
2y 5m to grant Granted Apr 07, 2026
Patent 12593793
SOYBEAN VARIETY 01094778
2y 5m to grant Granted Apr 07, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

AI Strategy Recommendation

Get an AI-powered prosecution strategy using examiner precedents, rejection analysis, and claim mapping.
Powered by AI — typically takes 5-10 seconds

Prosecution Projections

7-8
Expected OA Rounds
72%
Grant Probability
94%
With Interview (+22.3%)
3y 0m
Median Time to Grant
High
PTA Risk
Based on 524 resolved cases by this examiner. Grant probability derived from career allow rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month