Prosecution Insights
Last updated: April 19, 2026
Application No. 17/176,388

CELL SORTING SYSTEMS AND METHODS OF USE

Non-Final OA §102§103
Filed
Feb 16, 2021
Examiner
MARVICH, MARIA
Art Unit
1634
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
Memorial Sloan-Kettering Cancer Center
OA Round
3 (Non-Final)
55%
Grant Probability
Moderate
3-4
OA Rounds
4y 2m
To Grant
82%
With Interview

Examiner Intelligence

Grants 55% of resolved cases
55%
Career Allow Rate
529 granted / 967 resolved
-5.3% vs TC avg
Strong +27% interview lift
Without
With
+26.9%
Interview Lift
resolved cases with interview
Typical timeline
4y 2m
Avg Prosecution
53 currently pending
Career history
1020
Total Applications
across all art units

Statute-Specific Performance

§101
2.9%
-37.1% vs TC avg
§103
26.7%
-13.3% vs TC avg
§102
19.8%
-20.2% vs TC avg
§112
34.9%
-5.1% vs TC avg
Black line = Tech Center average estimate • Based on career data from 967 resolved cases

Office Action

§102 §103
DETAILED ACTION The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . A request for continued examination under 37 CFR 1.114, including the fee set forth in 37 CFR 1.17(e), was filed in this application after final rejection. Since this application is eligible for continued examination under 37 CFR 1.114, and the fee set forth in 37 CFR 1.17(e) has been timely paid, the finality of the previous Office action has been withdrawn pursuant to 37 CFR 1.114. Applicant's submission filed on 3/23/2026 has been entered. Claims 12, 21-29 and 31 are pending. This application is a continuation of PCT/US19/46764, filed August 16, 2019, which claims priority to U.S. Provisional Application No. 62/765,129, filed on August 16, 2018, and U.S. Provisional Application No. 62/798,206, filed January 29, 2019. Response to Amendments The response is sufficient to overcome the objections as well as rejections under 35 USC 112, second. The terminal disclaimers filed on 3/23/2026 disclaiming the terminal portion of any patent granted on this application which would extend beyond the expiration date of U.S. Patent 12,509,498 has been reviewed and is accepted. The terminal disclaimer has been recorded. Claim Objections Claims 21 and 26 are objected to because of the following informalities: upon a more thorough read, it appears that the article “the” is required in line 7 of claim 12, prior to “second”. Appropriate correction is required. Claim Rejections - 35 USC § 102 In the event the determination of the status of the application as subject to AIA 35 U.S.C. 102 and 103 (or as subject to pre-AIA 35 U.S.C. 102 and 103) is incorrect, any correction of the statutory basis (i.e., changing from AIA to pre-AIA ) for the rejection will not be considered a new ground of rejection if the prior art relied upon, and the rationale supporting the rejection, would be the same under either status. The following is a quotation of the appropriate paragraphs of 35 U.S.C. 102 that form the basis for the rejections under this section made in this Office action: A person shall be entitled to a patent unless – (a)(1) the claimed invention was patented, described in a printed publication, or in public use, on sale, or otherwise available to the public before the effective filing date of the claimed invention. Claims 12, 22 and 24-29 are rejected under 35 U.S.C. 102(a)(1) as being anticipated by Wong et al (WO 2017/091546) as evidenced by Hussack et al (Frontiers in Immunology, 2017, pages 1-11) and as evidenced by Brown et al (PLOS ONE, 2013, pages 1-10). This rejection is maintained for reasons of record. There are two parts of the system of Wong et al that anticipate the system of the claims. The claimed system comprises first, a first expression vector encoding a membrane bound peptide with an extracellular domain. The EC comprises two dimerization domains that comprise a leucine zipper domain from orthogonal zippers. Orthogonal zippers are described in the disclosure ¶ 0104, In certain embodiments, the first and second leucine zipper domains of the membrane-bound polypeptide are a pair of orthogonal zippers, i.e., the first and the second leucine zipper domains are the specific partners for each other to form heterodimers. However, one of the orthogonal partners will also bind to a third dimerization domain. But, this format is displayed in Wong et al in figure 16. PNG media_image1.png 348 333 media_image1.png Greyscale BZip1 and BZip2 are orthogonal as set forth in the disclosure (see e.g. ¶00206) and BZip1 can bind to AZip. ¶0204 which states, Two orthogonal BZIP zippers can be attached onto a zipCAR. Hence, Wong teaches a system comprising the claimed constructs and these are on vectors (¶00138). The constructs comprise antibodies which as established by Hussack et al antibodies are tags (page 12). When pure to very pure proteins are needed ABTAG can be used as a purification tag for BSA-affinity matrix purification. When the efficacy of a protein needs to be evaluated in vivo, the protein-ABTAG can be mixed with BSA to overcome the limitation of short serum half-life of the protein As to claim 22, in ¶00212 a linker is used between the zippers which encompasses claims 22 as well as claim 26 as claim 26 is a description of one of the choices of claim 22 and hence the limitations are only relevant if a TNF, Ig, co-stimulatory ligand, immune checkpoint molecule or TNFRSF is selected from claim 22. Since Wong teaches a liner, the remaining choices are moot. However, it is noted that the membrane bound protein comprises a 4-1BB peptide (see ¶00276). In figure 3C, CD3z is attached to the membrane bound polypeptide as recited in claim 24 and claim 25. As recited in claims 27-29, the B-Zip CAR comprises an mCherry or my epitope tag. Epitope tags are recognized by specific antibodies allowing for their detection and analysis. These are placed on the extracellular domain (see Brown et al). Claim Rejections - 35 USC § 103 In the event the determination of the status of the application as subject to AIA 35 U.S.C. 102 and 103 (or as subject to pre-AIA 35 U.S.C. 102 and 103) is incorrect, any correction of the statutory basis for the rejection will not be considered a new ground of rejection if the prior art relied upon, and the rationale supporting the rejection, would be the same under either status. The following is a quotation of 35 U.S.C. 103 which forms the basis for all obviousness rejections set forth in this Office action: A patent for a claimed invention may not be obtained, notwithstanding that the claimed invention is not identically disclosed as set forth in section 102, if the differences between the claimed invention and the prior art are such that the claimed invention as a whole would have been obvious before the effective filing date of the claimed invention to a person having ordinary skill in the art to which the claimed invention pertains. Patentability shall not be negated by the manner in which the invention was made. Claims 12 and 21-29 are rejected under 35 U.S.C. 103 as being unpatentable over Wong et al (WO 2017/091546) as evidenced by Hussack et al (Frontiers in Immunology, 2017, pages 1-11) and as evidenced by Brown et al (PLOS ONE, 2013, pages 1-10) in view of Lim et al (US 20160264665). This rejection is maintained for reasons of record. While Wong et al do not provide the sequences of the BZips, they are known in the art and presented below. RESULT 5 US-15-096-971-68 (NOTE: this sequence has 4 duplicates in the database searched. See complete list at the end of this report) Sequence 68, US/15096971 Patent No. 9670281 GENERAL INFORMATION APPLICANT: Lim, Wendell A. APPLICANT: Morsut, Leonardo APPLICANT: Roybal, Kole T. TITLE OF INVENTION: BINDING-TRIGGERED TRANSCRIPTIONAL SWITCHES AND METHODS OF USE TITLE OF INVENTION: THEREOF FILE REFERENCE: UCSF-511WO CURRENT APPLICATION NUMBER: US/15/096,971 CURRENT FILING DATE: 2016-04-12 PRIOR APPLICATION NUMBER: US 62/120,256 PRIOR FILING DATE: 2015-02-24 PRIOR APPLICATION NUMBER: US 62/257,153 PRIOR FILING DATE: 2015-11-18 PRIOR APPLICATION NUMBER: US 62/269,758 PRIOR FILING DATE: 2015-12-18 NUMBER OF SEQ ID NOS: 210 SEQ ID NO 68 LENGTH: 205 TYPE: PRT ORGANISM: Artificial sequence FEATURE: OTHER INFORMATION: Synthetic polypeptide Query Match 100.0%; Score 233; Length 205; Best Local Similarity 100.0%; Matches 47; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 LEIRAAFLRQRNTALRTEVAELEQEVQRLENEVSQYETRYGPLGGGK 47 ||||||||||||||||||||||||||||||||||||||||||||||| Db 1 LEIRAAFLRQRNTALRTEVAELEQEVQRLENEVSQYETRYGPLGGGK 47 RESULT 3 US-15-096-971-67 (NOTE: this sequence has 4 duplicates in the database searched. See complete list at the end of this report) Sequence 67, US/15096971 Patent No. 9670281 GENERAL INFORMATION APPLICANT: Lim, Wendell A. APPLICANT: Morsut, Leonardo APPLICANT: Roybal, Kole T. TITLE OF INVENTION: BINDING-TRIGGERED TRANSCRIPTIONAL SWITCHES AND METHODS OF USE TITLE OF INVENTION: THEREOF FILE REFERENCE: UCSF-511WO CURRENT APPLICATION NUMBER: US/15/096,971 CURRENT FILING DATE: 2016-04-12 PRIOR APPLICATION NUMBER: US 62/120,256 PRIOR FILING DATE: 2015-02-24 PRIOR APPLICATION NUMBER: US 62/257,153 PRIOR FILING DATE: 2015-11-18 PRIOR APPLICATION NUMBER: US 62/269,758 PRIOR FILING DATE: 2015-12-18 NUMBER OF SEQ ID NOS: 210 SEQ ID NO 6729 LENGTH: 109 TYPE: PRT ORGANISM: Artificial sequence FEATURE: OTHER INFORMATION: Synthetic polypeptide Query Match 100.0%; Score 233; Length 109; Best Local Similarity 100.0%; Matches 47; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 LEIEAAFLERENTALETRVAELRQRVQRLRNRVSQYRTRYGPLGGGK 47 ||||||||||||||||||||||||||||||||||||||||||||||| Db 63 LEIEAAFLERENTALETRVAELRQRVQRLRNRVSQYRTRYGPLGGGK 109 Similarly, linkers for use in multimer ZIP domains, (GGGS)3 i.e. SEQ ID NO:3. This arrangement is shown in Mori on page 695, col 2, ¶3. Based on such teachings, it would have prima facie been obvious to one of ordinary skill in the art at the time the invention was made to include sequences as claimed in products referencing these sequences by name. As noted above: 1) Wong teaches use of ZIP domains and linkers but does not provide for the sequences; 2) as set forth above, these sequences are known and provided for in the art. Thus, a person of ordinary skill in the art, absent evidence to the contrary, would have reasonably expected that one could make and use the product given the ability to construct the products from the art. Response to Arguments Applicants argue that the characterization of Wong is incorrect. Specifically, applicants argue that while the paragraphs make clear that the BZIPs can be orthogonal, figure 16 does not demonstrate dimerization of BZIP1 and BZIP2 but with the AZIPs on the zipFvs. Applicants continue in the response to the 103 rejection that the incorporation of an orthogonal pair as shown in Figure 16 would render Wong inoperative for its intended purpose. Secondly, applicants argue that the instant invention provides specific and unexpected benefits by allowing dimer formation only in the same cell and by increasing stringency. As to the first argument, that the BZIPs can be orthogonal is enough as that is all that is required of the first expression vector. The diagrams in Figure 16 need not show the BZIPs interacting to prove this as these are depictions of the structure. That they are orthogonal is sufficient as that is all that is required of the constructs of the claims. Applicants appear to be arguing that by orthogonal the claims are indicating that the Bzips are orthogonal to the Azips. However, this is not the construction of the disclosure which states clearly that two orthogonal Bzips are added to the CAR. As to the second argument, the unexpected results are not commensurate with the claims. Applicants assert but do not dhow that the claimed invention has properties that would not have been expected in the art. The 103 is simply showing the sequences one would expect as they are known in the art. Applicants results of unexpected results would have to demonstrate that using those sequences would have led to unexpected properties. This requires actual results and not arguments. Conclusion Any inquiry concerning this communication or earlier communications from the examiner should be directed to MARIA MARVICH whose telephone number is (571)272-0774. The examiner can normally be reached 8 am - 5 pm. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Maria Leavitt can be reached on 571-272-1085. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /MARIA MARVICH/Primary Examiner, Art Unit 1634
Read full office action

Prosecution Timeline

Feb 16, 2021
Application Filed
Apr 07, 2025
Non-Final Rejection — §102, §103
Aug 11, 2025
Response Filed
Oct 16, 2025
Final Rejection — §102, §103
Mar 23, 2026
Request for Continued Examination
Mar 24, 2026
Response after Non-Final Action
Apr 04, 2026
Non-Final Rejection — §102, §103 (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12600986
NUCLEIC ACID MOLECULES CONTAINING SPACERS AND METHODS OF USE THEREOF
2y 5m to grant Granted Apr 14, 2026
Patent 12590321
METHODS AND COMPOSITIONS FOR GENETICALLY MODIFYING AND EXPANDING LYMPHOCYTES AND REGULATING THE ACTIVITY THEREOF
2y 5m to grant Granted Mar 31, 2026
Patent 12589151
T Cell Modification
2y 5m to grant Granted Mar 31, 2026
Patent 12589128
ONCOLYTIC ADENOVIRUS COMPOSITIONS
2y 5m to grant Granted Mar 31, 2026
Patent 12571002
GENE THERAPIES FOR LYSOSOMAL DISORDERS
2y 5m to grant Granted Mar 10, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

AI Strategy Recommendation

Get an AI-powered prosecution strategy using examiner precedents, rejection analysis, and claim mapping.
Powered by AI — typically takes 5-10 seconds

Prosecution Projections

3-4
Expected OA Rounds
55%
Grant Probability
82%
With Interview (+26.9%)
4y 2m
Median Time to Grant
High
PTA Risk
Based on 967 resolved cases by this examiner. Grant probability derived from career allow rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month