Prosecution Insights
Last updated: April 19, 2026
Application No. 17/253,658

METHODS OF TREATING CLRN1-ASSOCIATED HEARING LOSS AND/OR VISION LOSS

Final Rejection §DP
Filed
Dec 18, 2020
Examiner
ARIETI, RUTH SOPHIA
Art Unit
1635
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
Akouos, Inc.
OA Round
4 (Final)
46%
Grant Probability
Moderate
5-6
OA Rounds
2y 7m
To Grant
99%
With Interview

Examiner Intelligence

Grants 46% of resolved cases
46%
Career Allow Rate
37 granted / 81 resolved
-14.3% vs TC avg
Strong +73% interview lift
Without
With
+72.7%
Interview Lift
resolved cases with interview
Typical timeline
2y 7m
Avg Prosecution
37 currently pending
Career history
118
Total Applications
across all art units

Statute-Specific Performance

§101
5.1%
-34.9% vs TC avg
§103
30.5%
-9.5% vs TC avg
§102
12.3%
-27.7% vs TC avg
§112
29.2%
-10.8% vs TC avg
Black line = Tech Center average estimate • Based on career data from 81 resolved cases

Office Action

§DP
DETAILED ACTION Notice of Pre-AIA or AIA Status The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . Claims 229-232, 247-254, and 256-270 are pending. Status of the Application Applicant’s response and amendment filed 07 October 2025 are acknowledged and entered. Applicant has amended Claims 229, 232, 254, and 257-260. Applicant has added Claims 261-270. Response to Amendment Objections to the claims are withdrawn. Applicant has amended the claims to overcome the 103 rejections; the 103 rejections are withdrawn. The NSDP rejections are maintained. Claims 229-232, 247-254, and 256-270 are examined. Arguments applicable to newly applied rejections to amended or newly presented claims are addressed below. Arguments that are no longer relevant are not addressed. Rejections not reiterated here are withdrawn. Claim Interpretation It is noted that Claims 269-270 (which depend from Claim 264, 248, and 232) are composition claims directed to a kit that comprise instructions for performing a method. The kit includes instructions for performing a method but those instructions do not add change the structure of the composition recited in Claim 232 and therefore do not provide any patentable weight to composition claims. Applicant should note that methods to any kind of treatment or methods of treating any deafness, any hearing loss, any vision loss, any Usher syndrome type III, or any retinitis pigmentosa are not enabled. Double Patenting The nonstatutory double patenting rejection is based on a judicially created doctrine grounded in public policy (a policy reflected in the statute) so as to prevent the unjustified or improper timewise extension of the “right to exclude” granted by a patent and to prevent possible harassment by multiple assignees. A nonstatutory double patenting rejection is appropriate where the conflicting claims are not identical, but at least one examined application claim is not patentably distinct from the reference claim(s) because the examined application claim is either anticipated by, or would have been obvious over, the reference claim(s). See, e.g., In re Berg, 140 F.3d 1428, 46 USPQ2d 1226 (Fed. Cir. 1998); In re Goodman, 11 F.3d 1046, 29 USPQ2d 2010 (Fed. Cir. 1993); In re Longi, 759 F.2d 887, 225 USPQ 645 (Fed. Cir. 1985); In re Van Ornum, 686 F.2d 937, 214 USPQ 761 (CCPA 1982); In re Vogel, 422 F.2d 438, 164 USPQ 619 (CCPA 1970); In re Thorington, 418 F.2d 528, 163 USPQ 644 (CCPA 1969). A timely filed terminal disclaimer in compliance with 37 CFR 1.321(c) or 1.321(d) may be used to overcome an actual or provisional rejection based on nonstatutory double patenting provided the reference application or patent either is shown to be commonly owned with the examined application, or claims an invention made as a result of activities undertaken within the scope of a joint research agreement. See MPEP § 717.02 for applications subject to examination under the first inventor to file provisions of the AIA as explained in MPEP § 2159. See MPEP § 2146 et seq. for applications not subject to examination under the first inventor to file provisions of the AIA . A terminal disclaimer must be signed in compliance with 37 CFR 1.321(b). The filing of a terminal disclaimer by itself is not a complete reply to a nonstatutory double patenting (NSDP) rejection. A complete reply requires that the terminal disclaimer be accompanied by a reply requesting reconsideration of the prior Office action. Even where the NSDP rejection is provisional the reply must be complete. See MPEP § 804, subsection I.B.1. For a reply to a non-final Office action, see 37 CFR 1.111(a). For a reply to final Office action, see 37 CFR 1.113(c). A request for reconsideration while not provided for in 37 CFR 1.113(c) may be filed after final for consideration. See MPEP §§ 706.07(e) and 714.13. The USPTO Internet website contains terminal disclaimer forms which may be used. Please visit www.uspto.gov/patent/patents-forms. The actual filing date of the application in which the form is filed determines what form (e.g., PTO/SB/25, PTO/SB/26, PTO/AIA /25, or PTO/AIA /26) should be used. A web-based eTerminal Disclaimer may be filled out completely online using web-screens. An eTerminal Disclaimer that meets all requirements is auto-processed and approved immediately upon submission. For more information about eTerminal Disclaimers, refer to www.uspto.gov/patents/apply/applying-online/eterminal-disclaimer. Claims 229-232, 247-254, and 256-270 are rejected on the ground of nonstatutory double patenting as being unpatentable over claims 1-28 of the U.S. Patent No. 11807867 (“US867”) in view of WO900, Powell, App178, and US952. This rejection is maintained and updated in response to the claim amendments. All supporting references are of record. Although the claims at issue are not identical, they are directed to overlapping subject matter because the instant claims recite a composition comprising an AAV nucleic acid vector wherein the vector comprises a 5’ ITR, a CMV enhancer, a CBA promoter, a chimeric intron according to SEQ ID NO 16, a 5’UTR, a coding sequence (CDS) encoding a CLRN1 protein according to SEQ ID NO 3, a 3’UTR, a polyA signal, and a 3’ITR, wherein the CDS comprises a nt sequence spanning 2 consecutive exons of CLRN1 genomic DNA and lacks an intron sequence between them; wherein the composition can comprise other components such as SEQ ID NOs 17 or 20; to the composition comprising an excipient; to an AAV2 capsid comprising the composition, to an Anc80 capsid comprising the composition; to a kit comprising the composition; and to methods of introducing it to a cochlea of a mammal that can be a human who can have been previously identified as having a defective endogenous CLRN1 gene; to methods of increasing CLRN1 expression in the ear or eye; and to methods of treating hearing or vision loss. The US867 claims are drawn to a plurality of recombinant AAV vectors: a first vector comprising a nucleic acid sequence of SEQ ID NO 96 and a second vector comprising a nucleic acid sequence of SEQ ID NO 105 (US867), wherein each of the vectors is encapsulated by an AAV capsid having a certain serotype, wherein the capsid can be an AAV2 capsid or an Anc80 capsid; to a composition comprising the vectors, wherein the composition can be formulated for intra-cochlear administration, to a method of expressing a recombinant full-length otoferlin protein in a mammalian cell, and/or to methods of treating hearing loss by administering the vectors into the cochlea of a subject. Both claim sets are directed to AAV vectors for treating hearing loss in a mammal or human by administering the vector to the cochlea of the mammal/human. An artisan would not know what is US867 SEQ ID NO 96 so they would consult the US867 Spec. and SEQ listing and find (Col 184 L59-67; Col 185-195) SEQ ID NO 96 comprises two ITRs (a 5’ ITR and a 3’ITR), a CAG promoter comprising: a CMV enhancer, chicken β-actin gene sequence, and a chimeric intron. US867 SEQ ID NO 96 comprises claimed SEQ ID NOs 16 and 17 as shown by the following alignments: US-17-816-305-96 (NOTE: this sequence has 2 duplicates in the database searched. See complete list at the end of this report) Sequence 96, US/17816305 Patent No. 11807867 GENERAL INFORMATION APPLICANT: AKOUOS, INC. (en) TITLE OF INVENTION: COMPOSITIONS AND METHODS FOR TREATING NON-AGE-ASSOCIATED HEARING IMPAIRMENT IN A HUMAN SUBJECT (en) FILE REFERENCE: 4833.0050002 CURRENT APPLICATION NUMBER: US/17/816,305 CURRENT FILING DATE: 2022-07-29 NUMBER OF SEQ ID NOS: 110 SEQ ID NO 96 LENGTH: 4744 TYPE: DNA FEATURE: NAME/KEY: source LOCATION: 1..4744 QUALIFIERS: mol_type = other DNA organism = synthetic construct Query Match 100.0%; Score 1013; Length 4744; Best Local Similarity 100.0%; Matches 1013; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 GGAGTCGCTGCGTTGCCTTCGCCCCGTGCCCCGCTCCGCGCCGCCTCGCGCCGCCCGCCC 60 SEQ ID NO 16 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 828 GGAGTCGCTGCGTTGCCTTCGCCCCGTGCCCCGCTCCGCGCCGCCTCGCGCCGCCCGCCC 887 SEQ ID NO 96 Qy 61 CGGCTCTGACTGACCGCGTTACTCCCACAGGTGAGCGGGCGGGACGGCCCTTCTCCTCCG 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 888 CGGCTCTGACTGACCGCGTTACTCCCACAGGTGAGCGGGCGGGACGGCCCTTCTCCTCCG 947 Qy 121 GGCTGTAATTAGCGCTTGGTTTAATGACGGCTCGTTTCTTTTCTGTGGCTGCGTGAAAGC 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 948 GGCTGTAATTAGCGCTTGGTTTAATGACGGCTCGTTTCTTTTCTGTGGCTGCGTGAAAGC 1007 Qy 181 CTTAAAGGGCTCCGGGAGGGCCCTTTGTGCGGGGGGGAGCGGCTCGGGGGGTGCGTGCGT 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1008 CTTAAAGGGCTCCGGGAGGGCCCTTTGTGCGGGGGGGAGCGGCTCGGGGGGTGCGTGCGT 1067 Qy 241 GTGTGTGTGCGTGGGGAGCGCCGCGTGCGGCCCGCGCTGCCCGGCGGCTGTGAGCGCTGC 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1068 GTGTGTGTGCGTGGGGAGCGCCGCGTGCGGCCCGCGCTGCCCGGCGGCTGTGAGCGCTGC 1127 Qy 301 GGGCGCGGCGCGGGGCTTTGTGCGCTCCGCGTGTGCGCGAGGGGAGCGCGGCCGGGGGCG 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1128 GGGCGCGGCGCGGGGCTTTGTGCGCTCCGCGTGTGCGCGAGGGGAGCGCGGCCGGGGGCG 1187 Qy 361 GTGCCCCGCGGTGCGGGGGGGCTGCGAGGGGAACAAAGGCTGCGTGCGGGGTGTGTGCGT 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1188 GTGCCCCGCGGTGCGGGGGGGCTGCGAGGGGAACAAAGGCTGCGTGCGGGGTGTGTGCGT 1247 Qy 421 GGGGGGGTGAGCAGGGGGTGTGGGCGCGGCGGTCGGGCTGTAACCCCCCCCTGCACCCCC 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1248 GGGGGGGTGAGCAGGGGGTGTGGGCGCGGCGGTCGGGCTGTAACCCCCCCCTGCACCCCC 1307 Qy 481 CTCCCCGAGTTGCTGAGCACGGCCCGGCTTCGGGTGCGGGGCTCCGTGCGGGGCGTGGCG 540 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1308 CTCCCCGAGTTGCTGAGCACGGCCCGGCTTCGGGTGCGGGGCTCCGTGCGGGGCGTGGCG 1367 Qy 541 CGGGGCTCGCCGTGCCGGGCGGGGGGTGGCGGCAGGTGGGGGTGCCGGGCGGGGCGGGGC 600 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1368 CGGGGCTCGCCGTGCCGGGCGGGGGGTGGCGGCAGGTGGGGGTGCCGGGCGGGGCGGGGC 1427 Qy 601 CGCCTCGGGCCGGGGAGGGCTCGGGGGAGGGGCGCGGCGGCCCCCGGAGCGCCGGCGGCT 660 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1428 CGCCTCGGGCCGGGGAGGGCTCGGGGGAGGGGCGCGGCGGCCCCCGGAGCGCCGGCGGCT 1487 Qy 661 GTCGAGGCGCGGCGAGCCGCAGCCATTGCCTTTTATGGTAATCGTGCGAGAGGGCGCAGG 720 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1488 GTCGAGGCGCGGCGAGCCGCAGCCATTGCCTTTTATGGTAATCGTGCGAGAGGGCGCAGG 1547 Qy 721 GACTTCCTTTGTCCCAAATCTGTGCGGAGCCGAAATCTGGGAGGCGCCGCCGCACCCCCT 780 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1548 GACTTCCTTTGTCCCAAATCTGTGCGGAGCCGAAATCTGGGAGGCGCCGCCGCACCCCCT 1607 Qy 781 CTAGCGGGCGCGGGGCGAAGCGGTGCGGCGCCGGCAGGAAGGAAATGGGCGGGGAGGGCC 840 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1608 CTAGCGGGCGCGGGGCGAAGCGGTGCGGCGCCGGCAGGAAGGAAATGGGCGGGGAGGGCC 1667 Qy 841 TTCGTGCGTCGCCGCGCCGCCGTCCCCTTCTCCCTCTCCAGCCTCGGGGCTGTCCGCGGG 900 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1668 TTCGTGCGTCGCCGCGCCGCCGTCCCCTTCTCCCTCTCCAGCCTCGGGGCTGTCCGCGGG 1727 Qy 901 GGGACGGCTGCCTTCGGGGGGGACGGGGCAGGGCGGGGTTCGGCTTCTGGCGTGTGACCG 960 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1728 GGGACGGCTGCCTTCGGGGGGGACGGGGCAGGGCGGGGTTCGGCTTCTGGCGTGTGACCG 1787 Qy 961 GCGGCTCTAGAGCCTCTGCTAACCATGTTCATGCCTTCTTCTTTTTCCTACAG 1013 ||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1788 GCGGCTCTAGAGCCTCTGCTAACCATGTTCATGCCTTCTTCTTTTTCCTACAG 1840 SEQ ID NO 17 Query Match 100.0%; Score 380; DB 1; Length 4744; Best Local Similarity 100.0%; Matches 380; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 GACATTGATTATTGACTAGTTATTAATAGTAATCAATTACGGGGTCATTAGTTCATAGCC 60 SEQ ID NO 17 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 168 GACATTGATTATTGACTAGTTATTAATAGTAATCAATTACGGGGTCATTAGTTCATAGCC 227 SEQ ID NO 96 Qy 61 CATATATGGAGTTCCGCGTTACATAACTTACGGTAAATGGCCCGCCTGGCTGACCGCCCA 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 228 CATATATGGAGTTCCGCGTTACATAACTTACGGTAAATGGCCCGCCTGGCTGACCGCCCA 287 Qy 121 ACGACCCCCGCCCATTGACGTCAATAATGACGTATGTTCCCATAGTAACGCCAATAGGGA 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 288 ACGACCCCCGCCCATTGACGTCAATAATGACGTATGTTCCCATAGTAACGCCAATAGGGA 347 Qy 181 CTTTCCATTGACGTCAATGGGTGGACTATTTACGGTAAACTGCCCACTTGGCAGTACATC 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 348 CTTTCCATTGACGTCAATGGGTGGACTATTTACGGTAAACTGCCCACTTGGCAGTACATC 407 Qy 241 AAGTGTATCATATGCCAAGTACGCCCCCTATTGACGTCAATGACGGTAAATGGCCCGCCT 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 408 AAGTGTATCATATGCCAAGTACGCCCCCTATTGACGTCAATGACGGTAAATGGCCCGCCT 467 Qy 301 GGCATTATGCCCAGTACATGACCTTATGGGACTTTCCTACTTGGCAGTACATCTACGTAT 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 468 GGCATTATGCCCAGTACATGACCTTATGGGACTTTCCTACTTGGCAGTACATCTACGTAT 527 Qy 361 TAGTCATCGCTATTACCATG 380 |||||||||||||||||||| Db 528 TAGTCATCGCTATTACCATG 547 Therefore the patented US867 claims recite elements (i), (ii), (iii), (iv), and (ix) of the claimed invention. Then the other prior art teaches the other claim elements that the US867 claims do not recite: WO900 (¶99) teaches an rAAV vector comprising the CLRN1 cDNA including the 5’ and 3’UTRs, and teaches driving it with the chicken β-actin promoter. WO900 teaches (¶9-10) the polynucleotide (polynt) can include a sequence having SEQ ID NO 2 (which it specifies comprises a 5’UTR and 3’UTR) and can be included on a vector that can be an adeno-associated viral vector (AAV) that can be used for transfecting ocular cells or cells of the inner ear. WO900 teaches (¶21) that the heterologous polynucleotide comprised in the AAV vector is flanked by at least one, and generally by two AAV inverted terminal repeat sequence (ITRs); an artisan would realize that being flanked by two ITRs refers to one ITR on either side, which is a 5’ITR and a 3’ITR. WO900 teaches (¶10-11) treating retinal cells. WO900 SEQ ID NO 2 comprises a polynt comprising a sequence encoding the amino acid sequence of instant SEQ ID NO 3 (which has been back-translated from AA[Wingdings font/0xE0]nucleotides). This is shown by the following sequence alignment: RESULT 7 BDA01054 ID BDA01054 standard; cDNA; 2352 BP. XX AC BDA01054; XX DT 16-JUN-2016 (first entry) XX DE Human derived clarin-1 (CLRN1) polynucleotide SEQ ID NO:2. XX KW CLRN1 gene; auditory; clarin-1; gene therapy; hearing loss; KW ophthalmological; ss; therapeutic; usher syndrome iii; vision disorder. XX OS Homo sapiens. XX CC PN WO2016073900-A1. XX CC PD 12-MAY-2016. XX CC PF 06-NOV-2015; 2015WO-US059546. XX PR 06-NOV-2014; 2014US-0076114P. PR 08-MAY-2015; 2015US-0158846P. XX CC PA (UCWR ) UNIV CASE WESTERN RESERVE. XX CC PI Alagramam KN; XX DR WPI; 2016-282935/37. XX CC PT New polynucleotide comprising a nucleic acid sequence that includes a CC PT cDNA coding sequence of a clarin-1 gene, useful for treating vision CC PT and/or hearing loss associated with Usher syndrome III. XX CC PS Claim 9; SEQ ID NO 2; 43pp; English. XX CC The invention relates to a novel polynucleotide, used for treating vision CC and/or hearing loss associated with Usher syndrome III. This CC polynucleotide comprises a nucleic acid sequence that includes a cDNA CC coding sequence of a clarin-1 (CLRN1) gene and a 3' untranslated region CC (UTR) nucleic acid that is derived from the 3' UTR of the clarin-1 gene, CC where the 3' UTR nucleic acid enhances expression of clarin-1 in a cell CC transfected with the polynucleotide compared to a cell transfected with a CC similar polynucleotide devoid of the 3' UTR nucleic acid. The invention CC further claims: a nucleic acid construct comprising a polynucleotide CC defined above; a vector for transfecting a cell, comprising a CC polynucleotide defined above, where the transfected cell expresses clarin CC -1; and a method of treating vision and/or hearing loss associated with CC Usher syndrome III in a subject by administering to the ocular cells CC and/or cells of the inner ear of the subject, a vector that promotes CC expression of clarin-1 in the cells. The present sequence is a clarin-1 CC polynucleotide, used for treating vision and/or hearing loss associated CC with Usher syndrome III in a subject. XX SQ Sequence 2352 BP; 705 A; 475 C; 484 G; 688 T; 0 U; 0 Other; Alignment Scores: Length: 2352 Score: 1214.00 Matches: 232 Percent Similarity: 100.0% Conservative: 0 Best Local Similarity: 100.0% Mismatches: 0 Query Match: 100.0% Indels: 0 Gaps: 0 US-17-253-658-3 (1-232) x BDA01054 (1-2352) Qy 1 MetProSerGlnGlnLysLysIleIlePheCysMetAlaGlyValPheSerPheAlaCys 20 SEQ ID NO 3 translated[Wingdings font/0xE0]NT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 282 ATGCCAAGCCAACAGAAGAAAATCATTTTTTGCATGGCCGGAGTGTTCAGTTTTGCATGT 341 WO900 SEQ ID NO 2 Qy 21 AlaLeuGlyValValThrAlaLeuGlyThrProLeuTrpIleLysAlaThrValLeuCys 40 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 342 GCCCTCGGAGTTGTGACAGCCTTGGGGACACCGTTGTGGATCAAAGCCACTGTCCTCTGC 401 Qy 41 LysThrGlyAlaLeuLeuValAsnAlaSerGlyGlnGluLeuAspLysPheMetGlyGlu 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 402 AAAACGGGAGCTCTGCTCGTCAATGCCTCAGGGCAGGAGCTGGACAAGTTTATGGGTGAA 461 Qy 61 MetGlnTyrGlyLeuPheHisGlyGluGlyValArgGlnCysGlyLeuGlyAlaArgPro 80 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 462 ATGCAGTACGGGCTTTTCCACGGAGAGGGTGTGAGGCAGTGTGGGTTGGGAGCAAGGCCC 521 Qy 81 PheArgPheSerPhePheProAspLeuLeuLysAlaIleProValSerIleHisValAsn 100 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 522 TTTCGGTTCTCATTTTTTCCAGATTTGCTCAAAGCAATCCCAGTGAGCATCCACGTCAAT 581 Qy 101 ValIleLeuPheSerAlaIleLeuIleValLeuThrMetValGlyThrAlaPhePheMet 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 582 GTCATTCTCTTCTCTGCCATCCTTATTGTGTTAACCATGGTGGGGACAGCCTTCTTCATG 641 Qy 121 TyrAsnAlaPheGlyLysProPheGluThrLeuHisGlyProLeuGlyLeuTyrLeuLeu 140 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 642 TACAATGCTTTTGGAAAACCTTTTGAAACTCTGCATGGTCCCCTAGGGCTGTACCTTTTG 701 Qy 141 SerPheIleSerGlySerCysGlyCysLeuValMetIleLeuPheAlaSerGluValLys 160 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 702 AGCTTCATTTCAGGCTCCTGTGGCTGTCTTGTCATGATATTGTTTGCCTCTGAAGTGAAA 761 Qy 161 IleHisHisLeuSerGluLysIleAlaAsnTyrLysGluGlyThrTyrValTyrLysThr 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 762 ATCCATCACCTCTCAGAAAAAATTGCAAATTATAAAGAAGGGACTTATGTCTACAAAACG 821 Qy 181 GlnSerGluLysTyrThrThrSerPheTrpValIlePhePheCysPhePheValHisPhe 200 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 822 CAAAGTGAAAAATATACCACCTCATTCTGGGTCATTTTCTTTTGCTTTTTTGTTCATTTT 881 Qy 201 LeuAsnGlyLeuLeuIleArgLeuAlaGlyPheGlnPheProPheAlaLysSerLysAsp 220 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 882 CTGAATGGGCTCCTAATACGACTTGCTGGATTTCAGTTCCCTTTTGCAAAATCTAAAGAC 941 Qy 221 AlaGluThrThrAsnValAlaAlaAspLeuMetTyr 232 |||||||||||||||||||||||||||||||||||| Db 942 GCAGAAACAACTAATGTAGCTGCAGATCTAATGTAC 977 That alignment shows that the composition of WO900 comprises SEQ ID NO 3 itself, a 5’UTR, and a 3’UTR. Those are elements (v), (vi), and (vii) of the instant claims. Powell teaches (§Polyadenylation Signal Sequences and Upstream Enhancer) one study, in human epithelial-like cells, found that a transgene had a 2.5-fold increase in expression with … bovine growth hormone polyA (bGHpA) signal sequences compared to a minimal synthetic polyA (SPA) signal. App178 teaches SEQ ID NO 30 which comprises a bovine growth hormone polyA signal and is 100% identical to instant SEQ ID NO 20, as shown by the following sequence alignment: RESULT 1 AXQ64086 (NOTE: this sequence has 272 duplicates in the database searched. See complete list at the end of this report) ID AXQ64086 standard; DNA; 225 BP. XX AC AXQ64086; XX DT 29-OCT-2009 (first entry) XX DE BGH polyA Yes1 supplementary expression cassette 3' UTR, SEQ:30 #2. XX KW 3'-utr; Yes1; dna cassette; gene expression; gene silencing; KW protein production; rna interference; ss. XX OS Bos taurus. OS Synthetic. XX CC PN US2009215178-A1. XX CC PD 27-AUG-2009. XX CC PF 22-FEB-2008; 2008US-00035437. XX PR 22-FEB-2008; 2008US-00035437. XX CC PA (TANG/) TANG Z. XX CC PI Tang Z; XX DR WPI; 2009-M96179/59. XX CC PT Generating cell clones with stable transgene (Gene of Interest (GOI)) CC PT expression comprises inactivation of endogenous essential genes of cell CC PT substrate and trans-complementation of essential genes products. XX CC PS Example 3; SEQ ID NO 30; 9pp; English. XX CC The present invention relates to a method for generating cell clones with CC stable transgene (Gene Of Interest (GOI)) expression. The method of the CC invention comprises: (i) inactivation of endogenous essential genes of CC cell substrate through Gene Inactivation Cassettes (GIC), (ii) trans- CC complementation of essential gene products through Gene Supplementary CC Cassettes (GSC), alternatively, the cassette codes for the gene product CC that is capable of inactivating GIC function, (iii) the GOI expression CC cassettes are preferably, physically linked to GSC to take advantage of CC favourable selective pressure, (iv) GIC could be preferably physically CC linked to GSC and GOI expression cassettes, where the endogenous CC essential genes of cell substrate refer to genes or combination of genes CC that are essential for cell survival and / or cell proliferation. The GIC CC comprises a vector comprising a promoter operably linked to RNA CC interference, RNAi (shRNA) / dsRNA / ribozyme molecule, or tandem repeats CC of such transcript units, targeted to cell endogenous essential mRNA. The CC invention provides strategies for increasing the productivity of CC recombinant protein expression in isogenic cell-lines, and a novel CC selection system for the improved stability and homogeneity of transgene CC expression in isogenic cells without dependence on continuous selective CC drugs. An example of the invention provides an essential gene knock-down CC cassette, targeted at 3' UTR of human endogenous Yes1 gene, and a CC supplementary Yes1 expression cassette which uses a 3' UTR from bovine CC growth hormone (BGH) polyA. The present sequence is a bovine growth CC hormone (BGH) polyA Yes1 supplementary expression cassette 3' UTR, used CC in an example of the invention. Note: This version of SEQ ID 30 is given CC in example 3, but it is not the same as the sequence referred to as SEQ CC ID 30 (seeAXQ61560) in the sequence listing. XX SQ Sequence 225 BP; 41 A; 53 C; 72 G; 59 T; 0 U; 0 Other; Query Match 100.0%; Score 225; Length 225; Best Local Similarity 100.0%; Matches 225; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 CTGTGCCTTCTAGTTGCCAGCCATCTGTTGTTTGCCCCTCCCCCGTGCCTTCCTTGACCC 60 SEQ ID NO 20 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 CTGTGCCTTCTAGTTGCCAGCCATCTGTTGTTTGCCCCTCCCCCGTGCCTTCCTTGACCC 60 Prior art SEQ Qy 61 TGGAAGGTGCCACTCCCACTGTCCTTTCCTAATAAAATGAGGAAATTGCATCGCATTGTC 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 TGGAAGGTGCCACTCCCACTGTCCTTTCCTAATAAAATGAGGAAATTGCATCGCATTGTC 120 Qy 121 TGAGTAGGTGTCATTCTATTCTGGGGGGTGGGGTGGGGCAGGACAGCAAGGGGGAGGATT 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 TGAGTAGGTGTCATTCTATTCTGGGGGGTGGGGTGGGGCAGGACAGCAAGGGGGAGGATT 180 Qy 181 GGGAAGACAATAGCAGGCATGCTGGGGATGCGGTGGGCTCTATGG 225 ||||||||||||||||||||||||||||||||||||||||||||| Db 181 GGGAAGACAATAGCAGGCATGCTGGGGATGCGGTGGGCTCTATGG 225 A poly-A sequence comprising SEQ ID NO 20 is component (viii) of the instant claims. It would have been obvious to an artisan before the effective filing date of the claimed invention to modify the invention of the US867 claims with the sequence encoding CLRN1 of WO900 and the teachings about a polyA sequence of Powell and App178 for the benefits of using the US867 vectors to treat Usher syndrome and to increase transgene expression. One would have been motivated to do so with a reasonable expectation of success because Powell teaches that a bovine growth hormone polyA signal can increase transgene expression. One would have been motivated to do so with a reasonable expectation of success because WO900 teaches (¶3-4) expressing CLRN1 had known usage in treating Usher syndrome, including (¶11) for both hearing and vision losses, and it would have been a simple matter to swap the sequence encoding CLRN1 of WO900 for the sequence encoding otoferlin of the US867 claims. An artisan would know that they need only use one AAV vector to encode CLRN1 because WO900 teaches (¶99, 108-111) the entire mCLRN1 cDNA was placed on a single AAV vector, indicating the entire CLRN1 cDNA could fit on a single AAV vector. They would have been motivated to use a single vector because it is simpler to administer a single vector gene therapy than a dual vector gene therapy. US952 teaches (Col 11 L3-15) a kit that comprises nucleic acid compounds within a container of solution and that the kit can comprise a pre-loaded syringe comprising the compounds. An artisan would have put their compounds into a kit comprising a pre-loaded syringe for the benefit of ensuring that the recipient has the exact dosage ready to administer and because doing so would have prevented any complications that arise from mixing a solution and then getting the mixed solution into a syringe. Therefore the instant claims would have been obvious in view of the US867 claims, WO900, Powell, App178, and US952. Claims 229-232, 247-254, and 256-270 are rejected on the ground of nonstatutory double patenting as being unpatentable over claims 1-25 of US Patent No. 12077773 (“US773”) in view of WO900, Powell, App178, and US952. This rejection is maintained and updated in response to the claim amendments. All supporting references are of record. Although the claims at issue are not identical, they are directed to overlapping subject matter because the instant claims recite a composition comprising an AAV nucleic acid vector wherein the vector comprises a 5’ ITR, a CMV enhancer, a CBA promoter, a chimeric intron according to SEQ ID NO 16, a 5’UTR, a coding sequence (CDS) encoding a CLRN1 protein according to SEQ ID NO 3, a 3’UTR, a polyA signal, and a 3’ITR, wherein the CDS comprises a nt sequence spanning 2 consecutive exons of CLRN1 genomic DNA and lacks an intron sequence between them; wherein the composition can comprise other components such as SEQ ID NOs 17 or 20; to the composition comprising an excipient; to an AAV2 capsid comprising the composition, to an Anc80 capsid comprising the composition; to a kit comprising the composition; and to methods of introducing it to a cochlea of a mammal that can be a human who can have been previously identified as having a defective endogenous CLRN1 gene; to methods of increasing CLRN1 expression in the ear or eye; and to methods of treating hearing or vision loss. The US773 claims are drawn to a plurality of recombinant AAV vectors: a first vector comprising a 5’ITR, a 3’ITR, a CAG promoter comprising the CMV enhancer of SEQ ID NO 98, a chicken β-actin gene sequence, and the chimeric intron of SEQ ID NO 100 and a second vector, wherein each of the vectors is encapsulated by an AAV capsid having a certain serotype, wherein the AAV vector can be an AAV2 or an Anc80; to a composition comprising the vectors, wherein the composition can be formulated for intra-cochlear administration. Both claim sets are directed to AAV vectors for administering a gene therapy to the cochlea. An artisan would not know what are US773 SEQ ID NOs 98 and 100 so they would consult the US773 Spec. and SEQ listing and find (Col 184 L59-67; Col 185-195) SEQ ID NO 98 comprises a CMV enhancer and SEQ ID NO 100 comprises a chimeric intron. US773 SEQ ID NO 100 comprises claimed SEQ ID NO 16 and US773 SEQ ID NO 98 comprises claimed SEQ ID NO 17 as shown by the following alignments: US-18-485-178-100 Filing date in PALM: 2023-10-11 Sequence 100, US/18485178 Patent No. 12077773 GENERAL INFORMATION APPLICANT: AKOUOS, INC. (en) TITLE OF INVENTION: COMPOSITIONS AND METHODS FOR TREATING NON-AGE-ASSOCIATED HEARING IMPAIRMENT IN A HUMAN SUBJECT (en) FILE REFERENCE: 4833.0050003 CURRENT APPLICATION NUMBER: US/18/485,178 CURRENT FILING DATE: 2023-10-11 NUMBER OF SEQ ID NOS: 110 SEQ ID NO 100 LENGTH: 1013 TYPE: DNA FEATURE: NAME/KEY: source LOCATION: 1..1013 QUALIFIERS: mol_type = other DNA organism = synthetic construct Query Match 100.0%; Score 1013; Length 1013; Best Local Similarity 100.0%; Matches 1013; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 GGAGTCGCTGCGTTGCCTTCGCCCCGTGCCCCGCTCCGCGCCGCCTCGCGCCGCCCGCCC 60 SEQ ID NO 16 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 GGAGTCGCTGCGTTGCCTTCGCCCCGTGCCCCGCTCCGCGCCGCCTCGCGCCGCCCGCCC 60 SEQ ID NO 100 Qy 61 CGGCTCTGACTGACCGCGTTACTCCCACAGGTGAGCGGGCGGGACGGCCCTTCTCCTCCG 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 CGGCTCTGACTGACCGCGTTACTCCCACAGGTGAGCGGGCGGGACGGCCCTTCTCCTCCG 120 Qy 121 GGCTGTAATTAGCGCTTGGTTTAATGACGGCTCGTTTCTTTTCTGTGGCTGCGTGAAAGC 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 GGCTGTAATTAGCGCTTGGTTTAATGACGGCTCGTTTCTTTTCTGTGGCTGCGTGAAAGC 180 Qy 181 CTTAAAGGGCTCCGGGAGGGCCCTTTGTGCGGGGGGGAGCGGCTCGGGGGGTGCGTGCGT 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 CTTAAAGGGCTCCGGGAGGGCCCTTTGTGCGGGGGGGAGCGGCTCGGGGGGTGCGTGCGT 240 Qy 241 GTGTGTGTGCGTGGGGAGCGCCGCGTGCGGCCCGCGCTGCCCGGCGGCTGTGAGCGCTGC 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 GTGTGTGTGCGTGGGGAGCGCCGCGTGCGGCCCGCGCTGCCCGGCGGCTGTGAGCGCTGC 300 Qy 301 GGGCGCGGCGCGGGGCTTTGTGCGCTCCGCGTGTGCGCGAGGGGAGCGCGGCCGGGGGCG 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 GGGCGCGGCGCGGGGCTTTGTGCGCTCCGCGTGTGCGCGAGGGGAGCGCGGCCGGGGGCG 360 Qy 361 GTGCCCCGCGGTGCGGGGGGGCTGCGAGGGGAACAAAGGCTGCGTGCGGGGTGTGTGCGT 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 GTGCCCCGCGGTGCGGGGGGGCTGCGAGGGGAACAAAGGCTGCGTGCGGGGTGTGTGCGT 420 Qy 421 GGGGGGGTGAGCAGGGGGTGTGGGCGCGGCGGTCGGGCTGTAACCCCCCCCTGCACCCCC 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 421 GGGGGGGTGAGCAGGGGGTGTGGGCGCGGCGGTCGGGCTGTAACCCCCCCCTGCACCCCC 480 Qy 481 CTCCCCGAGTTGCTGAGCACGGCCCGGCTTCGGGTGCGGGGCTCCGTGCGGGGCGTGGCG 540 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 481 CTCCCCGAGTTGCTGAGCACGGCCCGGCTTCGGGTGCGGGGCTCCGTGCGGGGCGTGGCG 540 Qy 541 CGGGGCTCGCCGTGCCGGGCGGGGGGTGGCGGCAGGTGGGGGTGCCGGGCGGGGCGGGGC 600 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 541 CGGGGCTCGCCGTGCCGGGCGGGGGGTGGCGGCAGGTGGGGGTGCCGGGCGGGGCGGGGC 600 Qy 601 CGCCTCGGGCCGGGGAGGGCTCGGGGGAGGGGCGCGGCGGCCCCCGGAGCGCCGGCGGCT 660 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 601 CGCCTCGGGCCGGGGAGGGCTCGGGGGAGGGGCGCGGCGGCCCCCGGAGCGCCGGCGGCT 660 Qy 661 GTCGAGGCGCGGCGAGCCGCAGCCATTGCCTTTTATGGTAATCGTGCGAGAGGGCGCAGG 720 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 661 GTCGAGGCGCGGCGAGCCGCAGCCATTGCCTTTTATGGTAATCGTGCGAGAGGGCGCAGG 720 Qy 721 GACTTCCTTTGTCCCAAATCTGTGCGGAGCCGAAATCTGGGAGGCGCCGCCGCACCCCCT 780 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 721 GACTTCCTTTGTCCCAAATCTGTGCGGAGCCGAAATCTGGGAGGCGCCGCCGCACCCCCT 780 Qy 781 CTAGCGGGCGCGGGGCGAAGCGGTGCGGCGCCGGCAGGAAGGAAATGGGCGGGGAGGGCC 840 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 781 CTAGCGGGCGCGGGGCGAAGCGGTGCGGCGCCGGCAGGAAGGAAATGGGCGGGGAGGGCC 840 Qy 841 TTCGTGCGTCGCCGCGCCGCCGTCCCCTTCTCCCTCTCCAGCCTCGGGGCTGTCCGCGGG 900 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 841 TTCGTGCGTCGCCGCGCCGCCGTCCCCTTCTCCCTCTCCAGCCTCGGGGCTGTCCGCGGG 900 Qy 901 GGGACGGCTGCCTTCGGGGGGGACGGGGCAGGGCGGGGTTCGGCTTCTGGCGTGTGACCG 960 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 901 GGGACGGCTGCCTTCGGGGGGGACGGGGCAGGGCGGGGTTCGGCTTCTGGCGTGTGACCG 960 Qy 961 GCGGCTCTAGAGCCTCTGCTAACCATGTTCATGCCTTCTTCTTTTTCCTACAG 1013 ||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 961 GCGGCTCTAGAGCCTCTGCTAACCATGTTCATGCCTTCTTCTTTTTCCTACAG 1013 SEQ ID NO 17 Query Match 100.0%; Score 380; DB 1; Length 381; Best Local Similarity 100.0%; Matches 380; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 GACATTGATTATTGACTAGTTATTAATAGTAATCAATTACGGGGTCATTAGTTCATAGCC 60 SEQ ID NO 17 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 GACATTGATTATTGACTAGTTATTAATAGTAATCAATTACGGGGTCATTAGTTCATAGCC 60 SEQ ID NO 96 Qy 61 CATATATGGAGTTCCGCGTTACATAACTTACGGTAAATGGCCCGCCTGGCTGACCGCCCA 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 CATATATGGAGTTCCGCGTTACATAACTTACGGTAAATGGCCCGCCTGGCTGACCGCCCA 120 Qy 121 ACGACCCCCGCCCATTGACGTCAATAATGACGTATGTTCCCATAGTAACGCCAATAGGGA 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 ACGACCCCCGCCCATTGACGTCAATAATGACGTATGTTCCCATAGTAACGCCAATAGGGA 180 Qy 181 CTTTCCATTGACGTCAATGGGTGGACTATTTACGGTAAACTGCCCACTTGGCAGTACATC 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 CTTTCCATTGACGTCAATGGGTGGACTATTTACGGTAAACTGCCCACTTGGCAGTACATC 240 Qy 241 AAGTGTATCATATGCCAAGTACGCCCCCTATTGACGTCAATGACGGTAAATGGCCCGCCT 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 AAGTGTATCATATGCCAAGTACGCCCCCTATTGACGTCAATGACGGTAAATGGCCCGCCT 300 Qy 301 GGCATTATGCCCAGTACATGACCTTATGGGACTTTCCTACTTGGCAGTACATCTACGTAT 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 GGCATTATGCCCAGTACATGACCTTATGGGACTTTCCTACTTGGCAGTACATCTACGTAT 360 Qy 361 TAGTCATCGCTATTACCATG 380 |||||||||||||||||||| Db 361 TAGTCATCGCTATTACCATG 380 Therefore the patented US773 claims recite elements (i), (ii), (iii), (iv), and (ix) of the claimed invention. Then the other prior art teaches the other claim elements that the US773 claims do not recite: WO900 teaches (¶99) an rAAV vector comprising the CLRN1 cDNA including the 5’ and 3’UTRs, and teaches driving it with the chicken β-actin promoter. WO900 teaches (¶9-10) the polynucleotide (polynt) can include a sequence having SEQ ID NO 2 (which it specifies comprises a 5’UTR and 3’UTR) and can be included on a vector that can be an adeno-associated viral vector (AAV) that can be used for transfecting ocular cells or cells of the inner ear. WO900 teaches (¶21) that the heterologous polynucleotide comprised in the AAV vector is flanked by at least one, and generally by two AAV inverted terminal repeat sequence (ITRs); an artisan would realize that being flanked by two ITRs refers to one ITR on either side, which is a 5’ITR and a 3’ITR. WO900 teaches (¶10-11) treating retinal cells. WO900 SEQ ID NO 2 comprises a polynt comprising a sequence encoding the amino acid sequence of instant SEQ ID NO 3 (which has been back-translated from AA[Wingdings font/0xE0]nucleotides). This is shown by the following sequence alignment: RESULT 7 BDA01054 ID BDA01054 standard; cDNA; 2352 BP. XX AC BDA01054; XX DT 16-JUN-2016 (first entry) XX DE Human derived clarin-1 (CLRN1) polynucleotide SEQ ID NO:2. XX KW CLRN1 gene; auditory; clarin-1; gene therapy; hearing loss; KW ophthalmological; ss; therapeutic; usher syndrome iii; vision disorder. XX OS Homo sapiens. XX CC PN WO2016073900-A1. XX CC PD 12-MAY-2016. XX CC PF 06-NOV-2015; 2015WO-US059546. XX PR 06-NOV-2014; 2014US-0076114P. PR 08-MAY-2015; 2015US-0158846P. XX CC PA (UCWR ) UNIV CASE WESTERN RESERVE. XX CC PI Alagramam KN; XX DR WPI; 2016-282935/37. XX CC PT New polynucleotide comprising a nucleic acid sequence that includes a CC PT cDNA coding sequence of a clarin-1 gene, useful for treating vision CC PT and/or hearing loss associated with Usher syndrome III. XX CC PS Claim 9; SEQ ID NO 2; 43pp; English. XX CC The invention relates to a novel polynucleotide, used for treating vision CC and/or hearing loss associated with Usher syndrome III. This CC polynucleotide comprises a nucleic acid sequence that includes a cDNA CC coding sequence of a clarin-1 (CLRN1) gene and a 3' untranslated region CC (UTR) nucleic acid that is derived from the 3' UTR of the clarin-1 gene, CC where the 3' UTR nucleic acid enhances expression of clarin-1 in a cell CC transfected with the polynucleotide compared to a cell transfected with a CC similar polynucleotide devoid of the 3' UTR nucleic acid. The invention CC further claims: a nucleic acid construct comprising a polynucleotide CC defined above; a vector for transfecting a cell, comprising a CC polynucleotide defined above, where the transfected cell expresses clarin CC -1; and a method of treating vision and/or hearing loss associated with CC Usher syndrome III in a subject by administering to the ocular cells CC and/or cells of the inner ear of the subject, a vector that promotes CC expression of clarin-1 in the cells. The present sequence is a clarin-1 CC polynucleotide, used for treating vision and/or hearing loss associated CC with Usher syndrome III in a subject. XX SQ Sequence 2352 BP; 705 A; 475 C; 484 G; 688 T; 0 U; 0 Other; Alignment Scores: Length: 2352 Score: 1214.00 Matches: 232 Percent Similarity: 100.0% Conservative: 0 Best Local Similarity: 100.0% Mismatches: 0 Query Match: 100.0% Indels: 0 Gaps: 0 US-17-253-658-3 (1-232) x BDA01054 (1-2352) Qy 1 MetProSerGlnGlnLysLysIleIlePheCysMetAlaGlyValPheSerPheAlaCys 20 SEQ ID NO 3 translated[Wingdings font/0xE0]NT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 282 ATGCCAAGCCAACAGAAGAAAATCATTTTTTGCATGGCCGGAGTGTTCAGTTTTGCATGT 341 WO900 SEQ ID NO 2 Qy 21 AlaLeuGlyValValThrAlaLeuGlyThrProLeuTrpIleLysAlaThrValLeuCys 40 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 342 GCCCTCGGAGTTGTGACAGCCTTGGGGACACCGTTGTGGATCAAAGCCACTGTCCTCTGC 401 Qy 41 LysThrGlyAlaLeuLeuValAsnAlaSerGlyGlnGluLeuAspLysPheMetGlyGlu 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 402 AAAACGGGAGCTCTGCTCGTCAATGCCTCAGGGCAGGAGCTGGACAAGTTTATGGGTGAA 461 Qy 61 MetGlnTyrGlyLeuPheHisGlyGluGlyValArgGlnCysGlyLeuGlyAlaArgPro 80 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 462 ATGCAGTACGGGCTTTTCCACGGAGAGGGTGTGAGGCAGTGTGGGTTGGGAGCAAGGCCC 521 Qy 81 PheArgPheSerPhePheProAspLeuLeuLysAlaIleProValSerIleHisValAsn 100 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 522 TTTCGGTTCTCATTTTTTCCAGATTTGCTCAAAGCAATCCCAGTGAGCATCCACGTCAAT 581 Qy 101 ValIleLeuPheSerAlaIleLeuIleValLeuThrMetValGlyThrAlaPhePheMet 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 582 GTCATTCTCTTCTCTGCCATCCTTATTGTGTTAACCATGGTGGGGACAGCCTTCTTCATG 641 Qy 121 TyrAsnAlaPheGlyLysProPheGluThrLeuHisGlyProLeuGlyLeuTyrLeuLeu 140 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 642 TACAATGCTTTTGGAAAACCTTTTGAAACTCTGCATGGTCCCCTAGGGCTGTACCTTTTG 701 Qy 141 SerPheIleSerGlySerCysGlyCysLeuValMetIleLeuPheAlaSerGluValLys 160 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 702 AGCTTCATTTCAGGCTCCTGTGGCTGTCTTGTCATGATATTGTTTGCCTCTGAAGTGAAA 761 Qy 161 IleHisHisLeuSerGluLysIleAlaAsnTyrLysGluGlyThrTyrValTyrLysThr 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 762 ATCCATCACCTCTCAGAAAAAATTGCAAATTATAAAGAAGGGACTTATGTCTACAAAACG 821 Qy 181 GlnSerGluLysTyrThrThrSerPheTrpValIlePhePheCysPhePheValHisPhe 200 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 822 CAAAGTGAAAAATATACCACCTCATTCTGGGTCATTTTCTTTTGCTTTTTTGTTCATTTT 881 Qy 201 LeuAsnGlyLeuLeuIleArgLeuAlaGlyPheGlnPheProPheAlaLysSerLysAsp 220 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 882 CTGAATGGGCTCCTAATACGACTTGCTGGATTTCAGTTCCCTTTTGCAAAATCTAAAGAC 941 Qy 221 AlaGluThrThrAsnValAlaAlaAspLeuMetTyr 232 |||||||||||||||||||||||||||||||||||| Db 942 GCAGAAACAACTAATGTAGCTGCAGATCTAATGTAC 977 That alignment shows that the composition of WO900 comprises SEQ ID NO 3 itself, a 5’UTR, and a 3’UTR. Those are elements (v), (vi), and (vii) of the instant claims. Powell teaches (§Polyadenylation Signal Sequences and Upstream Enhancer) one study, in human epithelial-like cells, found that a transgene had a 2.5-fold increase in expression with … bovine growth hormone polyA (bGHpA) signal sequences compared to a minimal synthetic polyA (SPA) signal. App178 teaches SEQ ID NO 30 which comprises a bovine growth hormone polyA signal and is 100% identical to instant SEQ ID NO 20, as shown by the following sequence alignment: RESULT 1 AXQ64086 (NOTE: this sequence has 272 duplicates in the database searched. See complete list at the end of this report) ID AXQ64086 standard; DNA; 225 BP. XX AC AXQ64086; XX DT 29-OCT-2009 (first entry) XX DE BGH polyA Yes1 supplementary expression cassette 3' UTR, SEQ:30 #2. XX KW 3'-utr; Yes1; dna cassette; gene expression; gene silencing; KW protein production; rna interference; ss. XX OS Bos taurus. OS Synthetic. XX CC PN US2009215178-A1. XX CC PD 27-AUG-2009. XX CC PF 22-FEB-2008; 2008US-00035437. XX PR 22-FEB-2008; 2008US-00035437. XX CC PA (TANG/) TANG Z. XX CC PI Tang Z; XX DR WPI; 2009-M96179/59. XX CC PT Generating cell clones with stable transgene (Gene of Interest (GOI)) CC PT expression comprises inactivation of endogenous essential genes of cell CC PT substrate and trans-complementation of essential genes products. XX CC PS Example 3; SEQ ID NO 30; 9pp; English. XX CC The present invention relates to a method for generating cell clones with CC stable transgene (Gene Of Interest (GOI)) expression. The method of the CC invention comprises: (i) inactivation of endogenous essential genes of CC cell substrate through Gene Inactivation Cassettes (GIC), (ii) trans- CC complementation of essential gene products through Gene Supplementary CC Cassettes (GSC), alternatively, the cassette codes for the gene product CC that is capable of inactivating GIC function, (iii) the GOI expression CC cassettes are preferably, physically linked to GSC to take advantage of CC favourable selective pressure, (iv) GIC could be preferably physically CC linked to GSC and GOI expression cassettes, where the endogenous CC essential genes of cell substrate refer to genes or combination of genes CC that are essential for cell survival and / or cell proliferation. The GIC CC comprises a vector comprising a promoter operably linked to RNA CC interference, RNAi (shRNA) / dsRNA / ribozyme molecule, or tandem repeats CC of such transcript units, targeted to cell endogenous essential mRNA. The CC invention provides strategies for increasing the productivity of CC recombinant protein expression in isogenic cell-lines, and a novel CC selection system for the improved stability and homogeneity of transgene CC expression in isogenic cells without dependence on continuous selective CC drugs. An example of the invention provides an essential gene knock-down CC cassette, targeted at 3' UTR of human endogenous Yes1 gene, and a CC supplementary Yes1 expression cassette which uses a 3' UTR from bovine CC growth hormone (BGH) polyA. The present sequence is a bovine growth CC hormone (BGH) polyA Yes1 supplementary expression cassette 3' UTR, used CC in an example of the invention. Note: This version of SEQ ID 30 is given CC in example 3, but it is not the same as the sequence referred to as SEQ CC ID 30 (seeAXQ61560) in the sequence listing. XX SQ Sequence 225 BP; 41 A; 53 C; 72 G; 59 T; 0 U; 0 Other; Query Match 100.0%; Score 225; Length 225; Best Local Similarity 100.0%; Matches 225; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 CTGTGCCTTCTAGTTGCCAGCCATCTGTTGTTTGCCCCTCCCCCGTGCCTTCCTTGACCC 60 SEQ ID NO 20 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 CTGTGCCTTCTAGTTGCCAGCCATCTGTTGTTTGCCCCTCCCCCGTGCCTTCCTTGACCC 60 Prior art SEQ Qy 61 TGGAAGGTGCCACTCCCACTGTCCTTTCCTAATAAAATGAGGAAATTGCATCGCATTGTC 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 TGGAAGGTGCCACTCCCACTGTCCTTTCCTAATAAAATGAGGAAATTGCATCGCATTGTC 120 Qy 121 TGAGTAGGTGTCATTCTATTCTGGGGGGTGGGGTGGGGCAGGACAGCAAGGGGGAGGATT 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 TGAGTAGGTGTCATTCTATTCTGGGGGGTGGGGTGGGGCAGGACAGCAAGGGGGAGGATT 180 Qy 181 GGGAAGACAATAGCAGGCATGCTGGGGATGCGGTGGGCTCTATGG 225 ||||||||||||||||||||||||||||||||||||||||||||| Db 181 GGGAAGACAATAGCAGGCATGCTGGGGATGCGGTGGGCTCTATGG 225 A poly-A sequence comprising SEQ ID NO 20 is component (viii) of the instant claims. It would have been obvious to an artisan before the effective filing date of the claimed invention to modify the invention of the US773 claims with the sequence encoding CLRN1 of WO900 and the teachings about a polyA sequence of Powell and App178 for the benefits of using the US773 vectors to treat Usher syndrome and to increase transgene expression. One would have been motivated to do so with a reasonable expectation of success because Powell teaches that a bovine growth hormone polyA signal can increase transgene expression. One would have been motivated to do so with a reasonable expectation of success because WO900 teaches (¶3-4) expressing CLRN1 had known usage in treating Usher syndrome, including (¶11) for both hearing and vision losses, and it would have been a simple matter to swap the sequence encoding CLRN1 of WO900 for the sequence encoding otoferlin of the US773 claims. An artisan would know that they need only use one AAV vector to encode CLRN1 because WO900 teaches (¶99, 108-111) the entire CLRN1 cDNA was placed on a single AAV vector, indicating the entire CLRN1 cDNA could fit on a single AAV vector. They would have been motivated to use a single vector because it is simpler to administer a single vector gene therapy than a dual vector gene therapy. US952 teaches (Col 11 L3-15) a kit that comprises nucleic acid compounds within a container of solution and that the kit can comprise a pre-loaded syringe comprising the compounds. An artisan would have put their compounds into a kit comprising a pre-loaded syringe for the benefit of ensuring that the recipient has the exact dosage ready to administer and because doing so would have prevented any complications that arise from mixing a solution and then getting the mixed solution into a syringe. Therefore the instant claims would have been obvious in view of the US773 claims, WO900, Powell, App178, and US952. Claims 229-232, 247-254, and 256-270 are rejected on the ground of nonstatutory double patenting as being unpatentable over claims 1-26 of the U.S. Patent No. 12305191 (“US191”) in view of WO900, Powell, App178, and US952. This rejection is maintained and updated in response to the claim amendments. All supporting references are of record. Although the claims at issue are not identical, they are directed to overlapping subject matter because the instant claims recite a composition comprising an AAV nucleic acid vector wherein the vector comprises a 5’ ITR, a CMV enhancer, a CBA promoter, a chimeric intron according to SEQ ID NO 16, a 5’UTR, a coding sequence (CDS) encoding a CLRN1 protein according to SEQ ID NO 3, a 3’UTR, a polyA signal, and a 3’ITR, wherein the CDS comprises a nt sequence spanning 2 consecutive exons of CLRN1 genomic DNA and lacks an intron sequence between them; wherein the composition can comprise other components such as SEQ ID NOs 17 or 20; to the composition comprising an excipient; to an AAV2 capsid comprising the composition, to an Anc80 capsid comprising the composition; to a kit comprising the composition; and to methods of introducing it to a cochlea of a mammal that can be a human who can have been previously identified as having a defective endogenous CLRN1 gene; to methods of increasing CLRN1 expression in the ear or eye; and to methods of treating hearing or vision loss. The US191 claims are drawn to a plurality of recombinant AAV vectors: a first vector comprising a 5’ITR, a 3’ITR, a CAG promoter comprising SEQ ID NO 61, and a second vector, wherein each of the vectors is encapsulated by an AAV capsid having a certain serotype, wherein the capsid can be an AAV2 capsid or an Anc80 capsid; to a composition comprising the vectors, wherein the composition can be formulated for intra-cochlear administration. Both claim sets are directed to AAV vectors for administering a gene therapy to the cochlea. An artisan would not know what is US191 SEQ ID NO 61 so they would consult the US191 Spec. and SEQ listing and find (Col 81 L30-35; Col 184 L10-20) SEQ ID NO 61 comprises a CAG promoter comprising: a CMV enhancer, chicken β-actin gene sequence, and a chimeric intron. US191 SEQ ID NO 61 comprises claimed SEQ ID NOs 16 and 17 as shown by the following alignments: US-18-777-787-61 Filing date in PALM: 2024-07-19 Sequence 61, US/18777787 Patent No. 12305191 GENERAL INFORMATION APPLICANT: AKOUOS, INC. (en) TITLE OF INVENTION: COMPOSITIONS AND METHODS FOR TREATING NON-AGE-ASSOCIATED HEARING IMPAIRMENT IN A HUMAN SUBJECT (en) FILE REFERENCE: 4833.0050004 CURRENT APPLICATION NUMBER: US/18/777,787 CURRENT FILING DATE: 2024-07-19 NUMBER OF SEQ ID NOS: 110 SEQ ID NO 61 LENGTH: 1671 TYPE: DNA FEATURE: NAME/KEY: source LOCATION: 1..1671 QUALIFIERS: mol_type = other DNA organism = synthetic construct ALIGNMENT: Query Match 100.0%; Score 1013; Length 1671; Best Local Similarity 100.0%; Matches 1013; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 GGAGTCGCTGCGTTGCCTTCGCCCCGTGCCCCGCTCCGCGCCGCCTCGCGCCGCCCGCCC 60 SEQ ID NO 16 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 659 GGAGTCGCTGCGTTGCCTTCGCCCCGTGCCCCGCTCCGCGCCGCCTCGCGCCGCCCGCCC 718 SEQ ID NO 61 Qy 61 CGGCTCTGACTGACCGCGTTACTCCCACAGGTGAGCGGGCGGGACGGCCCTTCTCCTCCG 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 719 CGGCTCTGACTGACCGCGTTACTCCCACAGGTGAGCGGGCGGGACGGCCCTTCTCCTCCG 778 Qy 121 GGCTGTAATTAGCGCTTGGTTTAATGACGGCTCGTTTCTTTTCTGTGGCTGCGTGAAAGC 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 779 GGCTGTAATTAGCGCTTGGTTTAATGACGGCTCGTTTCTTTTCTGTGGCTGCGTGAAAGC 838 Qy 181 CTTAAAGGGCTCCGGGAGGGCCCTTTGTGCGGGGGGGAGCGGCTCGGGGGGTGCGTGCGT 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 839 CTTAAAGGGCTCCGGGAGGGCCCTTTGTGCGGGGGGGAGCGGCTCGGGGGGTGCGTGCGT 898 Qy 241 GTGTGTGTGCGTGGGGAGCGCCGCGTGCGGCCCGCGCTGCCCGGCGGCTGTGAGCGCTGC 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 899 GTGTGTGTGCGTGGGGAGCGCCGCGTGCGGCCCGCGCTGCCCGGCGGCTGTGAGCGCTGC 958 Qy 301 GGGCGCGGCGCGGGGCTTTGTGCGCTCCGCGTGTGCGCGAGGGGAGCGCGGCCGGGGGCG 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 959 GGGCGCGGCGCGGGGCTTTGTGCGCTCCGCGTGTGCGCGAGGGGAGCGCGGCCGGGGGCG 1018 Qy 361 GTGCCCCGCGGTGCGGGGGGGCTGCGAGGGGAACAAAGGCTGCGTGCGGGGTGTGTGCGT 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1019 GTGCCCCGCGGTGCGGGGGGGCTGCGAGGGGAACAAAGGCTGCGTGCGGGGTGTGTGCGT 1078 Qy 421 GGGGGGGTGAGCAGGGGGTGTGGGCGCGGCGGTCGGGCTGTAACCCCCCCCTGCACCCCC 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1079 GGGGGGGTGAGCAGGGGGTGTGGGCGCGGCGGTCGGGCTGTAACCCCCCCCTGCACCCCC 1138 Qy 481 CTCCCCGAGTTGCTGAGCACGGCCCGGCTTCGGGTGCGGGGCTCCGTGCGGGGCGTGGCG 540 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1139 CTCCCCGAGTTGCTGAGCACGGCCCGGCTTCGGGTGCGGGGCTCCGTGCGGGGCGTGGCG 1198 Qy 541 CGGGGCTCGCCGTGCCGGGCGGGGGGTGGCGGCAGGTGGGGGTGCCGGGCGGGGCGGGGC 600 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1199 CGGGGCTCGCCGTGCCGGGCGGGGGGTGGCGGCAGGTGGGGGTGCCGGGCGGGGCGGGGC 1258 Qy 601 CGCCTCGGGCCGGGGAGGGCTCGGGGGAGGGGCGCGGCGGCCCCCGGAGCGCCGGCGGCT 660 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1259 CGCCTCGGGCCGGGGAGGGCTCGGGGGAGGGGCGCGGCGGCCCCCGGAGCGCCGGCGGCT 1318 Qy 661 GTCGAGGCGCGGCGAGCCGCAGCCATTGCCTTTTATGGTAATCGTGCGAGAGGGCGCAGG 720 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1319 GTCGAGGCGCGGCGAGCCGCAGCCATTGCCTTTTATGGTAATCGTGCGAGAGGGCGCAGG 1378 Qy 721 GACTTCCTTTGTCCCAAATCTGTGCGGAGCCGAAATCTGGGAGGCGCCGCCGCACCCCCT 780 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1379 GACTTCCTTTGTCCCAAATCTGTGCGGAGCCGAAATCTGGGAGGCGCCGCCGCACCCCCT 1438 Qy 781 CTAGCGGGCGCGGGGCGAAGCGGTGCGGCGCCGGCAGGAAGGAAATGGGCGGGGAGGGCC 840 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1439 CTAGCGGGCGCGGGGCGAAGCGGTGCGGCGCCGGCAGGAAGGAAATGGGCGGGGAGGGCC 1498 Qy 841 TTCGTGCGTCGCCGCGCCGCCGTCCCCTTCTCCCTCTCCAGCCTCGGGGCTGTCCGCGGG 900 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1499 TTCGTGCGTCGCCGCGCCGCCGTCCCCTTCTCCCTCTCCAGCCTCGGGGCTGTCCGCGGG 1558 Qy 901 GGGACGGCTGCCTTCGGGGGGGACGGGGCAGGGCGGGGTTCGGCTTCTGGCGTGTGACCG 960 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1559 GGGACGGCTGCCTTCGGGGGGGACGGGGCAGGGCGGGGTTCGGCTTCTGGCGTGTGACCG 1618 Qy 961 GCGGCTCTAGAGCCTCTGCTAACCATGTTCATGCCTTCTTCTTTTTCCTACAG 1013 ||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1619 GCGGCTCTAGAGCCTCTGCTAACCATGTTCATGCCTTCTTCTTTTTCCTACAG 1671 SEQ ID NO 17 Query Match 100.0%; Score 380; DB 1; Length 1671; Best Local Similarity 100.0%; Matches 380; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 GACATTGATTATTGACTAGTTATTAATAGTAATCAATTACGGGGTCATTAGTTCATAGCC 60 SEQ ID NO 17 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 GACATTGATTATTGACTAGTTATTAATAGTAATCAATTACGGGGTCATTAGTTCATAGCC 60 SEQ ID NO 61 Qy 61 CATATATGGAGTTCCGCGTTACATAACTTACGGTAAATGGCCCGCCTGGCTGACCGCCCA 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 CATATATGGAGTTCCGCGTTACATAACTTACGGTAAATGGCCCGCCTGGCTGACCGCCCA 120 Qy 121 ACGACCCCCGCCCATTGACGTCAATAATGACGTATGTTCCCATAGTAACGCCAATAGGGA 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 ACGACCCCCGCCCATTGACGTCAATAATGACGTATGTTCCCATAGTAACGCCAATAGGGA 180 Qy 181 CTTTCCATTGACGTCAATGGGTGGACTATTTACGGTAAACTGCCCACTTGGCAGTACATC 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 CTTTCCATTGACGTCAATGGGTGGACTATTTACGGTAAACTGCCCACTTGGCAGTACATC 240 Qy 241 AAGTGTATCATATGCCAAGTACGCCCCCTATTGACGTCAATGACGGTAAATGGCCCGCCT 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 AAGTGTATCATATGCCAAGTACGCCCCCTATTGACGTCAATGACGGTAAATGGCCCGCCT 300 Qy 301 GGCATTATGCCCAGTACATGACCTTATGGGACTTTCCTACTTGGCAGTACATCTACGTAT 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 GGCATTATGCCCAGTACATGACCTTATGGGACTTTCCTACTTGGCAGTACATCTACGTAT 360 Qy 361 TAGTCATCGCTATTACCATG 380 |||||||||||||||||||| Db 361 TAGTCATCGCTATTACCATG 380 Therefore the patented US191 claims recite elements (i), (ii), (iii), (iv), and (ix) of the claimed invention. Then the other prior art teaches the other claim elements that the US191 claims do not recite: WO900 teaches (¶99) an rAAV vector comprising the CLRN1 cDNA including the 5’ and 3’UTRs, and teaches driving it with the chicken β-actin promoter. WO900 teaches (¶9-10) the polynucleotide (polynt) can include a sequence having SEQ ID NO 2 (which it specifies comprises a 5’UTR and 3’UTR) and can be included on a vector that can be an adeno-associated viral vector (AAV) that can be used for transfecting ocular cells or cells of the inner ear. WO900 teaches (¶21) that the heterologous polynucleotide comprised in the AAV vector is flanked by at least one, and generally by two AAV inverted terminal repeat sequence (ITRs); an artisan would realize that being flanked by two ITRs refers to one ITR on either side, which is a 5’ITR and a 3’ITR. WO900 teaches (¶10-11) treating retinal cells. WO900 SEQ ID NO 2 comprises a polynt comprising a sequence encoding the amino acid sequence of instant SEQ ID NO 3 (which has been back-translated from AA[Wingdings font/0xE0]nucleotides). This is shown by the following sequence alignment: RESULT 7 BDA01054 ID BDA01054 standard; cDNA; 2352 BP. XX AC BDA01054; XX DT 16-JUN-2016 (first entry) XX DE Human derived clarin-1 (CLRN1) polynucleotide SEQ ID NO:2. XX KW CLRN1 gene; auditory; clarin-1; gene therapy; hearing loss; KW ophthalmological; ss; therapeutic; usher syndrome iii; vision disorder. XX OS Homo sapiens. XX CC PN WO2016073900-A1. XX CC PD 12-MAY-2016. XX CC PF 06-NOV-2015; 2015WO-US059546. XX PR 06-NOV-2014; 2014US-0076114P. PR 08-MAY-2015; 2015US-0158846P. XX CC PA (UCWR ) UNIV CASE WESTERN RESERVE. XX CC PI Alagramam KN; XX DR WPI; 2016-282935/37. XX CC PT New polynucleotide comprising a nucleic acid sequence that includes a CC PT cDNA coding sequence of a clarin-1 gene, useful for treating vision CC PT and/or hearing loss associated with Usher syndrome III. XX CC PS Claim 9; SEQ ID NO 2; 43pp; English. XX CC The invention relates to a novel polynucleotide, used for treating vision CC and/or hearing loss associated with Usher syndrome III. This CC polynucleotide comprises a nucleic acid sequence that includes a cDNA CC coding sequence of a clarin-1 (CLRN1) gene and a 3' untranslated region CC (UTR) nucleic acid that is derived from the 3' UTR of the clarin-1 gene, CC where the 3' UTR nucleic acid enhances expression of clarin-1 in a cell CC transfected with the polynucleotide compared to a cell transfected with a CC similar polynucleotide devoid of the 3' UTR nucleic acid. The invention CC further claims: a nucleic acid construct comprising a polynucleotide CC defined above; a vector for transfecting a cell, comprising a CC polynucleotide defined above, where the transfected cell expresses clarin CC -1; and a method of treating vision and/or hearing loss associated with CC Usher syndrome III in a subject by administering to the ocular cells CC and/or cells of the inner ear of the subject, a vector that promotes CC expression of clarin-1 in the cells. The present sequence is a clarin-1 CC polynucleotide, used for treating vision and/or hearing loss associated CC with Usher syndrome III in a subject. XX SQ Sequence 2352 BP; 705 A; 475 C; 484 G; 688 T; 0 U; 0 Other; Alignment Scores: Length: 2352 Score: 1214.00 Matches: 232 Percent Similarity: 100.0% Conservative: 0 Best Local Similarity: 100.0% Mismatches: 0 Query Match: 100.0% Indels: 0 Gaps: 0 US-17-253-658-3 (1-232) x BDA01054 (1-2352) Qy 1 MetProSerGlnGlnLysLysIleIlePheCysMetAlaGlyValPheSerPheAlaCys 20 SEQ ID NO 3 translated[Wingdings font/0xE0]NT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 282 ATGCCAAGCCAACAGAAGAAAATCATTTTTTGCATGGCCGGAGTGTTCAGTTTTGCATGT 341 WO900 SEQ ID NO 2 Qy 21 AlaLeuGlyValValThrAlaLeuGlyThrProLeuTrpIleLysAlaThrValLeuCys 40 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 342 GCCCTCGGAGTTGTGACAGCCTTGGGGACACCGTTGTGGATCAAAGCCACTGTCCTCTGC 401 Qy 41 LysThrGlyAlaLeuLeuValAsnAlaSerGlyGlnGluLeuAspLysPheMetGlyGlu 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 402 AAAACGGGAGCTCTGCTCGTCAATGCCTCAGGGCAGGAGCTGGACAAGTTTATGGGTGAA 461 Qy 61 MetGlnTyrGlyLeuPheHisGlyGluGlyValArgGlnCysGlyLeuGlyAlaArgPro 80 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 462 ATGCAGTACGGGCTTTTCCACGGAGAGGGTGTGAGGCAGTGTGGGTTGGGAGCAAGGCCC 521 Qy 81 PheArgPheSerPhePheProAspLeuLeuLysAlaIleProValSerIleHisValAsn 100 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 522 TTTCGGTTCTCATTTTTTCCAGATTTGCTCAAAGCAATCCCAGTGAGCATCCACGTCAAT 581 Qy 101 ValIleLeuPheSerAlaIleLeuIleValLeuThrMetValGlyThrAlaPhePheMet 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 582 GTCATTCTCTTCTCTGCCATCCTTATTGTGTTAACCATGGTGGGGACAGCCTTCTTCATG 641 Qy 121 TyrAsnAlaPheGlyLysProPheGluThrLeuHisGlyProLeuGlyLeuTyrLeuLeu 140 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 642 TACAATGCTTTTGGAAAACCTTTTGAAACTCTGCATGGTCCCCTAGGGCTGTACCTTTTG 701 Qy 141 SerPheIleSerGlySerCysGlyCysLeuValMetIleLeuPheAlaSerGluValLys 160 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 702 AGCTTCATTTCAGGCTCCTGTGGCTGTCTTGTCATGATATTGTTTGCCTCTGAAGTGAAA 761 Qy 161 IleHisHisLeuSerGluLysIleAlaAsnTyrLysGluGlyThrTyrValTyrLysThr 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 762 ATCCATCACCTCTCAGAAAAAATTGCAAATTATAAAGAAGGGACTTATGTCTACAAAACG 821 Qy 181 GlnSerGluLysTyrThrThrSerPheTrpValIlePhePheCysPhePheValHisPhe 200 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 822 CAAAGTGAAAAATATACCACCTCATTCTGGGTCATTTTCTTTTGCTTTTTTGTTCATTTT 881 Qy 201 LeuAsnGlyLeuLeuIleArgLeuAlaGlyPheGlnPheProPheAlaLysSerLysAsp 220 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 882 CTGAATGGGCTCCTAATACGACTTGCTGGATTTCAGTTCCCTTTTGCAAAATCTAAAGAC 941 Qy 221 AlaGluThrThrAsnValAlaAlaAspLeuMetTyr 232 |||||||||||||||||||||||||||||||||||| Db 942 GCAGAAACAACTAATGTAGCTGCAGATCTAATGTAC 977 That alignment shows that the composition of WO900 comprises SEQ ID NO 3 itself, a 5’UTR, and a 3’UTR. Those are elements (v), (vi), and (vii) of the instant claims. Powell teaches (§Polyadenylation Signal Sequences and Upstream Enhancer) one study, in human epithelial-like cells, found that a transgene had a 2.5-fold increase in expression with … bovine growth hormone polyA (bGHpA) signal sequences compared to a minimal synthetic polyA (SPA) signal. App178 teaches SEQ ID NO 30 which comprises a bovine growth hormone polyA signal and is 100% identical to instant SEQ ID NO 20, as shown by the following sequence alignment: RESULT 1 AXQ64086 (NOTE: this sequence has 272 duplicates in the database searched. See complete list at the end of this report) ID AXQ64086 standard; DNA; 225 BP. XX AC AXQ64086; XX DT 29-OCT-2009 (first entry) XX DE BGH polyA Yes1 supplementary expression cassette 3' UTR, SEQ:30 #2. XX KW 3'-utr; Yes1; dna cassette; gene expression; gene silencing; KW protein production; rna interference; ss. XX OS Bos taurus. OS Synthetic. XX CC PN US2009215178-A1. XX CC PD 27-AUG-2009. XX CC PF 22-FEB-2008; 2008US-00035437. XX PR 22-FEB-2008; 2008US-00035437. XX CC PA (TANG/) TANG Z. XX CC PI Tang Z; XX DR WPI; 2009-M96179/59. XX CC PT Generating cell clones with stable transgene (Gene of Interest (GOI)) CC PT expression comprises inactivation of endogenous essential genes of cell CC PT substrate and trans-complementation of essential genes products. XX CC PS Example 3; SEQ ID NO 30; 9pp; English. XX CC The present invention relates to a method for generating cell clones with CC stable transgene (Gene Of Interest (GOI)) expression. The method of the CC invention comprises: (i) inactivation of endogenous essential genes of CC cell substrate through Gene Inactivation Cassettes (GIC), (ii) trans- CC complementation of essential gene products through Gene Supplementary CC Cassettes (GSC), alternatively, the cassette codes for the gene product CC that is capable of inactivating GIC function, (iii) the GOI expression CC cassettes are preferably, physically linked to GSC to take advantage of CC favourable selective pressure, (iv) GIC could be preferably physically CC linked to GSC and GOI expression cassettes, where the endogenous CC essential genes of cell substrate refer to genes or combination of genes CC that are essential for cell survival and / or cell proliferation. The GIC CC comprises a vector comprising a promoter operably linked to RNA CC interference, RNAi (shRNA) / dsRNA / ribozyme molecule, or tandem repeats CC of such transcript units, targeted to cell endogenous essential mRNA. The CC invention provides strategies for increasing the productivity of CC recombinant protein expression in isogenic cell-lines, and a novel CC selection system for the improved stability and homogeneity of transgene CC expression in isogenic cells without dependence on continuous selective CC drugs. An example of the invention provides an essential gene knock-down CC cassette, targeted at 3' UTR of human endogenous Yes1 gene, and a CC supplementary Yes1 expression cassette which uses a 3' UTR from bovine CC growth hormone (BGH) polyA. The present sequence is a bovine growth CC hormone (BGH) polyA Yes1 supplementary expression cassette 3' UTR, used CC in an example of the invention. Note: This version of SEQ ID 30 is given CC in example 3, but it is not the same as the sequence referred to as SEQ CC ID 30 (seeAXQ61560) in the sequence listing. XX SQ Sequence 225 BP; 41 A; 53 C; 72 G; 59 T; 0 U; 0 Other; Query Match 100.0%; Score 225; Length 225; Best Local Similarity 100.0%; Matches 225; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 CTGTGCCTTCTAGTTGCCAGCCATCTGTTGTTTGCCCCTCCCCCGTGCCTTCCTTGACCC 60 SEQ ID NO 20 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 CTGTGCCTTCTAGTTGCCAGCCATCTGTTGTTTGCCCCTCCCCCGTGCCTTCCTTGACCC 60 Prior art SEQ Qy 61 TGGAAGGTGCCACTCCCACTGTCCTTTCCTAATAAAATGAGGAAATTGCATCGCATTGTC 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 TGGAAGGTGCCACTCCCACTGTCCTTTCCTAATAAAATGAGGAAATTGCATCGCATTGTC 120 Qy 121 TGAGTAGGTGTCATTCTATTCTGGGGGGTGGGGTGGGGCAGGACAGCAAGGGGGAGGATT 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 TGAGTAGGTGTCATTCTATTCTGGGGGGTGGGGTGGGGCAGGACAGCAAGGGGGAGGATT 180 Qy 181 GGGAAGACAATAGCAGGCATGCTGGGGATGCGGTGGGCTCTATGG 225 ||||||||||||||||||||||||||||||||||||||||||||| Db 181 GGGAAGACAATAGCAGGCATGCTGGGGATGCGGTGGGCTCTATGG 225 A poly-A sequence comprising SEQ ID NO 20 is component (viii) of the instant claims. It would have been obvious to an artisan before the effective filing date of the claimed invention to modify the invention of the US191 claims with the sequence encoding CLRN1 of WO900 and the teachings about a polyA sequence of Powell and App178 for the benefits of using the US191 vectors to treat Usher syndrome and to increase transgene expression. One would have been motivated to do so with a reasonable expectation of success because Powell teaches that a bovine growth hormone polyA signal can increase transgene expression. One would have been motivated to do so with a reasonable expectation of success because WO900 teaches (¶3-4) expressing CLRN1 had known usage in treating Usher syndrome, including (¶11) for both hearing and vision losses, and it would have been a simple matter to swap the sequence encoding CLRN1 of WO900 for the sequence encoding otoferlin of US191. An artisan would know that they need only use one AAV vector to encode CLRN1 because WO900 teaches (¶99, 108-111) the entire mCLRN1 cDNA was placed on a single AAV vector, indicating the entire CLRN1 cDNA could fit on a single AAV vector. They would have been motivated to use a single vector because it is simpler to administer a single vector gene therapy than a dual vector gene therapy. US952 teaches (Col 11 L3-15) a kit that comprises nucleic acid compounds within a container of solution and that the kit can comprise a pre-loaded syringe comprising the compounds. An artisan would have put their compounds into a kit comprising a pre-loaded syringe for the benefit of ensuring that the recipient has the exact dosage ready to administer and because doing so would have prevented any complications that arise from mixing a solution and then getting the mixed solution into a syringe. Therefore the instant claims would have been obvious in view of the US191 claims, WO900, Powell, App178, and US952. Claims 229-232, 247-254, and 256-270 are provisionally rejected on the ground of nonstatutory double patenting as being unpatentable over claims 1, 39, 44, 55, 58-63, 65, 69, 71, 74, 77, 87-101 of copending Application No. 17628266 (reference application; “App266”) in view of Powell, WO900, App178, and US952. This rejection is maintained and updated in response to the claim amendments. All supporting references are of record. Although the claims at issue are not identical, they are not patentably distinct from each other because both claim sets are directed to methods and compositions of gene therapies for expressing a gene of interest in the inner ear to treat hearing loss. The instant claims recite a composition comprising an AAV nucleic acid vector wherein the vector comprises a 5’ ITR, a CMV enhancer, a CBA promoter, a chimeric intron, a 5’UTR, a coding sequence (CDS) encoding a CLRN1 protein according to SEQ ID NO 3, a 3’UTR, a polyA signal, and a 3’ITR, wherein the CDS comprises a nt sequence spanning 2 consecutive exons of CLRN1 genomic DNA and lacks an intron sequence between them; wherein the composition can comprise other components such as SEQ ID NOs 16-17 or 20; to the composition comprising an excipient; to an AAV2 capsid comprising the composition, to an Anc80 capsid comprising the composition; to a kit comprising the composition; and to methods of introducing it to a cochlea of a mammal that can be a human who can have been previously identified as having a defective endogenous CLRN1 gene; to methods of increasing CLRN1 expression in the ear or eye; and to methods of treating hearing or vision loss. The App266 claims are very broad and recite a construct comprising a promoter that can be a chicken β-actin promoter, a chimeric intron comprising SEQ ID NO 19 (i.e., claimed SEQ ID NO 16), a CVM enhancer comprising SEQ ID NO 17, a 5’UTR and a 3’UTR, two AAV ITRs flanking the coding sequence, and methods of using the construct to treat hearing loss. App266 claim 1 recites that the coding sequence can encode any secreted protein. App266 claims recite an AAV2 capsid or Anc80 capsid comprising the construct. Both claim sets are directed to constructs for gene expression in the ear, wherein the constructs comprise the same elements including a chimeric intron comprising SEQ ID NO 16 and a CVM enhancer comprising SEQ ID NO 17. App266 SEQ ID NO 17 is identical to claimed SEQ ID NO 17: US-17-628-266-17 Query Match 100.0%; Score 380; DB 1; Length 381; Best Local Similarity 100.0%; Matches 380; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 GACATTGATTATTGACTAGTTATTAATAGTAATCAATTACGGGGTCATTAGTTCATAGCC 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 GACATTGATTATTGACTAGTTATTAATAGTAATCAATTACGGGGTCATTAGTTCATAGCC 60 Qy 61 CATATATGGAGTTCCGCGTTACATAACTTACGGTAAATGGCCCGCCTGGCTGACCGCCCA 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 CATATATGGAGTTCCGCGTTACATAACTTACGGTAAATGGCCCGCCTGGCTGACCGCCCA 120 Qy 121 ACGACCCCCGCCCATTGACGTCAATAATGACGTATGTTCCCATAGTAACGCCAATAGGGA 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 ACGACCCCCGCCCATTGACGTCAATAATGACGTATGTTCCCATAGTAACGCCAATAGGGA 180 Qy 181 CTTTCCATTGACGTCAATGGGTGGACTATTTACGGTAAACTGCCCACTTGGCAGTACATC 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 CTTTCCATTGACGTCAATGGGTGGACTATTTACGGTAAACTGCCCACTTGGCAGTACATC 240 Qy 241 AAGTGTATCATATGCCAAGTACGCCCCCTATTGACGTCAATGACGGTAAATGGCCCGCCT 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 AAGTGTATCATATGCCAAGTACGCCCCCTATTGACGTCAATGACGGTAAATGGCCCGCCT 300 Qy 301 GGCATTATGCCCAGTACATGACCTTATGGGACTTTCCTACTTGGCAGTACATCTACGTAT 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 GGCATTATGCCCAGTACATGACCTTATGGGACTTTCCTACTTGGCAGTACATCTACGTAT 360 Qy 361 TAGTCATCGCTATTACCATG 380 |||||||||||||||||||| Db 361 TAGTCATCGCTATTACCATG 380 App266 SEQ ID NO 19 is identical to claimed SEQ ID NO 16: RESULT 1 US-17-628-266-19 Query Match 100.0%; Score 1013; DB 1; Length 1040; Best Local Similarity 100.0%; Matches 1013; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 GGAGTCGCTGCGTTGCCTTCGCCCCGTGCCCCGCTCCGCGCCGCCTCGCGCCGCCCGCCC 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 GGAGTCGCTGCGTTGCCTTCGCCCCGTGCCCCGCTCCGCGCCGCCTCGCGCCGCCCGCCC 60 Qy 61 CGGCTCTGACTGACCGCGTTACTCCCACAGGTGAGCGGGCGGGACGGCCCTTCTCCTCCG 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 CGGCTCTGACTGACCGCGTTACTCCCACAGGTGAGCGGGCGGGACGGCCCTTCTCCTCCG 120 Qy 121 GGCTGTAATTAGCGCTTGGTTTAATGACGGCTCGTTTCTTTTCTGTGGCTGCGTGAAAGC 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 GGCTGTAATTAGCGCTTGGTTTAATGACGGCTCGTTTCTTTTCTGTGGCTGCGTGAAAGC 180 Qy 181 CTTAAAGGGCTCCGGGAGGGCCCTTTGTGCGGGGGGGAGCGGCTCGGGGGGTGCGTGCGT 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 CTTAAAGGGCTCCGGGAGGGCCCTTTGTGCGGGGGGGAGCGGCTCGGGGGGTGCGTGCGT 240 Qy 241 GTGTGTGTGCGTGGGGAGCGCCGCGTGCGGCCCGCGCTGCCCGGCGGCTGTGAGCGCTGC 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 GTGTGTGTGCGTGGGGAGCGCCGCGTGCGGCCCGCGCTGCCCGGCGGCTGTGAGCGCTGC 300 Qy 301 GGGCGCGGCGCGGGGCTTTGTGCGCTCCGCGTGTGCGCGAGGGGAGCGCGGCCGGGGGCG 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 GGGCGCGGCGCGGGGCTTTGTGCGCTCCGCGTGTGCGCGAGGGGAGCGCGGCCGGGGGCG 360 Qy 361 GTGCCCCGCGGTGCGGGGGGGCTGCGAGGGGAACAAAGGCTGCGTGCGGGGTGTGTGCGT 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 GTGCCCCGCGGTGCGGGGGGGCTGCGAGGGGAACAAAGGCTGCGTGCGGGGTGTGTGCGT 420 Qy 421 GGGGGGGTGAGCAGGGGGTGTGGGCGCGGCGGTCGGGCTGTAACCCCCCCCTGCACCCCC 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 421 GGGGGGGTGAGCAGGGGGTGTGGGCGCGGCGGTCGGGCTGTAACCCCCCCCTGCACCCCC 480 Qy 481 CTCCCCGAGTTGCTGAGCACGGCCCGGCTTCGGGTGCGGGGCTCCGTGCGGGGCGTGGCG 540 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 481 CTCCCCGAGTTGCTGAGCACGGCCCGGCTTCGGGTGCGGGGCTCCGTGCGGGGCGTGGCG 540 Qy 541 CGGGGCTCGCCGTGCCGGGCGGGGGGTGGCGGCAGGTGGGGGTGCCGGGCGGGGCGGGGC 600 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 541 CGGGGCTCGCCGTGCCGGGCGGGGGGTGGCGGCAGGTGGGGGTGCCGGGCGGGGCGGGGC 600 Qy 601 CGCCTCGGGCCGGGGAGGGCTCGGGGGAGGGGCGCGGCGGCCCCCGGAGCGCCGGCGGCT 660 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 601 CGCCTCGGGCCGGGGAGGGCTCGGGGGAGGGGCGCGGCGGCCCCCGGAGCGCCGGCGGCT 660 Qy 661 GTCGAGGCGCGGCGAGCCGCAGCCATTGCCTTTTATGGTAATCGTGCGAGAGGGCGCAGG 720 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 661 GTCGAGGCGCGGCGAGCCGCAGCCATTGCCTTTTATGGTAATCGTGCGAGAGGGCGCAGG 720 Qy 721 GACTTCCTTTGTCCCAAATCTGTGCGGAGCCGAAATCTGGGAGGCGCCGCCGCACCCCCT 780 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 721 GACTTCCTTTGTCCCAAATCTGTGCGGAGCCGAAATCTGGGAGGCGCCGCCGCACCCCCT 780 Qy 781 CTAGCGGGCGCGGGGCGAAGCGGTGCGGCGCCGGCAGGAAGGAAATGGGCGGGGAGGGCC 840 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 781 CTAGCGGGCGCGGGGCGAAGCGGTGCGGCGCCGGCAGGAAGGAAATGGGCGGGGAGGGCC 840 Qy 841 TTCGTGCGTCGCCGCGCCGCCGTCCCCTTCTCCCTCTCCAGCCTCGGGGCTGTCCGCGGG 900 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 841 TTCGTGCGTCGCCGCGCCGCCGTCCCCTTCTCCCTCTCCAGCCTCGGGGCTGTCCGCGGG 900 Qy 901 GGGACGGCTGCCTTCGGGGGGGACGGGGCAGGGCGGGGTTCGGCTTCTGGCGTGTGACCG 960 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 901 GGGACGGCTGCCTTCGGGGGGGACGGGGCAGGGCGGGGTTCGGCTTCTGGCGTGTGACCG 960 Qy 961 GCGGCTCTAGAGCCTCTGCTAACCATGTTCATGCCTTCTTCTTTTTCCTACAG 1013 ||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 961 GCGGCTCTAGAGCCTCTGCTAACCATGTTCATGCCTTCTTCTTTTTCCTACAG 1013 Therefore the App266 claims recite elements (i), (ii), (iii), (iv), (v), (vii) and (ix) of the claimed invention. Then the other prior art teaches the other claim elements that the App266 claims do not recite: The App266 claims recite the construct encodes a different protein than CLRN1, but WO900 (¶99) teaches an rAAV vector comprising the CLRN1 cDNA. WO900 teaches (¶9-10) the polynucleotide (polynt) can include a sequence having SEQ ID NO 2 (which it specifies comprises a 5’UTR and 3’UTR) and can be included on a vector that can be an adeno-associated viral vector (AAV) that can be used for transfecting ocular cells or cells of the inner ear. WO900 SEQ ID NO 2 comprises a polynt comprising a sequence encoding the amino acid sequence of instant SEQ ID NO 3 (which has been back-translated from AA[Wingdings font/0xE0]nucleotides). This is shown by the following sequence alignment: RESULT 7 BDA01054 ID BDA01054 standard; cDNA; 2352 BP. XX AC BDA01054; XX DT 16-JUN-2016 (first entry) XX DE Human derived clarin-1 (CLRN1) polynucleotide SEQ ID NO:2. XX KW CLRN1 gene; auditory; clarin-1; gene therapy; hearing loss; KW ophthalmological; ss; therapeutic; usher syndrome iii; vision disorder. XX OS Homo sapiens. XX CC PN WO2016073900-A1. XX CC PD 12-MAY-2016. XX CC PF 06-NOV-2015; 2015WO-US059546. XX PR 06-NOV-2014; 2014US-0076114P. PR 08-MAY-2015; 2015US-0158846P. XX CC PA (UCWR ) UNIV CASE WESTERN RESERVE. XX CC PI Alagramam KN; XX DR WPI; 2016-282935/37. XX CC PT New polynucleotide comprising a nucleic acid sequence that includes a CC PT cDNA coding sequence of a clarin-1 gene, useful for treating vision CC PT and/or hearing loss associated with Usher syndrome III. XX CC PS Claim 9; SEQ ID NO 2; 43pp; English. XX CC The invention relates to a novel polynucleotide, used for treating vision CC and/or hearing loss associated with Usher syndrome III. This CC polynucleotide comprises a nucleic acid sequence that includes a cDNA CC coding sequence of a clarin-1 (CLRN1) gene and a 3' untranslated region CC (UTR) nucleic acid that is derived from the 3' UTR of the clarin-1 gene, CC where the 3' UTR nucleic acid enhances expression of clarin-1 in a cell CC transfected with the polynucleotide compared to a cell transfected with a CC similar polynucleotide devoid of the 3' UTR nucleic acid. The invention CC further claims: a nucleic acid construct comprising a polynucleotide CC defined above; a vector for transfecting a cell, comprising a CC polynucleotide defined above, where the transfected cell expresses clarin CC -1; and a method of treating vision and/or hearing loss associated with CC Usher syndrome III in a subject by administering to the ocular cells CC and/or cells of the inner ear of the subject, a vector that promotes CC expression of clarin-1 in the cells. The present sequence is a clarin-1 CC polynucleotide, used for treating vision and/or hearing loss associated CC with Usher syndrome III in a subject. XX SQ Sequence 2352 BP; 705 A; 475 C; 484 G; 688 T; 0 U; 0 Other; Alignment Scores: Length: 2352 Score: 1214.00 Matches: 232 Percent Similarity: 100.0% Conservative: 0 Best Local Similarity: 100.0% Mismatches: 0 Query Match: 100.0% Indels: 0 Gaps: 0 US-17-253-658-3 (1-232) x BDA01054 (1-2352) Qy 1 MetProSerGlnGlnLysLysIleIlePheCysMetAlaGlyValPheSerPheAlaCys 20 SEQ ID NO 3 translated[Wingdings font/0xE0]NT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 282 ATGCCAAGCCAACAGAAGAAAATCATTTTTTGCATGGCCGGAGTGTTCAGTTTTGCATGT 341 WO900 SEQ ID NO 2 Qy 21 AlaLeuGlyValValThrAlaLeuGlyThrProLeuTrpIleLysAlaThrValLeuCys 40 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 342 GCCCTCGGAGTTGTGACAGCCTTGGGGACACCGTTGTGGATCAAAGCCACTGTCCTCTGC 401 Qy 41 LysThrGlyAlaLeuLeuValAsnAlaSerGlyGlnGluLeuAspLysPheMetGlyGlu 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 402 AAAACGGGAGCTCTGCTCGTCAATGCCTCAGGGCAGGAGCTGGACAAGTTTATGGGTGAA 461 Qy 61 MetGlnTyrGlyLeuPheHisGlyGluGlyValArgGlnCysGlyLeuGlyAlaArgPro 80 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 462 ATGCAGTACGGGCTTTTCCACGGAGAGGGTGTGAGGCAGTGTGGGTTGGGAGCAAGGCCC 521 Qy 81 PheArgPheSerPhePheProAspLeuLeuLysAlaIleProValSerIleHisValAsn 100 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 522 TTTCGGTTCTCATTTTTTCCAGATTTGCTCAAAGCAATCCCAGTGAGCATCCACGTCAAT 581 Qy 101 ValIleLeuPheSerAlaIleLeuIleValLeuThrMetValGlyThrAlaPhePheMet 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 582 GTCATTCTCTTCTCTGCCATCCTTATTGTGTTAACCATGGTGGGGACAGCCTTCTTCATG 641 Qy 121 TyrAsnAlaPheGlyLysProPheGluThrLeuHisGlyProLeuGlyLeuTyrLeuLeu 140 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 642 TACAATGCTTTTGGAAAACCTTTTGAAACTCTGCATGGTCCCCTAGGGCTGTACCTTTTG 701 Qy 141 SerPheIleSerGlySerCysGlyCysLeuValMetIleLeuPheAlaSerGluValLys 160 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 702 AGCTTCATTTCAGGCTCCTGTGGCTGTCTTGTCATGATATTGTTTGCCTCTGAAGTGAAA 761 Qy 161 IleHisHisLeuSerGluLysIleAlaAsnTyrLysGluGlyThrTyrValTyrLysThr 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 762 ATCCATCACCTCTCAGAAAAAATTGCAAATTATAAAGAAGGGACTTATGTCTACAAAACG 821 Qy 181 GlnSerGluLysTyrThrThrSerPheTrpValIlePhePheCysPhePheValHisPhe 200 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 822 CAAAGTGAAAAATATACCACCTCATTCTGGGTCATTTTCTTTTGCTTTTTTGTTCATTTT 881 Qy 201 LeuAsnGlyLeuLeuIleArgLeuAlaGlyPheGlnPheProPheAlaLysSerLysAsp 220 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 882 CTGAATGGGCTCCTAATACGACTTGCTGGATTTCAGTTCCCTTTTGCAAAATCTAAAGAC 941 Qy 221 AlaGluThrThrAsnValAlaAlaAspLeuMetTyr 232 |||||||||||||||||||||||||||||||||||| Db 942 GCAGAAACAACTAATGTAGCTGCAGATCTAATGTAC 977 That alignment shows that the composition of WO900 comprises element (vi) of the instant claims. WO900 teaches (¶10-11) treating retinal cells. Powell teaches (§Polyadenylation Signal Sequences and Upstream Enhancer) one study, in human epithelial-like cells, found that a transgene had a 2.5-fold increase in expression with … bovine growth hormone polyA (bGHpA) signal sequences compared to a minimal synthetic polyA (SPA) signal. App178 teaches SEQ ID NO 30 which comprises a bovine growth hormone polyA signal and is 100% identical to instant SEQ ID NO 20, as shown by the following sequence alignment: RESULT 1 AXQ64086 (NOTE: this sequence has 272 duplicates in the database searched. See complete list at the end of this report) ID AXQ64086 standard; DNA; 225 BP. XX AC AXQ64086; XX DT 29-OCT-2009 (first entry) XX DE BGH polyA Yes1 supplementary expression cassette 3' UTR, SEQ:30 #2. XX KW 3'-utr; Yes1; dna cassette; gene expression; gene silencing; KW protein production; rna interference; ss. XX OS Bos taurus. OS Synthetic. XX CC PN US2009215178-A1. XX CC PD 27-AUG-2009. XX CC PF 22-FEB-2008; 2008US-00035437. XX PR 22-FEB-2008; 2008US-00035437. XX CC PA (TANG/) TANG Z. XX CC PI Tang Z; XX DR WPI; 2009-M96179/59. XX CC PT Generating cell clones with stable transgene (Gene of Interest (GOI)) CC PT expression comprises inactivation of endogenous essential genes of cell CC PT substrate and trans-complementation of essential genes products. XX CC PS Example 3; SEQ ID NO 30; 9pp; English. XX CC The present invention relates to a method for generating cell clones with CC stable transgene (Gene Of Interest (GOI)) expression. The method of the CC invention comprises: (i) inactivation of endogenous essential genes of CC cell substrate through Gene Inactivation Cassettes (GIC), (ii) trans- CC complementation of essential gene products through Gene Supplementary CC Cassettes (GSC), alternatively, the cassette codes for the gene product CC that is capable of inactivating GIC function, (iii) the GOI expression CC cassettes are preferably, physically linked to GSC to take advantage of CC favourable selective pressure, (iv) GIC could be preferably physically CC linked to GSC and GOI expression cassettes, where the endogenous CC essential genes of cell substrate refer to genes or combination of genes CC that are essential for cell survival and / or cell proliferation. The GIC CC comprises a vector comprising a promoter operably linked to RNA CC interference, RNAi (shRNA) / dsRNA / ribozyme molecule, or tandem repeats CC of such transcript units, targeted to cell endogenous essential mRNA. The CC invention provides strategies for increasing the productivity of CC recombinant protein expression in isogenic cell-lines, and a novel CC selection system for the improved stability and homogeneity of transgene CC expression in isogenic cells without dependence on continuous selective CC drugs. An example of the invention provides an essential gene knock-down CC cassette, targeted at 3' UTR of human endogenous Yes1 gene, and a CC supplementary Yes1 expression cassette which uses a 3' UTR from bovine CC growth hormone (BGH) polyA. The present sequence is a bovine growth CC hormone (BGH) polyA Yes1 supplementary expression cassette 3' UTR, used CC in an example of the invention. Note: This version of SEQ ID 30 is given CC in example 3, but it is not the same as the sequence referred to as SEQ CC ID 30 (seeAXQ61560) in the sequence listing. XX SQ Sequence 225 BP; 41 A; 53 C; 72 G; 59 T; 0 U; 0 Other; Query Match 100.0%; Score 225; Length 225; Best Local Similarity 100.0%; Matches 225; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 CTGTGCCTTCTAGTTGCCAGCCATCTGTTGTTTGCCCCTCCCCCGTGCCTTCCTTGACCC 60 SEQ ID NO 20 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 CTGTGCCTTCTAGTTGCCAGCCATCTGTTGTTTGCCCCTCCCCCGTGCCTTCCTTGACCC 60 Prior art SEQ Qy 61 TGGAAGGTGCCACTCCCACTGTCCTTTCCTAATAAAATGAGGAAATTGCATCGCATTGTC 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 TGGAAGGTGCCACTCCCACTGTCCTTTCCTAATAAAATGAGGAAATTGCATCGCATTGTC 120 Qy 121 TGAGTAGGTGTCATTCTATTCTGGGGGGTGGGGTGGGGCAGGACAGCAAGGGGGAGGATT 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 TGAGTAGGTGTCATTCTATTCTGGGGGGTGGGGTGGGGCAGGACAGCAAGGGGGAGGATT 180 Qy 181 GGGAAGACAATAGCAGGCATGCTGGGGATGCGGTGGGCTCTATGG 225 ||||||||||||||||||||||||||||||||||||||||||||| Db 181 GGGAAGACAATAGCAGGCATGCTGGGGATGCGGTGGGCTCTATGG 225 The App266 claims do not recite a kit that comprises a pre-loaded syringe. However, US952 teaches (Col 11 L3-15) a kit that comprises nucleic acid compounds within a container of solution and that the kit can comprise a pre-loaded syringe comprising the compounds. An artisan would have put their compounds into a kit comprising a pre-loaded syringe for the benefit of ensuring that the recipient has the exact dosage ready to administer and because doing so would have prevented any complications that arise from mixing a solution and then getting the mixed solution into a syringe. Therefore it would have been obvious to use WO900’s SEQ ID NO 2 with the expression construct of App266 in order to express CLRN1. An artisan would have known that using WO900’s sequence and teachings with the invention recited in the App266 claims and modified by the teachings of Powell, App178, and US952 would have provided a benefit of treating hearing or vision loss because WO900 teaches that (¶11). Using the bovine growth hormone polyA signal of App178 would have been of benefit based on the teachings of Powell. Packaging it into a pre-loaded syringe would also have been of benefit as taught by US952. There is no reason why the invention of the App266 claims are exclusively for expression of secreted proteins. Using WO900’s sequence and teachings with the invention recited in the App266 claims and modified by the teachings of Powell, App178, and US952 would have produced the instant invention. This is a provisional nonstatutory double patenting rejection. Claims 229-232, 247-254, and 256-270 are rejected on the ground of nonstatutory double patenting as being unpatentable over claims 1, 63, and 66-68 of Application No. 18134095 (reference application; “App095”) in view of WO900 and US952. The App095 claims have now issued as US Pat. No. 12365726. This rejection is maintained and updated in response to the claim amendments. All supporting references are of record. Although the claims at issue are not identical, they are not patentably distinct from each other because both claim sets are directed to methods and compositions of gene therapies for expressing a gene of interest in the inner ear to treat hearing loss. The instant claims recite a composition comprising an AAV nucleic acid vector wherein the vector comprises a 5’ ITR, a CMV enhancer, a CBA promoter, a chimeric intron, a 5’UTR, a coding sequence (CDS) encoding a CLRN1 protein according to SEQ ID NO 3, a 3’UTR, a polyA signal, and a 3’ITR, wherein the CDS comprises a nt sequence spanning 2 consecutive exons of CLRN1 genomic DNA and lacks an intron sequence between them; wherein the composition can comprise other components such as SEQ ID NOs 16-17 or 20; to the composition comprising an excipient; to an AAV2 capsid comprising the composition, to an Anc80 capsid comprising the composition; to a kit comprising the composition; and to methods of introducing it to a cochlea of a mammal that can be a human who can have been previously identified as having a defective endogenous CLRN1 gene; to methods of increasing CLRN1 expression in the ear or eye; and to methods of treating hearing or vision loss. The App095 claims recite an AAV particle comprising a nucleic acid construct according to SEQ ID NO 91 or 92 and an AAV capsid, wherein the capsid can be an AAV2 capsid or an Anc80 capsid; and a kit and composition comprising the particle. An artisan would not know what are SEQ ID NO 91 or 92 but they would consult the Spec. (¶29, ) and SEQ listing and find that those SEQ ID NOs comprise a 5’ITR, a CMV enhancer comprising claimed SEQ ID NO 17, a CBA promoter, a chimeric intron according claimed SEQ ID NO 16, a coding sequence, and a 3’ITR. Both claim sets are directed to AAV constructs for gene expression, wherein the constructs comprise the same elements including a chimeric intron comprising SEQ ID NO 16 and a CVM enhancer comprising SEQ ID NO 17 and a polyA sequence comprising SEQ ID NO 20. App095 SEQ ID NOs 91 and 92 comprise regions identical to claimed SEQ ID NOs 17, 16, and 20: RESULT 1 US-18-134-095-91 Query Match 100.0%; Score 380; DB 1; Length 3847; Best Local Similarity 100.0%; Matches 380; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 GACATTGATTATTGACTAGTTATTAATAGTAATCAATTACGGGGTCATTAGTTCATAGCC 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 168 GACATTGATTATTGACTAGTTATTAATAGTAATCAATTACGGGGTCATTAGTTCATAGCC 227 Qy 61 CATATATGGAGTTCCGCGTTACATAACTTACGGTAAATGGCCCGCCTGGCTGACCGCCCA 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 228 CATATATGGAGTTCCGCGTTACATAACTTACGGTAAATGGCCCGCCTGGCTGACCGCCCA 287 Qy 121 ACGACCCCCGCCCATTGACGTCAATAATGACGTATGTTCCCATAGTAACGCCAATAGGGA 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 288 ACGACCCCCGCCCATTGACGTCAATAATGACGTATGTTCCCATAGTAACGCCAATAGGGA 347 Qy 181 CTTTCCATTGACGTCAATGGGTGGACTATTTACGGTAAACTGCCCACTTGGCAGTACATC 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 348 CTTTCCATTGACGTCAATGGGTGGACTATTTACGGTAAACTGCCCACTTGGCAGTACATC 407 Qy 241 AAGTGTATCATATGCCAAGTACGCCCCCTATTGACGTCAATGACGGTAAATGGCCCGCCT 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 408 AAGTGTATCATATGCCAAGTACGCCCCCTATTGACGTCAATGACGGTAAATGGCCCGCCT 467 Qy 301 GGCATTATGCCCAGTACATGACCTTATGGGACTTTCCTACTTGGCAGTACATCTACGTAT 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 468 GGCATTATGCCCAGTACATGACCTTATGGGACTTTCCTACTTGGCAGTACATCTACGTAT 527 Qy 361 TAGTCATCGCTATTACCATG 380 |||||||||||||||||||| Db 528 TAGTCATCGCTATTACCATG 547 SEQ ID NO 16: RESULT 1 US-18-134-095-91 Query Match 100.0%; Score 1013; DB 1; Length 3847; Best Local Similarity 100.0%; Matches 1013; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 GGAGTCGCTGCGTTGCCTTCGCCCCGTGCCCCGCTCCGCGCCGCCTCGCGCCGCCCGCCC 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 828 GGAGTCGCTGCGTTGCCTTCGCCCCGTGCCCCGCTCCGCGCCGCCTCGCGCCGCCCGCCC 887 Qy 61 CGGCTCTGACTGACCGCGTTACTCCCACAGGTGAGCGGGCGGGACGGCCCTTCTCCTCCG 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 888 CGGCTCTGACTGACCGCGTTACTCCCACAGGTGAGCGGGCGGGACGGCCCTTCTCCTCCG 947 Qy 121 GGCTGTAATTAGCGCTTGGTTTAATGACGGCTCGTTTCTTTTCTGTGGCTGCGTGAAAGC 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 948 GGCTGTAATTAGCGCTTGGTTTAATGACGGCTCGTTTCTTTTCTGTGGCTGCGTGAAAGC 1007 Qy 181 CTTAAAGGGCTCCGGGAGGGCCCTTTGTGCGGGGGGGAGCGGCTCGGGGGGTGCGTGCGT 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1008 CTTAAAGGGCTCCGGGAGGGCCCTTTGTGCGGGGGGGAGCGGCTCGGGGGGTGCGTGCGT 1067 Qy 241 GTGTGTGTGCGTGGGGAGCGCCGCGTGCGGCCCGCGCTGCCCGGCGGCTGTGAGCGCTGC 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1068 GTGTGTGTGCGTGGGGAGCGCCGCGTGCGGCCCGCGCTGCCCGGCGGCTGTGAGCGCTGC 1127 Qy 301 GGGCGCGGCGCGGGGCTTTGTGCGCTCCGCGTGTGCGCGAGGGGAGCGCGGCCGGGGGCG 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1128 GGGCGCGGCGCGGGGCTTTGTGCGCTCCGCGTGTGCGCGAGGGGAGCGCGGCCGGGGGCG 1187 Qy 361 GTGCCCCGCGGTGCGGGGGGGCTGCGAGGGGAACAAAGGCTGCGTGCGGGGTGTGTGCGT 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1188 GTGCCCCGCGGTGCGGGGGGGCTGCGAGGGGAACAAAGGCTGCGTGCGGGGTGTGTGCGT 1247 Qy 421 GGGGGGGTGAGCAGGGGGTGTGGGCGCGGCGGTCGGGCTGTAACCCCCCCCTGCACCCCC 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1248 GGGGGGGTGAGCAGGGGGTGTGGGCGCGGCGGTCGGGCTGTAACCCCCCCCTGCACCCCC 1307 Qy 481 CTCCCCGAGTTGCTGAGCACGGCCCGGCTTCGGGTGCGGGGCTCCGTGCGGGGCGTGGCG 540 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1308 CTCCCCGAGTTGCTGAGCACGGCCCGGCTTCGGGTGCGGGGCTCCGTGCGGGGCGTGGCG 1367 Qy 541 CGGGGCTCGCCGTGCCGGGCGGGGGGTGGCGGCAGGTGGGGGTGCCGGGCGGGGCGGGGC 600 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1368 CGGGGCTCGCCGTGCCGGGCGGGGGGTGGCGGCAGGTGGGGGTGCCGGGCGGGGCGGGGC 1427 Qy 601 CGCCTCGGGCCGGGGAGGGCTCGGGGGAGGGGCGCGGCGGCCCCCGGAGCGCCGGCGGCT 660 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1428 CGCCTCGGGCCGGGGAGGGCTCGGGGGAGGGGCGCGGCGGCCCCCGGAGCGCCGGCGGCT 1487 Qy 661 GTCGAGGCGCGGCGAGCCGCAGCCATTGCCTTTTATGGTAATCGTGCGAGAGGGCGCAGG 720 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1488 GTCGAGGCGCGGCGAGCCGCAGCCATTGCCTTTTATGGTAATCGTGCGAGAGGGCGCAGG 1547 Qy 721 GACTTCCTTTGTCCCAAATCTGTGCGGAGCCGAAATCTGGGAGGCGCCGCCGCACCCCCT 780 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1548 GACTTCCTTTGTCCCAAATCTGTGCGGAGCCGAAATCTGGGAGGCGCCGCCGCACCCCCT 1607 Qy 781 CTAGCGGGCGCGGGGCGAAGCGGTGCGGCGCCGGCAGGAAGGAAATGGGCGGGGAGGGCC 840 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1608 CTAGCGGGCGCGGGGCGAAGCGGTGCGGCGCCGGCAGGAAGGAAATGGGCGGGGAGGGCC 1667 Qy 841 TTCGTGCGTCGCCGCGCCGCCGTCCCCTTCTCCCTCTCCAGCCTCGGGGCTGTCCGCGGG 900 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1668 TTCGTGCGTCGCCGCGCCGCCGTCCCCTTCTCCCTCTCCAGCCTCGGGGCTGTCCGCGGG 1727 Qy 901 GGGACGGCTGCCTTCGGGGGGGACGGGGCAGGGCGGGGTTCGGCTTCTGGCGTGTGACCG 960 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1728 GGGACGGCTGCCTTCGGGGGGGACGGGGCAGGGCGGGGTTCGGCTTCTGGCGTGTGACCG 1787 Qy 961 GCGGCTCTAGAGCCTCTGCTAACCATGTTCATGCCTTCTTCTTTTTCCTACAG 1013 ||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1788 GCGGCTCTAGAGCCTCTGCTAACCATGTTCATGCCTTCTTCTTTTTCCTACAG 1840 SEQ ID NO 20: RESULT 1 US-18-134-095-92 Query Match 100.0%; Score 225; DB 1; Length 3845; Best Local Similarity 100.0%; Matches 225; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 CTGTGCCTTCTAGTTGCCAGCCATCTGTTGTTTGCCCCTCCCCCGTGCCTTCCTTGACCC 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3438 CTGTGCCTTCTAGTTGCCAGCCATCTGTTGTTTGCCCCTCCCCCGTGCCTTCCTTGACCC 3497 Qy 61 TGGAAGGTGCCACTCCCACTGTCCTTTCCTAATAAAATGAGGAAATTGCATCGCATTGTC 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3498 TGGAAGGTGCCACTCCCACTGTCCTTTCCTAATAAAATGAGGAAATTGCATCGCATTGTC 3557 Qy 121 TGAGTAGGTGTCATTCTATTCTGGGGGGTGGGGTGGGGCAGGACAGCAAGGGGGAGGATT 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3558 TGAGTAGGTGTCATTCTATTCTGGGGGGTGGGGTGGGGCAGGACAGCAAGGGGGAGGATT 3617 Qy 181 GGGAAGACAATAGCAGGCATGCTGGGGATGCGGTGGGCTCTATGG 225 ||||||||||||||||||||||||||||||||||||||||||||| Db 3618 GGGAAGACAATAGCAGGCATGCTGGGGATGCGGTGGGCTCTATGG 3662 Therefore the App095 claims recite elements (i), (ii), (iii), (iv), (viii), and (ix) of the claimed invention. Then the other prior art teaches the other claim elements that the App095 claims do not recite: WO900 teaches (¶99) an rAAV vector comprising the CLRN1 cDNA including the 5’ and 3’UTRs, and teaches driving it with the chicken β-actin promoter. WO900 teaches (¶9-10) the polynucleotide (polynt) can include a sequence having SEQ ID NO 2 (which it specifies comprises a 5’UTR and 3’UTR) and can be included on a vector that can be an adeno-associated viral vector (AAV) that can be used for transfecting ocular cells or cells of the inner ear. WO900 teaches (¶21) that the heterologous polynucleotide comprised in the AAV vector is flanked by at least one, and generally by two AAV inverted terminal repeat sequence (ITRs); an artisan would realize that being flanked by two ITRs refers to one ITR on either side, which is a 5’ITR and a 3’ITR. WO900 SEQ ID NO 2 comprises a polynt comprising a sequence encoding the amino acid sequence of instant SEQ ID NO 3 (which has been back-translated from AA[Wingdings font/0xE0]nucleotides). This is shown by the following sequence alignment: RESULT 7 BDA01054 ID BDA01054 standard; cDNA; 2352 BP. XX AC BDA01054; XX DT 16-JUN-2016 (first entry) XX DE Human derived clarin-1 (CLRN1) polynucleotide SEQ ID NO:2. XX KW CLRN1 gene; auditory; clarin-1; gene therapy; hearing loss; KW ophthalmological; ss; therapeutic; usher syndrome iii; vision disorder. XX OS Homo sapiens. XX CC PN WO2016073900-A1. XX CC PD 12-MAY-2016. XX CC PF 06-NOV-2015; 2015WO-US059546. XX PR 06-NOV-2014; 2014US-0076114P. PR 08-MAY-2015; 2015US-0158846P. XX CC PA (UCWR ) UNIV CASE WESTERN RESERVE. XX CC PI Alagramam KN; XX DR WPI; 2016-282935/37. XX CC PT New polynucleotide comprising a nucleic acid sequence that includes a CC PT cDNA coding sequence of a clarin-1 gene, useful for treating vision CC PT and/or hearing loss associated with Usher syndrome III. XX CC PS Claim 9; SEQ ID NO 2; 43pp; English. XX CC The invention relates to a novel polynucleotide, used for treating vision CC and/or hearing loss associated with Usher syndrome III. This CC polynucleotide comprises a nucleic acid sequence that includes a cDNA CC coding sequence of a clarin-1 (CLRN1) gene and a 3' untranslated region CC (UTR) nucleic acid that is derived from the 3' UTR of the clarin-1 gene, CC where the 3' UTR nucleic acid enhances expression of clarin-1 in a cell CC transfected with the polynucleotide compared to a cell transfected with a CC similar polynucleotide devoid of the 3' UTR nucleic acid. The invention CC further claims: a nucleic acid construct comprising a polynucleotide CC defined above; a vector for transfecting a cell, comprising a CC polynucleotide defined above, where the transfected cell expresses clarin CC -1; and a method of treating vision and/or hearing loss associated with CC Usher syndrome III in a subject by administering to the ocular cells CC and/or cells of the inner ear of the subject, a vector that promotes CC expression of clarin-1 in the cells. The present sequence is a clarin-1 CC polynucleotide, used for treating vision and/or hearing loss associated CC with Usher syndrome III in a subject. XX SQ Sequence 2352 BP; 705 A; 475 C; 484 G; 688 T; 0 U; 0 Other; Alignment Scores: Length: 2352 Score: 1214.00 Matches: 232 Percent Similarity: 100.0% Conservative: 0 Best Local Similarity: 100.0% Mismatches: 0 Query Match: 100.0% Indels: 0 Gaps: 0 US-17-253-658-3 (1-232) x BDA01054 (1-2352) Qy 1 MetProSerGlnGlnLysLysIleIlePheCysMetAlaGlyValPheSerPheAlaCys 20 SEQ ID NO 3 translated[Wingdings font/0xE0]NT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 282 ATGCCAAGCCAACAGAAGAAAATCATTTTTTGCATGGCCGGAGTGTTCAGTTTTGCATGT 341 WO900 SEQ ID NO 2 Qy 21 AlaLeuGlyValValThrAlaLeuGlyThrProLeuTrpIleLysAlaThrValLeuCys 40 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 342 GCCCTCGGAGTTGTGACAGCCTTGGGGACACCGTTGTGGATCAAAGCCACTGTCCTCTGC 401 Qy 41 LysThrGlyAlaLeuLeuValAsnAlaSerGlyGlnGluLeuAspLysPheMetGlyGlu 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 402 AAAACGGGAGCTCTGCTCGTCAATGCCTCAGGGCAGGAGCTGGACAAGTTTATGGGTGAA 461 Qy 61 MetGlnTyrGlyLeuPheHisGlyGluGlyValArgGlnCysGlyLeuGlyAlaArgPro 80 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 462 ATGCAGTACGGGCTTTTCCACGGAGAGGGTGTGAGGCAGTGTGGGTTGGGAGCAAGGCCC 521 Qy 81 PheArgPheSerPhePheProAspLeuLeuLysAlaIleProValSerIleHisValAsn 100 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 522 TTTCGGTTCTCATTTTTTCCAGATTTGCTCAAAGCAATCCCAGTGAGCATCCACGTCAAT 581 Qy 101 ValIleLeuPheSerAlaIleLeuIleValLeuThrMetValGlyThrAlaPhePheMet 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 582 GTCATTCTCTTCTCTGCCATCCTTATTGTGTTAACCATGGTGGGGACAGCCTTCTTCATG 641 Qy 121 TyrAsnAlaPheGlyLysProPheGluThrLeuHisGlyProLeuGlyLeuTyrLeuLeu 140 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 642 TACAATGCTTTTGGAAAACCTTTTGAAACTCTGCATGGTCCCCTAGGGCTGTACCTTTTG 701 Qy 141 SerPheIleSerGlySerCysGlyCysLeuValMetIleLeuPheAlaSerGluValLys 160 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 702 AGCTTCATTTCAGGCTCCTGTGGCTGTCTTGTCATGATATTGTTTGCCTCTGAAGTGAAA 761 Qy 161 IleHisHisLeuSerGluLysIleAlaAsnTyrLysGluGlyThrTyrValTyrLysThr 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 762 ATCCATCACCTCTCAGAAAAAATTGCAAATTATAAAGAAGGGACTTATGTCTACAAAACG 821 Qy 181 GlnSerGluLysTyrThrThrSerPheTrpValIlePhePheCysPhePheValHisPhe 200 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 822 CAAAGTGAAAAATATACCACCTCATTCTGGGTCATTTTCTTTTGCTTTTTTGTTCATTTT 881 Qy 201 LeuAsnGlyLeuLeuIleArgLeuAlaGlyPheGlnPheProPheAlaLysSerLysAsp 220 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 882 CTGAATGGGCTCCTAATACGACTTGCTGGATTTCAGTTCCCTTTTGCAAAATCTAAAGAC 941 Qy 221 AlaGluThrThrAsnValAlaAlaAspLeuMetTyr 232 |||||||||||||||||||||||||||||||||||| Db 942 GCAGAAACAACTAATGTAGCTGCAGATCTAATGTAC 977 That alignment shows that the composition of WO900 comprises SEQ ID NO 3 itself, a 5’UTR, and a 3’UTR. Those are elements (v), (vi), and (vii) of the instant claims. WO900 teaches (¶10-11) treating retinal cells. The App095 claims do not recite a kit that comprises a pre-loaded syringe. However, US952 teaches (Col 11 L3-15) a kit that comprises nucleic acid compounds within a container of solution and that the kit can comprise a pre-loaded syringe comprising the compounds. An artisan would have put their compounds into a kit comprising a pre-loaded syringe for the benefit of ensuring that the recipient has the exact dosage ready to administer and because doing so would have prevented any complications that arise from mixing a solution and then getting the mixed solution into a syringe. Therefore it would have been obvious to use WO900’s SEQ ID NO 2 with the AAV particle of App095 in order to express CLRN1. An artisan would have known that using WO900’s sequence and teachings with the invention recited in the App095 claims and modified by the teachings of Powell, App178, and US952 would have provided a benefit of treating hearing or vision loss because WO900 teaches that (¶11), and it would have been a simple matter to swap the sequence encoding CLRN1 of WO900 for the sequence encoding a VEGF antibody of the App095 claims. Packaging it into a pre-loaded syringe would also have been of benefit as taught by US952. Using WO900’s sequence and teachings with the invention recited in the App095 claims and modified by the teachings of US952 would have produced the instant invention. Therefore the instant claims would have been obvious in view of the App095 claims, WO900, and US952. Claims 229-232, 247-254, and 256-270 are provisionally rejected on the ground of nonstatutory double patenting as being unpatentable over claims 103-127 of copending Application No. 18696131 (reference application; “App131”) in view of Powell, WO900, Landegger (et al. 2017. A synthetic AAV vector enables safe and efficient gene transfer to the mammalian inner ear. Nat. Biotechnol. 35[3]:280-286, “Landegger”, of record on IDS), App178, and US952. This rejection is maintained and updated in response to the claim amendments. All supporting references are of record. Although the claims at issue are not identical, they are not patentably distinct from each other because both claim sets are directed to methods and compositions of gene therapies for expressing a gene of interest in the inner ear to treat hearing loss. The instant claims recite a composition comprising an AAV nucleic acid vector wherein the vector comprises a 5’ ITR, a CMV enhancer, a CBA promoter, a chimeric intron, a 5’UTR, a coding sequence (CDS) encoding a CLRN1 protein according to SEQ ID NO 3, a 3’UTR, a polyA signal, and a 3’ITR, wherein the CDS comprises a nt sequence spanning 2 consecutive exons of CLRN1 genomic DNA and lacks an intron sequence between them; wherein the composition can comprise other components such as SEQ ID NOs 16-17 or 20; to the composition comprising an excipient; to an AAV2 capsid comprising the composition, to an Anc80 capsid comprising the composition; to a kit comprising the composition; and to methods of introducing it to a cochlea of a mammal that can be a human who can have been previously identified as having a defective endogenous CLRN1 gene; to methods of increasing CLRN1 expression in the ear or eye; and to methods of treating hearing or vision loss. The App131 claims recite a composition comprising a construct, wherein the construct comprises SEQ ID NO 333, an AAV particle comprising the construct, and methods of administering the AAV to a cochlea. An artisan would not know what is SEQ ID NO 333 but they would consult the SEQ listing and find that it comprises a 5’ITR, a CMV enhancer comprising claimed SEQ ID NO 17, a CBA promoter, a chimeric intron according claimed SEQ ID NO 16, a coding sequence, and a 3’ITR. Both claim sets are directed to constructs for gene expression in the cochlea, wherein the constructs comprise the same elements including a chimeric intron comprising SEQ ID NO 19 and a CVM enhancer comprising SEQ ID NO 17. App131 SEQ ID NO 333 comprises regions identical to claimed SEQ ID NOs 17 and 16: US-18-696-131A-333 Query Match 100.0%; Score 380; DB 1; Length 3405; Best Local Similarity 100.0%; Matches 380; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 GACATTGATTATTGACTAGTTATTAATAGTAATCAATTACGGGGTCATTAGTTCATAGCC 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 145 GACATTGATTATTGACTAGTTATTAATAGTAATCAATTACGGGGTCATTAGTTCATAGCC 204 Qy 61 CATATATGGAGTTCCGCGTTACATAACTTACGGTAAATGGCCCGCCTGGCTGACCGCCCA 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 205 CATATATGGAGTTCCGCGTTACATAACTTACGGTAAATGGCCCGCCTGGCTGACCGCCCA 264 Qy 121 ACGACCCCCGCCCATTGACGTCAATAATGACGTATGTTCCCATAGTAACGCCAATAGGGA 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 265 ACGACCCCCGCCCATTGACGTCAATAATGACGTATGTTCCCATAGTAACGCCAATAGGGA 324 Qy 181 CTTTCCATTGACGTCAATGGGTGGACTATTTACGGTAAACTGCCCACTTGGCAGTACATC 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 325 CTTTCCATTGACGTCAATGGGTGGACTATTTACGGTAAACTGCCCACTTGGCAGTACATC 384 Qy 241 AAGTGTATCATATGCCAAGTACGCCCCCTATTGACGTCAATGACGGTAAATGGCCCGCCT 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 385 AAGTGTATCATATGCCAAGTACGCCCCCTATTGACGTCAATGACGGTAAATGGCCCGCCT 444 Qy 301 GGCATTATGCCCAGTACATGACCTTATGGGACTTTCCTACTTGGCAGTACATCTACGTAT 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 445 GGCATTATGCCCAGTACATGACCTTATGGGACTTTCCTACTTGGCAGTACATCTACGTAT 504 Qy 361 TAGTCATCGCTATTACCATG 380 |||||||||||||||||||| Db 505 TAGTCATCGCTATTACCATG 524 SEQ ID NO 16: US-18-696-131A-333 Query Match 100.0%; Score 1013; DB 1; Length 3405; Best Local Similarity 100.0%; Matches 1013; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 GGAGTCGCTGCGTTGCCTTCGCCCCGTGCCCCGCTCCGCGCCGCCTCGCGCCGCCCGCCC 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 803 GGAGTCGCTGCGTTGCCTTCGCCCCGTGCCCCGCTCCGCGCCGCCTCGCGCCGCCCGCCC 862 Qy 61 CGGCTCTGACTGACCGCGTTACTCCCACAGGTGAGCGGGCGGGACGGCCCTTCTCCTCCG 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 863 CGGCTCTGACTGACCGCGTTACTCCCACAGGTGAGCGGGCGGGACGGCCCTTCTCCTCCG 922 Qy 121 GGCTGTAATTAGCGCTTGGTTTAATGACGGCTCGTTTCTTTTCTGTGGCTGCGTGAAAGC 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 923 GGCTGTAATTAGCGCTTGGTTTAATGACGGCTCGTTTCTTTTCTGTGGCTGCGTGAAAGC 982 Qy 181 CTTAAAGGGCTCCGGGAGGGCCCTTTGTGCGGGGGGGAGCGGCTCGGGGGGTGCGTGCGT 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 983 CTTAAAGGGCTCCGGGAGGGCCCTTTGTGCGGGGGGGAGCGGCTCGGGGGGTGCGTGCGT 1042 Qy 241 GTGTGTGTGCGTGGGGAGCGCCGCGTGCGGCCCGCGCTGCCCGGCGGCTGTGAGCGCTGC 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1043 GTGTGTGTGCGTGGGGAGCGCCGCGTGCGGCCCGCGCTGCCCGGCGGCTGTGAGCGCTGC 1102 Qy 301 GGGCGCGGCGCGGGGCTTTGTGCGCTCCGCGTGTGCGCGAGGGGAGCGCGGCCGGGGGCG 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1103 GGGCGCGGCGCGGGGCTTTGTGCGCTCCGCGTGTGCGCGAGGGGAGCGCGGCCGGGGGCG 1162 Qy 361 GTGCCCCGCGGTGCGGGGGGGCTGCGAGGGGAACAAAGGCTGCGTGCGGGGTGTGTGCGT 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1163 GTGCCCCGCGGTGCGGGGGGGCTGCGAGGGGAACAAAGGCTGCGTGCGGGGTGTGTGCGT 1222 Qy 421 GGGGGGGTGAGCAGGGGGTGTGGGCGCGGCGGTCGGGCTGTAACCCCCCCCTGCACCCCC 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1223 GGGGGGGTGAGCAGGGGGTGTGGGCGCGGCGGTCGGGCTGTAACCCCCCCCTGCACCCCC 1282 Qy 481 CTCCCCGAGTTGCTGAGCACGGCCCGGCTTCGGGTGCGGGGCTCCGTGCGGGGCGTGGCG 540 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1283 CTCCCCGAGTTGCTGAGCACGGCCCGGCTTCGGGTGCGGGGCTCCGTGCGGGGCGTGGCG 1342 Qy 541 CGGGGCTCGCCGTGCCGGGCGGGGGGTGGCGGCAGGTGGGGGTGCCGGGCGGGGCGGGGC 600 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1343 CGGGGCTCGCCGTGCCGGGCGGGGGGTGGCGGCAGGTGGGGGTGCCGGGCGGGGCGGGGC 1402 Qy 601 CGCCTCGGGCCGGGGAGGGCTCGGGGGAGGGGCGCGGCGGCCCCCGGAGCGCCGGCGGCT 660 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1403 CGCCTCGGGCCGGGGAGGGCTCGGGGGAGGGGCGCGGCGGCCCCCGGAGCGCCGGCGGCT 1462 Qy 661 GTCGAGGCGCGGCGAGCCGCAGCCATTGCCTTTTATGGTAATCGTGCGAGAGGGCGCAGG 720 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1463 GTCGAGGCGCGGCGAGCCGCAGCCATTGCCTTTTATGGTAATCGTGCGAGAGGGCGCAGG 1522 Qy 721 GACTTCCTTTGTCCCAAATCTGTGCGGAGCCGAAATCTGGGAGGCGCCGCCGCACCCCCT 780 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1523 GACTTCCTTTGTCCCAAATCTGTGCGGAGCCGAAATCTGGGAGGCGCCGCCGCACCCCCT 1582 Qy 781 CTAGCGGGCGCGGGGCGAAGCGGTGCGGCGCCGGCAGGAAGGAAATGGGCGGGGAGGGCC 840 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1583 CTAGCGGGCGCGGGGCGAAGCGGTGCGGCGCCGGCAGGAAGGAAATGGGCGGGGAGGGCC 1642 Qy 841 TTCGTGCGTCGCCGCGCCGCCGTCCCCTTCTCCCTCTCCAGCCTCGGGGCTGTCCGCGGG 900 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1643 TTCGTGCGTCGCCGCGCCGCCGTCCCCTTCTCCCTCTCCAGCCTCGGGGCTGTCCGCGGG 1702 Qy 901 GGGACGGCTGCCTTCGGGGGGGACGGGGCAGGGCGGGGTTCGGCTTCTGGCGTGTGACCG 960 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1703 GGGACGGCTGCCTTCGGGGGGGACGGGGCAGGGCGGGGTTCGGCTTCTGGCGTGTGACCG 1762 Qy 961 GCGGCTCTAGAGCCTCTGCTAACCATGTTCATGCCTTCTTCTTTTTCCTACAG 1013 ||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1763 GCGGCTCTAGAGCCTCTGCTAACCATGTTCATGCCTTCTTCTTTTTCCTACAG 1815 Therefore the App131 claims recite elements (i), (ii), (iii), (iv), and (ix) of the claimed invention. Then the other prior art teaches the other claim elements that the App131 claims do not recite: WO900 teaches an rAAV vector comprising the CLRN1 cDNA including the 5’ and 3’UTRs, and teaches driving it with the chicken β-actin promoter. WO900 teaches (¶9-10) the polynucleotide (polynt) can include a sequence having SEQ ID NO 2 (which it specifies comprises a 5’UTR and 3’UTR) and can be included on a vector that can be an adeno-associated viral vector (AAV) that can be used for transfecting ocular cells or cells of the inner ear. WO900 teaches (¶21) that the heterologous polynucleotide comprised in the AAV vector is flanked by at least one, and generally by two AAV inverted terminal repeat sequence (ITRs); an artisan would realize that being flanked by two ITRs refers to one ITR on either side, which is a 5’ITR and a 3’ITR. WO900 teaches (¶10-11) treating retinal cells and (¶72) AAV2. WO900 SEQ ID NO 2 comprises a polynt comprising a sequence encoding the amino acid sequence of instant SEQ ID NO 3 (which has been back-translated from AA[Wingdings font/0xE0]nucleotides). This is shown by the following sequence alignment: RESULT 7 BDA01054 ID BDA01054 standard; cDNA; 2352 BP. XX AC BDA01054; XX DT 16-JUN-2016 (first entry) XX DE Human derived clarin-1 (CLRN1) polynucleotide SEQ ID NO:2. XX KW CLRN1 gene; auditory; clarin-1; gene therapy; hearing loss; KW ophthalmological; ss; therapeutic; usher syndrome iii; vision disorder. XX OS Homo sapiens. XX CC PN WO2016073900-A1. XX CC PD 12-MAY-2016. XX CC PF 06-NOV-2015; 2015WO-US059546. XX PR 06-NOV-2014; 2014US-0076114P. PR 08-MAY-2015; 2015US-0158846P. XX CC PA (UCWR ) UNIV CASE WESTERN RESERVE. XX CC PI Alagramam KN; XX DR WPI; 2016-282935/37. XX CC PT New polynucleotide comprising a nucleic acid sequence that includes a CC PT cDNA coding sequence of a clarin-1 gene, useful for treating vision CC PT and/or hearing loss associated with Usher syndrome III. XX CC PS Claim 9; SEQ ID NO 2; 43pp; English. XX CC The invention relates to a novel polynucleotide, used for treating vision CC and/or hearing loss associated with Usher syndrome III. This CC polynucleotide comprises a nucleic acid sequence that includes a cDNA CC coding sequence of a clarin-1 (CLRN1) gene and a 3' untranslated region CC (UTR) nucleic acid that is derived from the 3' UTR of the clarin-1 gene, CC where the 3' UTR nucleic acid enhances expression of clarin-1 in a cell CC transfected with the polynucleotide compared to a cell transfected with a CC similar polynucleotide devoid of the 3' UTR nucleic acid. The invention CC further claims: a nucleic acid construct comprising a polynucleotide CC defined above; a vector for transfecting a cell, comprising a CC polynucleotide defined above, where the transfected cell expresses clarin CC -1; and a method of treating vision and/or hearing loss associated with CC Usher syndrome III in a subject by administering to the ocular cells CC and/or cells of the inner ear of the subject, a vector that promotes CC expression of clarin-1 in the cells. The present sequence is a clarin-1 CC polynucleotide, used for treating vision and/or hearing loss associated CC with Usher syndrome III in a subject. XX SQ Sequence 2352 BP; 705 A; 475 C; 484 G; 688 T; 0 U; 0 Other; Alignment Scores: Length: 2352 Score: 1214.00 Matches: 232 Percent Similarity: 100.0% Conservative: 0 Best Local Similarity: 100.0% Mismatches: 0 Query Match: 100.0% Indels: 0 Gaps: 0 US-17-253-658-3 (1-232) x BDA01054 (1-2352) Qy 1 MetProSerGlnGlnLysLysIleIlePheCysMetAlaGlyValPheSerPheAlaCys 20 SEQ ID NO 3 translated[Wingdings font/0xE0]NT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 282 ATGCCAAGCCAACAGAAGAAAATCATTTTTTGCATGGCCGGAGTGTTCAGTTTTGCATGT 341 WO900 SEQ ID NO 2 Qy 21 AlaLeuGlyValValThrAlaLeuGlyThrProLeuTrpIleLysAlaThrValLeuCys 40 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 342 GCCCTCGGAGTTGTGACAGCCTTGGGGACACCGTTGTGGATCAAAGCCACTGTCCTCTGC 401 Qy 41 LysThrGlyAlaLeuLeuValAsnAlaSerGlyGlnGluLeuAspLysPheMetGlyGlu 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 402 AAAACGGGAGCTCTGCTCGTCAATGCCTCAGGGCAGGAGCTGGACAAGTTTATGGGTGAA 461 Qy 61 MetGlnTyrGlyLeuPheHisGlyGluGlyValArgGlnCysGlyLeuGlyAlaArgPro 80 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 462 ATGCAGTACGGGCTTTTCCACGGAGAGGGTGTGAGGCAGTGTGGGTTGGGAGCAAGGCCC 521 Qy 81 PheArgPheSerPhePheProAspLeuLeuLysAlaIleProValSerIleHisValAsn 100 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 522 TTTCGGTTCTCATTTTTTCCAGATTTGCTCAAAGCAATCCCAGTGAGCATCCACGTCAAT 581 Qy 101 ValIleLeuPheSerAlaIleLeuIleValLeuThrMetValGlyThrAlaPhePheMet 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 582 GTCATTCTCTTCTCTGCCATCCTTATTGTGTTAACCATGGTGGGGACAGCCTTCTTCATG 641 Qy 121 TyrAsnAlaPheGlyLysProPheGluThrLeuHisGlyProLeuGlyLeuTyrLeuLeu 140 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 642 TACAATGCTTTTGGAAAACCTTTTGAAACTCTGCATGGTCCCCTAGGGCTGTACCTTTTG 701 Qy 141 SerPheIleSerGlySerCysGlyCysLeuValMetIleLeuPheAlaSerGluValLys 160 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 702 AGCTTCATTTCAGGCTCCTGTGGCTGTCTTGTCATGATATTGTTTGCCTCTGAAGTGAAA 761 Qy 161 IleHisHisLeuSerGluLysIleAlaAsnTyrLysGluGlyThrTyrValTyrLysThr 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 762 ATCCATCACCTCTCAGAAAAAATTGCAAATTATAAAGAAGGGACTTATGTCTACAAAACG 821 Qy 181 GlnSerGluLysTyrThrThrSerPheTrpValIlePhePheCysPhePheValHisPhe 200 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 822 CAAAGTGAAAAATATACCACCTCATTCTGGGTCATTTTCTTTTGCTTTTTTGTTCATTTT 881 Qy 201 LeuAsnGlyLeuLeuIleArgLeuAlaGlyPheGlnPheProPheAlaLysSerLysAsp 220 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 882 CTGAATGGGCTCCTAATACGACTTGCTGGATTTCAGTTCCCTTTTGCAAAATCTAAAGAC 941 Qy 221 AlaGluThrThrAsnValAlaAlaAspLeuMetTyr 232 |||||||||||||||||||||||||||||||||||| Db 942 GCAGAAACAACTAATGTAGCTGCAGATCTAATGTAC 977 That alignment shows that the composition of WO900 comprises SEQ ID NO 3 itself, a 5’UTR, and a 3’UTR. Those are elements (v), (vi), and (vii) of the instant claims. Landegger teaches (§Abstract) an Anc80 vector for transgene delivery to the cochlea. Landegger teaches the vector is well tolerated and targets outer hair cells at high rates. Powell teaches (§Polyadenylation Signal Sequences and Upstream Enhancer) one study, in human epithelial-like cells, found that a transgene had a 2.5-fold increase in expression with … bovine growth hormone polyA (bGHpA) signal sequences compared to a minimal synthetic polyA (SPA) signal. App178 teaches SEQ ID NO 30 which comprises a bovine growth hormone polyA signal and is 100% identical to instant SEQ ID NO 20, as shown by the following sequence alignment: RESULT 1 AXQ64086 (NOTE: this sequence has 272 duplicates in the database searched. See complete list at the end of this report) ID AXQ64086 standard; DNA; 225 BP. XX AC AXQ64086; XX DT 29-OCT-2009 (first entry) XX DE BGH polyA Yes1 supplementary expression cassette 3' UTR, SEQ:30 #2. XX KW 3'-utr; Yes1; dna cassette; gene expression; gene silencing; KW protein production; rna interference; ss. XX OS Bos taurus. OS Synthetic. XX CC PN US2009215178-A1. XX CC PD 27-AUG-2009. XX CC PF 22-FEB-2008; 2008US-00035437. XX PR 22-FEB-2008; 2008US-00035437. XX CC PA (TANG/) TANG Z. XX CC PI Tang Z; XX DR WPI; 2009-M96179/59. XX CC PT Generating cell clones with stable transgene (Gene of Interest (GOI)) CC PT expression comprises inactivation of endogenous essential genes of cell CC PT substrate and trans-complementation of essential genes products. XX CC PS Example 3; SEQ ID NO 30; 9pp; English. XX CC The present invention relates to a method for generating cell clones with CC stable transgene (Gene Of Interest (GOI)) expression. The method of the CC invention comprises: (i) inactivation of endogenous essential genes of CC cell substrate through Gene Inactivation Cassettes (GIC), (ii) trans- CC complementation of essential gene products through Gene Supplementary CC Cassettes (GSC), alternatively, the cassette codes for the gene product CC that is capable of inactivating GIC function, (iii) the GOI expression CC cassettes are preferably, physically linked to GSC to take advantage of CC favourable selective pressure, (iv) GIC could be preferably physically CC linked to GSC and GOI expression cassettes, where the endogenous CC essential genes of cell substrate refer to genes or combination of genes CC that are essential for cell survival and / or cell proliferation. The GIC CC comprises a vector comprising a promoter operably linked to RNA CC interference, RNAi (shRNA) / dsRNA / ribozyme molecule, or tandem repeats CC of such transcript units, targeted to cell endogenous essential mRNA. The CC invention provides strategies for increasing the productivity of CC recombinant protein expression in isogenic cell-lines, and a novel CC selection system for the improved stability and homogeneity of transgene CC expression in isogenic cells without dependence on continuous selective CC drugs. An example of the invention provides an essential gene knock-down CC cassette, targeted at 3' UTR of human endogenous Yes1 gene, and a CC supplementary Yes1 expression cassette which uses a 3' UTR from bovine CC growth hormone (BGH) polyA. The present sequence is a bovine growth CC hormone (BGH) polyA Yes1 supplementary expression cassette 3' UTR, used CC in an example of the invention. Note: This version of SEQ ID 30 is given CC in example 3, but it is not the same as the sequence referred to as SEQ CC ID 30 (seeAXQ61560) in the sequence listing. XX SQ Sequence 225 BP; 41 A; 53 C; 72 G; 59 T; 0 U; 0 Other; Query Match 100.0%; Score 225; Length 225; Best Local Similarity 100.0%; Matches 225; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 CTGTGCCTTCTAGTTGCCAGCCATCTGTTGTTTGCCCCTCCCCCGTGCCTTCCTTGACCC 60 SEQ ID NO 20 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 CTGTGCCTTCTAGTTGCCAGCCATCTGTTGTTTGCCCCTCCCCCGTGCCTTCCTTGACCC 60 Prior art SEQ Qy 61 TGGAAGGTGCCACTCCCACTGTCCTTTCCTAATAAAATGAGGAAATTGCATCGCATTGTC 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 TGGAAGGTGCCACTCCCACTGTCCTTTCCTAATAAAATGAGGAAATTGCATCGCATTGTC 120 Qy 121 TGAGTAGGTGTCATTCTATTCTGGGGGGTGGGGTGGGGCAGGACAGCAAGGGGGAGGATT 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 TGAGTAGGTGTCATTCTATTCTGGGGGGTGGGGTGGGGCAGGACAGCAAGGGGGAGGATT 180 Qy 181 GGGAAGACAATAGCAGGCATGCTGGGGATGCGGTGGGCTCTATGG 225 ||||||||||||||||||||||||||||||||||||||||||||| Db 181 GGGAAGACAATAGCAGGCATGCTGGGGATGCGGTGGGCTCTATGG 225 A poly-A sequence comprising SEQ ID NO 20 is component (viii) of the instant claims. The App131 claims do not recite a kit that comprises a pre-loaded syringe. However, US952 teaches (Col 11 L3-15) a kit that comprises nucleic acid compounds within a container of solution and that the kit can comprise a pre-loaded syringe comprising the compounds. An artisan would have put their compounds into a kit comprising a pre-loaded syringe for the benefit of ensuring that the recipient has the exact dosage ready to administer and because doing so would have prevented any complications that arise from mixing a solution and then getting the mixed solution into a syringe. Therefore it would have been obvious to use WO900’s SEQ ID NO 2 with the expression construct of App131 in order to express CLRN1. An artisan would have known that using WO900’s sequence and teachings with the invention recited in the App131 claims and modified by the teachings of Powell, App178, and US952 would have provided a benefit of treating hearing or vision loss because WO900 teaches that (¶11), and it would have been a simple matter to swap the sequence encoding CLRN1 of WO900 for the sequence encoding a Kv7.4 protein of the App131 claims. Using the bovine growth hormone polyA signal of App178 would have been of benefit based on the teachings of Powell. It would have been obvious to use Landegger’s Anc80 vector because it is well tolerated. Packaging it into a pre-loaded syringe would also have been of benefit as taught by US952. Using WO900’s sequence and teachings with the invention recited in the App131 claims and modified by the teachings of Landegger, Powell, App178, and US952 would have produced the instant invention. Therefore the instant claims would have been obvious in view of the App131 claims, WO900, Landegger, Powell, App178, and US952. This is a provisional nonstatutory double patenting rejection. Claims 229-232, 247-254, and 256-270 are provisionally rejected on the ground of nonstatutory double patenting as being unpatentable over claims 1, 10-11, 13-17, 19-24, and 38-50 of copending Application No. 18269307 (reference application; “App307”; of record) in view of US Patent No. 8980952, issued 17 March 2015 (“US952”) and WO900. This rejection is maintained and updated in response to the claim amendments. All references are of record. Although the claims at issue are not identical, they are not patentably distinct from each other because the instant claims recite a composition comprising an AAV nucleic acid vector wherein the vector comprises a 5’ ITR, a CMV enhancer, a CBA promoter, a chimeric intron according to SEQ ID NO 16, a 5’UTR, a coding sequence (CDS) encoding a CLRN1 protein according to SEQ ID NO 3, a 3’UTR, a polyA signal, and a 3’ITR, wherein the CDS comprises a nt sequence spanning 2 consecutive exons of CLRN1 genomic DNA and lacks an intron sequence between them; wherein the composition can comprise other components such as SEQ ID NOs 17 or 20; to the composition comprising an excipient; to an AAV2 capsid comprising the composition, to an Anc80 capsid comprising the composition; to a kit comprising the composition; and to methods of introducing it to a cochlea of a mammal that can be a human who can have been previously identified as having a defective endogenous CLRN1 gene; to methods of increasing CLRN1 expression in the ear or eye; and to methods of treating hearing or vision loss. The App307 claims are drawn to a gene therapy comprising an AAV particle comprising a 5’ ITR, a CMV enhancer, a CBA promoter, a chimeric intron, a 5’UTR, a coding sequence (CDS) encoding a CLRN1 protein according to SEQ ID NO 1, a 3’UTR, a polyA signal, and a 3’ITR, wherein the CLRN1 protein can have SEQ ID NO 10, can have a polyA signal, CMV enhancer, or chimeric intron according to SEQ ID NOs 44, 38, or 39; wherein the particle can comprise an AAV capsid and the capsid can be an Anc80 capsid, and to methods of treating vision or hearing loss. Both claim sets are drawn to gene therapies for treating hearing and vision loss by administering a gene therapy encoding a CLRN1 protein. Instant SEQ ID NO 3 is the same as App307 SEQ ID NO 10 (recited in App307 Claim 45), as shown by the following alignment: RESULT 1 US-18-269-307-10 Query Match 100.0%; Score 1214; DB 1; Length 232; Best Local Similarity 100.0%; Matches 232; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 MPSQQKKIIFCMAGVFSFACALGVVTALGTPLWIKATVLCKTGALLVNASGQELDKFMGE 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MPSQQKKIIFCMAGVFSFACALGVVTALGTPLWIKATVLCKTGALLVNASGQELDKFMGE 60 Qy 61 MQYGLFHGEGVRQCGLGARPFRFSFFPDLLKAIPVSIHVNVILFSAILIVLTMVGTAFFM 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 MQYGLFHGEGVRQCGLGARPFRFSFFPDLLKAIPVSIHVNVILFSAILIVLTMVGTAFFM 120 Qy 121 YNAFGKPFETLHGPLGLYLLSFISGSCGCLVMILFASEVKIHHLSEKIANYKEGTYVYKT 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 YNAFGKPFETLHGPLGLYLLSFISGSCGCLVMILFASEVKIHHLSEKIANYKEGTYVYKT 180 Qy 181 QSEKYTTSFWVIFFCFFVHFLNGLLIRLAGFQFPFAKSKDAETTNVAADLMY 232 |||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 QSEKYTTSFWVIFFCFFVHFLNGLLIRLAGFQFPFAKSKDAETTNVAADLMY 232 Instant SEQ ID NO 20 is identical to App307 SEQ ID NO 44 (recited in App307 Claim 47), as shown by the following alignment: RESULT 1 US-17-253-658-20 Query Match 100.0%; Score 225; DB 1; Length 225; Best Local Similarity 100.0%; Matches 225; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 CTGTGCCTTCTAGTTGCCAGCCATCTGTTGTTTGCCCCTCCCCCGTGCCTTCCTTGACCC 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 CTGTGCCTTCTAGTTGCCAGCCATCTGTTGTTTGCCCCTCCCCCGTGCCTTCCTTGACCC 60 Qy 61 TGGAAGGTGCCACTCCCACTGTCCTTTCCTAATAAAATGAGGAAATTGCATCGCATTGTC 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 TGGAAGGTGCCACTCCCACTGTCCTTTCCTAATAAAATGAGGAAATTGCATCGCATTGTC 120 Qy 121 TGAGTAGGTGTCATTCTATTCTGGGGGGTGGGGTGGGGCAGGACAGCAAGGGGGAGGATT 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 TGAGTAGGTGTCATTCTATTCTGGGGGGTGGGGTGGGGCAGGACAGCAAGGGGGAGGATT 180 Qy 181 GGGAAGACAATAGCAGGCATGCTGGGGATGCGGTGGGCTCTATGG 225 ||||||||||||||||||||||||||||||||||||||||||||| Db 181 GGGAAGACAATAGCAGGCATGCTGGGGATGCGGTGGGCTCTATGG 225 Instant SEQ ID NO 17 is the same as App307 SEQ ID NO 38 (recited in App307 Claim 41), as shown by the following alignment: RESULT 1 US-18-269-307-38 Query Match 100.0%; Score 380; DB 1; Length 381; Best Local Similarity 100.0%; Matches 380; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 GACATTGATTATTGACTAGTTATTAATAGTAATCAATTACGGGGTCATTAGTTCATAGCC 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 GACATTGATTATTGACTAGTTATTAATAGTAATCAATTACGGGGTCATTAGTTCATAGCC 60 Qy 61 CATATATGGAGTTCCGCGTTACATAACTTACGGTAAATGGCCCGCCTGGCTGACCGCCCA 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 CATATATGGAGTTCCGCGTTACATAACTTACGGTAAATGGCCCGCCTGGCTGACCGCCCA 120 Qy 121 ACGACCCCCGCCCATTGACGTCAATAATGACGTATGTTCCCATAGTAACGCCAATAGGGA 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 ACGACCCCCGCCCATTGACGTCAATAATGACGTATGTTCCCATAGTAACGCCAATAGGGA 180 Qy 181 CTTTCCATTGACGTCAATGGGTGGACTATTTACGGTAAACTGCCCACTTGGCAGTACATC 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 CTTTCCATTGACGTCAATGGGTGGACTATTTACGGTAAACTGCCCACTTGGCAGTACATC 240 Qy 241 AAGTGTATCATATGCCAAGTACGCCCCCTATTGACGTCAATGACGGTAAATGGCCCGCCT 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 AAGTGTATCATATGCCAAGTACGCCCCCTATTGACGTCAATGACGGTAAATGGCCCGCCT 300 Qy 301 GGCATTATGCCCAGTACATGACCTTATGGGACTTTCCTACTTGGCAGTACATCTACGTAT 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 GGCATTATGCCCAGTACATGACCTTATGGGACTTTCCTACTTGGCAGTACATCTACGTAT 360 Qy 361 TAGTCATCGCTATTACCATG 380 |||||||||||||||||||| Db 361 TAGTCATCGCTATTACCATG 380 Instant SEQ ID NO 16 is the same as App307 SEQ ID NO 39 (recited in App307 Claim 43), as shown by the following alignment: US-18-269-307-39 Filing date in PALM: 2023-06-23 Sequence 39, US/18269307 Publication No. US20240139344A1 GENERAL INFORMATION APPLICANT: AKOUOS, INC. TITLE OF INVENTION: COMPOSITIONS AND METHODS FOR TREATING CLRN1-ASSOCIATED HEARING TITLE OF INVENTION: LOSS AND/OR VISION LOSS FILE REFERENCE: 2013615-0214 CURRENT APPLICATION NUMBER: US/18/269,307 CURRENT FILING DATE: 2023-06-23 PRIOR APPLICATION NUMBER: 63/131,413 PRIOR FILING DATE: 2020-12-29 NUMBER OF SEQ ID NOS: 71 SEQ ID NO 39 LENGTH: 1013 TYPE: DNA ORGANISM: Artificial Sequence FEATURE: NAME/KEY: source OTHER INFORMATION: /note="Description of Artificial Sequence: SyntheticRESULT 1 ALIGNMENT: Query Match 100.0%; Score 1013; Length 1013; Best Local Similarity 100.0%; Matches 1013; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 GGAGTCGCTGCGTTGCCTTCGCCCCGTGCCCCGCTCCGCGCCGCCTCGCGCCGCCCGCCC 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 GGAGTCGCTGCGTTGCCTTCGCCCCGTGCCCCGCTCCGCGCCGCCTCGCGCCGCCCGCCC 60 Qy 61 CGGCTCTGACTGACCGCGTTACTCCCACAGGTGAGCGGGCGGGACGGCCCTTCTCCTCCG 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 CGGCTCTGACTGACCGCGTTACTCCCACAGGTGAGCGGGCGGGACGGCCCTTCTCCTCCG 120 Qy 121 GGCTGTAATTAGCGCTTGGTTTAATGACGGCTCGTTTCTTTTCTGTGGCTGCGTGAAAGC 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 GGCTGTAATTAGCGCTTGGTTTAATGACGGCTCGTTTCTTTTCTGTGGCTGCGTGAAAGC 180 Qy 181 CTTAAAGGGCTCCGGGAGGGCCCTTTGTGCGGGGGGGAGCGGCTCGGGGGGTGCGTGCGT 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 CTTAAAGGGCTCCGGGAGGGCCCTTTGTGCGGGGGGGAGCGGCTCGGGGGGTGCGTGCGT 240 Qy 241 GTGTGTGTGCGTGGGGAGCGCCGCGTGCGGCCCGCGCTGCCCGGCGGCTGTGAGCGCTGC 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 GTGTGTGTGCGTGGGGAGCGCCGCGTGCGGCCCGCGCTGCCCGGCGGCTGTGAGCGCTGC 300 Qy 301 GGGCGCGGCGCGGGGCTTTGTGCGCTCCGCGTGTGCGCGAGGGGAGCGCGGCCGGGGGCG 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 GGGCGCGGCGCGGGGCTTTGTGCGCTCCGCGTGTGCGCGAGGGGAGCGCGGCCGGGGGCG 360 Qy 361 GTGCCCCGCGGTGCGGGGGGGCTGCGAGGGGAACAAAGGCTGCGTGCGGGGTGTGTGCGT 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 GTGCCCCGCGGTGCGGGGGGGCTGCGAGGGGAACAAAGGCTGCGTGCGGGGTGTGTGCGT 420 Qy 421 GGGGGGGTGAGCAGGGGGTGTGGGCGCGGCGGTCGGGCTGTAACCCCCCCCTGCACCCCC 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 421 GGGGGGGTGAGCAGGGGGTGTGGGCGCGGCGGTCGGGCTGTAACCCCCCCCTGCACCCCC 480 Qy 481 CTCCCCGAGTTGCTGAGCACGGCCCGGCTTCGGGTGCGGGGCTCCGTGCGGGGCGTGGCG 540 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 481 CTCCCCGAGTTGCTGAGCACGGCCCGGCTTCGGGTGCGGGGCTCCGTGCGGGGCGTGGCG 540 Qy 541 CGGGGCTCGCCGTGCCGGGCGGGGGGTGGCGGCAGGTGGGGGTGCCGGGCGGGGCGGGGC 600 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 541 CGGGGCTCGCCGTGCCGGGCGGGGGGTGGCGGCAGGTGGGGGTGCCGGGCGGGGCGGGGC 600 Qy 601 CGCCTCGGGCCGGGGAGGGCTCGGGGGAGGGGCGCGGCGGCCCCCGGAGCGCCGGCGGCT 660 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 601 CGCCTCGGGCCGGGGAGGGCTCGGGGGAGGGGCGCGGCGGCCCCCGGAGCGCCGGCGGCT 660 Qy 661 GTCGAGGCGCGGCGAGCCGCAGCCATTGCCTTTTATGGTAATCGTGCGAGAGGGCGCAGG 720 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 661 GTCGAGGCGCGGCGAGCCGCAGCCATTGCCTTTTATGGTAATCGTGCGAGAGGGCGCAGG 720 Qy 721 GACTTCCTTTGTCCCAAATCTGTGCGGAGCCGAAATCTGGGAGGCGCCGCCGCACCCCCT 780 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 721 GACTTCCTTTGTCCCAAATCTGTGCGGAGCCGAAATCTGGGAGGCGCCGCCGCACCCCCT 780 Qy 781 CTAGCGGGCGCGGGGCGAAGCGGTGCGGCGCCGGCAGGAAGGAAATGGGCGGGGAGGGCC 840 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 781 CTAGCGGGCGCGGGGCGAAGCGGTGCGGCGCCGGCAGGAAGGAAATGGGCGGGGAGGGCC 840 Qy 841 TTCGTGCGTCGCCGCGCCGCCGTCCCCTTCTCCCTCTCCAGCCTCGGGGCTGTCCGCGGG 900 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 841 TTCGTGCGTCGCCGCGCCGCCGTCCCCTTCTCCCTCTCCAGCCTCGGGGCTGTCCGCGGG 900 Qy 901 GGGACGGCTGCCTTCGGGGGGGACGGGGCAGGGCGGGGTTCGGCTTCTGGCGTGTGACCG 960 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 901 GGGACGGCTGCCTTCGGGGGGGACGGGGCAGGGCGGGGTTCGGCTTCTGGCGTGTGACCG 960 Qy 961 GCGGCTCTAGAGCCTCTGCTAACCATGTTCATGCCTTCTTCTTTTTCCTACAG 1013 ||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 961 GCGGCTCTAGAGCCTCTGCTAACCATGTTCATGCCTTCTTCTTTTTCCTACAG 1013 The backtranslation of instant SEQ ID NO 3 is identical App307 SEQ ID NO 19 (recited in App307 Claim 48), as shown by the following alignment: RESULT 1 US-18-269-307-19 Query Match 100.0%; Score 696; DB 1; Length 696; Best Local Similarity 100.0%; Matches 696; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 ATGCCTAGCCAGCAGAAGAAAATCATCTTCTGCATGGCCGGCGTGTTCAGCTTCGCCTGT 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 ATGCCTAGCCAGCAGAAGAAAATCATCTTCTGCATGGCCGGCGTGTTCAGCTTCGCCTGT 60 Qy 61 GCTCTGGGAGTTGTGACAGCCCTGGGAACCCCTCTGTGGATCAAAGCCACAGTGCTGTGC 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 GCTCTGGGAGTTGTGACAGCCCTGGGAACCCCTCTGTGGATCAAAGCCACAGTGCTGTGC 120 Qy 121 AAGACAGGCGCCCTGCTGGTTAATGCCTCTGGCCAAGAGCTGGACAAGTTCATGGGCGAG 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 AAGACAGGCGCCCTGCTGGTTAATGCCTCTGGCCAAGAGCTGGACAAGTTCATGGGCGAG 180 Qy 181 ATGCAGTACGGCCTGTTCCATGGCGAAGGCGTCAGACAGTGTGGCCTGGGAGCCAGACCT 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 ATGCAGTACGGCCTGTTCCATGGCGAAGGCGTCAGACAGTGTGGCCTGGGAGCCAGACCT 240 Qy 241 TTCAGATTCAGCTTCTTCCCAGACCTGCTGAAGGCTATCCCCGTGTCCATCCACGTGAAC 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 TTCAGATTCAGCTTCTTCCCAGACCTGCTGAAGGCTATCCCCGTGTCCATCCACGTGAAC 300 Qy 301 GTGATCCTGTTCAGCGCCATCCTGATCGTGCTGACAATGGTCGGAACCGCCTTCTTCATG 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 GTGATCCTGTTCAGCGCCATCCTGATCGTGCTGACAATGGTCGGAACCGCCTTCTTCATG 360 Qy 361 TACAACGCCTTCGGCAAGCCCTTCGAGACACTGCATGGACCTCTGGGCCTGTACCTGCTG 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 TACAACGCCTTCGGCAAGCCCTTCGAGACACTGCATGGACCTCTGGGCCTGTACCTGCTG 420 Qy 421 AGCTTTATCAGCGGCAGCTGTGGCTGCCTGGTCATGATTCTGTTCGCCAGCGAAGTGAAG 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 421 AGCTTTATCAGCGGCAGCTGTGGCTGCCTGGTCATGATTCTGTTCGCCAGCGAAGTGAAG 480 Qy 481 ATCCACCACCTGAGCGAGAAGATCGCCAACTACAAAGAGGGCACCTACGTCTACAAGACC 540 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 481 ATCCACCACCTGAGCGAGAAGATCGCCAACTACAAAGAGGGCACCTACGTCTACAAGACC 540 Qy 541 CAGTCCGAGAAGTACACCACCAGCTTTTGGGTTATCTTCTTCTGTTTCTTCGTGCACTTC 600 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 541 CAGTCCGAGAAGTACACCACCAGCTTTTGGGTTATCTTCTTCTGTTTCTTCGTGCACTTC 600 Qy 601 CTGAACGGCCTGCTGATCAGACTGGCCGGCTTCCAGTTTCCATTCGCCAAGAGCAAGGAC 660 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 601 CTGAACGGCCTGCTGATCAGACTGGCCGGCTTCCAGTTTCCATTCGCCAAGAGCAAGGAC 660 Qy 661 GCCGAAACCACAAACGTGGCCGCCGATCTGATGTAC 696 |||||||||||||||||||||||||||||||||||| Db 661 GCCGAAACCACAAACGTGGCCGCCGATCTGATGTAC 696 The App307 claims do not recite that the kit (App307 Claim 14) comprises a pre-loaded syringe. However, US952 teaches (Col 11 L3-15) a kit that comprises nucleic acid compounds within a container of solution and that the kit can comprise a pre-loaded syringe comprising the compounds. An artisan would have put their compounds into a kit comprising a pre-loaded syringe for the benefit of ensuring that the recipient has the exact dosage ready to administer and because doing so would have prevented any complications that arise from mixing a solution and then getting the mixed solution into a syringe. The App307 claims don’t recite AAV2 or delivering to a retinal cell but WO900 teaches (¶10-11) treating retinal cells and (¶72) AAV2. Therefore the instant claims would have been obvious in view of App307 claims and US952 and WO900, and the methods of the instant claims could not be used without the composition and methods of App307 claims and US952. The App307 claims encompass the invention of the instant claims. This is a provisional nonstatutory double patenting rejection because the patentably indistinct claims have not in fact been patented. Claims 259-260 are provisionally rejected on the ground of nonstatutory double patenting as being unpatentable over claims 8-10, 12-13, 17, 87, 91-92, 106, 109, 113-114, 117-118, 120, 129, 131, 133, 142, 157, and 167 of copending Application No. 18314671 (reference application; “App671”; of record) and in view of International Publication Number WO900 (of record), NCBI (of record), Landegger (et al. 2017. A synthetic AAV vector enables safe and efficient gene transfer to the mammalian inner ear. Nat. Biotechnol. 35[3]:280-286, “Landegger”, of record on IDS), and Powell. This rejection is maintained and updated in response to the claim amendments. All references are of record. Although the claims at issue are not identical, they are not patentably distinct from each other because both claim sets are directed to methods and compositions of gene therapies for expressing a gene of interest in the inner ear to treat hearing loss. The instant claims recite a composition comprising an AAV nucleic acid vector wherein the vector comprises a 5’ ITR, a CMV enhancer, a CBA promoter, a chimeric intron, a 5’UTR, a coding sequence (CDS) encoding a CLRN1 protein according to SEQ ID NO 3, a 3’UTR, a polyA signal, and a 3’ITR; to an AAV2 capsid comprising the composition, to an Anc80 capsid comprising the composition; wherein the CDS comprises a nt sequence spanning 2 consecutive exons of CLRN1 genomic DNA and lacks an intron sequence between them. The App671 claims broadly recite an expression construct comprising a polynucleotide encoding a polypeptide linked to a promoter and methods of using the construct to treat hearing loss, an AAV particle comprising the vector. The App671 claims in combination with the prior art encompass the instant claims because the App671 claims require only an expression construct comprising a polynucleotide encoding a polypeptide operably linked to a specific promoter and the instant claims recite a vector comprising a CDS of a CLRN1 protein. The operably linked polynucleotide sequence of the App671 claims could be any operably linked polynucleotide sequence. Using the invention of the App671 claims to express the CLRN1 gene is an expressly disclosed embodiment of App671 (see ¶139). The AAV vector recited in the instant claims is a kind of expression construct. Other App671 claims recite methods of expressing the polypeptide or increasing expression of the polypeptide in the ear, which also encompasses the instant claims. Furthermore, the App671 claims specify promoters that include a vimentin promoter and insulin promoter; both of these kinds of promoter are expressly disclosed embodiments of the instant invention (pp. 118-121 L1-7) and NCBI teaches the sequence of at least App671 SEQ ID NO 57. App671 does not teach instant SEQ ID NO 3 but WO900 teaches SEQ ID NO 2 which encodes the product of instant SEQ ID NO 3. WO900 teaches (¶99) an rAAV vector comprising the CLRN1 cDNA including the 5’ and 3’UTRs, and teaches driving it with the chicken β-actin promoter. WO900 teaches (¶10-11) treating retinal cells. Therefore it would have been obvious to use WO900’s SEQ ID NO 2 with the expression construct of App671 in order to express CLRN1 which, as stated, is an expressly disclosed embodiment of App671. Doing so would have produced the instant invention. Using WO900’s sequence and teachings with the invention recited in the App671 claims would have provided a benefit of treating hearing or vision loss. The App671 claims do not recite a CMV enhancer, a chimeric intron, or that the polyA signal is a bovine growth hormone polyA signal. Landegger teaches (§Abstract) an Anc80 vector for transgene delivery to the cochlea. Landegger teaches the vector is well tolerated and targets outer hair cells at high rates. Powell teaches (§Polyadenylation Signal Sequences and Upstream Enhancer) one study, in human epithelial-like cells, found that a transgene had a 2.5-fold increase in expression with … bovine growth hormone polyA (bGHpA) signal sequences compared to a minimal synthetic polyA (SPA) signal. Powell teaches (§CMV Enhancer) the CMV enhancer increases transgene expression under different cell-specific promoters and different cell types making it a broadly applicable tool to increase transgene expression levels. Powell teaches (§Introns) the presence of an intron or intervening sequence in mRNA was first described, in vitro, to be important for mRNA processing and increased transgene expression… and … a hybrid intron (adenovirus/mouse immunoglobulin) increased transgene expression by 1.6-fold. Powell’s Table 3 shows that chimeric introns could improve expression, depending on the intron. A hybrid intron is simply another term for a chimeric intron. Altogether, Powell teaches that each of those elements—a CMV enhancer, a chimeric intron, and a bovine growth hormone polyA signal—can increase transgene expression. It would have been obvious to a person of ordinary skill in the art before the effective filing date of the instant invention to modify the compositions and methods of the App671 claims and WO900 with the CMV enhancer, chimeric intron, and bovine growth hormone polyA signal of Powell for the benefit of improving transgene expression. One would have been motivated to do so with a reasonable expectation of success because Powell teaches that each element improves transgene expression in gene therapy. It would have been obvious to use Landegger’s Anc80 vector because it is well tolerated. Therefore, the instant claims would have been obvious in view of the App671 claims and the prior art of WO900, Landegger, and Powell. This is a provisional nonstatutory double patenting rejection. Claims 259-260 are provisionally rejected on the ground of nonstatutory double patenting as being unpatentable over claims 1, 4, 10-12, 14, 21, 24, 26, 31-32, 34, 36, 38-39, 42-46, 48, 51, 54-55, 57, 70, and 78 of copending Application No. 18697425 (reference application; “App425”) in view of WO900 and Powell. This rejection is maintained and updated in response to the claim amendments. All references are of record. Although the claims at issue are not identical, they are not patentably distinct from each other because both claim sets are directed to methods and compositions of gene therapies for expressing a CLRN1 in the cochlea to treat hearing loss. The instant claims recite a composition comprising an AAV nucleic acid vector wherein the vector comprises a 5’ ITR, a CMV enhancer, a CBA promoter, a chimeric intron, a 5’UTR, a coding sequence (CDS) encoding a CLRN1 protein according to SEQ ID NO 3, a 3’UTR, a polyA signal, and a 3’ITR; to an AAV2 capsid comprising the composition, to an Anc80 capsid comprising the composition; wherein the CDS comprises a nt sequence spanning 2 consecutive exons of CLRN1 genomic DNA and lacks an intron sequence between them. The App425 claims are broadly directed to a construct comprising a polynucleotide encoding a polypeptide linked to a promoter which expresses the polynucleotide in an outer hair cell, wherein the promoter can be an OCM or prestin promoter and wherein the polynucleotide can encode CLRN1, the vector can be AAV, and to methods of using the construct to treat hearing loss. The broad App425 claims read on the instant claims because the App425 claims require only an expression construct comprising a polynucleotide encoding a polypeptide operably linked to a specific promoter, wherein the gene can be CLRN1 (see Claim 12), and the instant claims recite an AAV vector comprising a CDS of a CLRN1 protein, and an AAV particle that can comprise an AAV capsid wherein the capsid can be an AAV2 capsid or an Anc80 capsid. An OCM or prestin promoter are (p. 121 L1-5) explicitly disclosed embodiments of the instant Spec. The operably linked polynucleotide sequence of the App425 claims could be any operably linked polynucleotide sequence and App425 Claim 12 explicitly recites CLRN1. The outer hair cell of the App425 claims is located within the cochlea. App425 does not teach a chicken β-actin promoter or claimed SEQ ID NO 3 but WO900 teaches SEQ ID NO 2 which encodes the product of instant SEQ ID NO 3 and (¶99) the CLRN1 cDNA comprises the 5’ and 3’UTRs, and teaches driving it with the chicken β-actin promoter. WO900 teaches (¶10-11) treating retinal cells. Powell teaches (§Polyadenylation Signal Sequences and Upstream Enhancer) one study, in human epithelial-like cells, found that a transgene had a 2.5-fold increase in expression with … bovine growth hormone polyA (bGHpA) signal sequences compared to a minimal synthetic polyA (SPA) signal. Powell teaches (§CMV Enhancer) the CMV enhancer increases transgene expression under different cell-specific promoters and different cell types making it a broadly applicable tool to increase transgene expression levels. Powell teaches (§Introns) the presence of an intron or intervening sequence in mRNA was first described, in vitro, to be important for mRNA processing and increased transgene expression… and … a hybrid intron (adenovirus/mouse immunoglobulin) increased transgene expression by 1.6-fold. Powell’s Table 3 shows that chimeric introns could improve expression, depending on the intron. A hybrid intron is simply another term for a chimeric intron. Altogether, Powell teaches that each of those elements—a CMV enhancer, a chimeric intron, and a bovine growth hormone polyA signal—can increase transgene expression. It would have been obvious to a person of ordinary skill in the art before the effective filing date of the instant invention to modify the compositions and methods of the App425 claims with the CBA-driven CLRN1 of WO900 and with the CMV enhancer, chimeric intron, and bovine growth hormone polyA signal of Powell for the benefits of improving transgene expression. One would have been motivated to do so with a reasonable expectation of success because Powell teaches that each element improves transgene expression in gene therapy. Therefore it would have been obvious to use the expression construct of the App425 claims and WO900’s SEQ ID NO 2 and additional components of Powell in order to express CLRN11. Doing so would have produced the instant invention. Using WO900’s sequence and teachings with the invention recited in the App425 claims would have provided a benefit of treating hearing or vision loss. The instant claims would have been obvious in view of the App425 claims, WO900, and Powell. This is a provisional nonstatutory double patenting rejection. Claims 229-232, 247-254, and 259-270 are provisionally rejected on the ground of nonstatutory double patenting as being unpatentable over claims 1-28, 32-34, 37, 41-42, 44-46, 48-51, 53-124, 127, 131-132, 134-136, 138-141, 143-199 of copending Application No. 18866969 (reference application; “App969”) in view of WO900, Powell, App178, and US952. This rejection is maintained and updated in response to the claim amendments. All supporting references are of record. Although the claims at issue are not identical, they are directed to overlapping subject matter because the instant claims recite a composition comprising an AAV nucleic acid vector wherein the vector comprises a 5’ ITR, a CMV enhancer, a CBA promoter, a chimeric intron according to SEQ ID NO 16, a 5’UTR, a coding sequence (CDS) encoding a CLRN1 protein according to SEQ ID NO 3, a 3’UTR, a polyA signal, and a 3’ITR, wherein the CDS comprises a nt sequence spanning 2 consecutive exons of CLRN1 genomic DNA and lacks an intron sequence between them; wherein the composition can comprise other components such as SEQ ID NOs 17 or 20; to the composition comprising an excipient; to an AAV2 capsid comprising the composition, to an Anc80 capsid comprising the composition; to a kit comprising the composition; and to methods of introducing it to a cochlea of a mammal that can be a human who can have been previously identified as having a defective endogenous CLRN1 gene; to methods of increasing CLRN1 expression in the ear or eye; and to methods of treating hearing or vision loss. The copending App969 claims are drawn to a plurality of recombinant AAV vectors: a first vector comprising first expression cassette comprising a promoter operably linked to a nucleic acid sequence comprising an otoferlin gene, wherein the cassette is flanked by ITRs, and wherein the expression cassette can have a sequence with at least 70% identity to SEQ ID NO 96; wherein the promoter can be a CBA promoter or a CMV promoter, and to a second vector that can comprise a polyA sequence including a bovine polyA sequence; wherein each of the vectors is encapsulated by an AAV capsid having a certain serotype, wherein the capsid can be an AAV2 capsid or an Anc80 capsid, to a composition comprising the vectors, wherein the composition can be formulated for intra-cochlear administration, to a method of expressing a recombinant full-length otoferlin protein in a mammalian cell, and/or to methods of treating hearing loss by administering the vectors into the cochlea of a subject; wherein the composition can be administered by a single injection to an inner ear cell, to a kit comprising a preloaded syringe comprising the composition, Both claim sets are directed to AAV vectors for treating hearing loss in a mammal or human by administering the vector to the cochlea of the mammal/human. An artisan would not know what is App969 SEQ ID NO 96 so they would consult the App969 Spec. and SEQ listing and find (pp. 104-113) SEQ ID NO 96 comprises two ITRs (a 5’ ITR and a 3’ITR), a CAG promoter comprising: a CMV enhancer, chicken β-actin gene sequence, and a chimeric intron comprising SEQ ID NO 100. App969 SEQ ID NO 96 comprises claimed SEQ ID NOs 16 and 17 as shown by the following alignments: US-18-866-969-96 Filing date in PALM: N/A Sequence 96, US/18866969 GENERAL INFORMATION APPLICANT: AKOUOS, INC. (en) TITLE OF INVENTION: COMPOSITIONS AND METHODS FOR TREATING NON-AGE-ASSOCIATED HEARING IMPAIRMENT IN A HUMAN SUBJECT (en) FILE REFERENCE: 4833.0170001 CURRENT APPLICATION NUMBER: US/18/866,969 CURRENT FILING DATE: 2024-11-18 NUMBER OF SEQ ID NOS: 110 SEQ ID NO 96 LENGTH: 4744 TYPE: DNA FEATURE: NAME/KEY: misc_feature LOCATION: 1..4744 QUALIFIERS: note = Synthetic Polynucleotide FEATURE: NAME/KEY: source LOCATION: 1..4744 QUALIFIERS: mol_type = other DNA organism = synthetic construct Query Match 100.0%; Score 1013; Length 4744; Best Local Similarity 100.0%; Matches 1013; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 GGAGTCGCTGCGTTGCCTTCGCCCCGTGCCCCGCTCCGCGCCGCCTCGCGCCGCCCGCCC 60 SEQ ID NO 16 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 828 GGAGTCGCTGCGTTGCCTTCGCCCCGTGCCCCGCTCCGCGCCGCCTCGCGCCGCCCGCCC 887 SEQ ID NO 96 Qy 61 CGGCTCTGACTGACCGCGTTACTCCCACAGGTGAGCGGGCGGGACGGCCCTTCTCCTCCG 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 888 CGGCTCTGACTGACCGCGTTACTCCCACAGGTGAGCGGGCGGGACGGCCCTTCTCCTCCG 947 Qy 121 GGCTGTAATTAGCGCTTGGTTTAATGACGGCTCGTTTCTTTTCTGTGGCTGCGTGAAAGC 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 948 GGCTGTAATTAGCGCTTGGTTTAATGACGGCTCGTTTCTTTTCTGTGGCTGCGTGAAAGC 1007 Qy 181 CTTAAAGGGCTCCGGGAGGGCCCTTTGTGCGGGGGGGAGCGGCTCGGGGGGTGCGTGCGT 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1008 CTTAAAGGGCTCCGGGAGGGCCCTTTGTGCGGGGGGGAGCGGCTCGGGGGGTGCGTGCGT 1067 Qy 241 GTGTGTGTGCGTGGGGAGCGCCGCGTGCGGCCCGCGCTGCCCGGCGGCTGTGAGCGCTGC 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1068 GTGTGTGTGCGTGGGGAGCGCCGCGTGCGGCCCGCGCTGCCCGGCGGCTGTGAGCGCTGC 1127 Qy 301 GGGCGCGGCGCGGGGCTTTGTGCGCTCCGCGTGTGCGCGAGGGGAGCGCGGCCGGGGGCG 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1128 GGGCGCGGCGCGGGGCTTTGTGCGCTCCGCGTGTGCGCGAGGGGAGCGCGGCCGGGGGCG 1187 Qy 361 GTGCCCCGCGGTGCGGGGGGGCTGCGAGGGGAACAAAGGCTGCGTGCGGGGTGTGTGCGT 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1188 GTGCCCCGCGGTGCGGGGGGGCTGCGAGGGGAACAAAGGCTGCGTGCGGGGTGTGTGCGT 1247 Qy 421 GGGGGGGTGAGCAGGGGGTGTGGGCGCGGCGGTCGGGCTGTAACCCCCCCCTGCACCCCC 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1248 GGGGGGGTGAGCAGGGGGTGTGGGCGCGGCGGTCGGGCTGTAACCCCCCCCTGCACCCCC 1307 Qy 481 CTCCCCGAGTTGCTGAGCACGGCCCGGCTTCGGGTGCGGGGCTCCGTGCGGGGCGTGGCG 540 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1308 CTCCCCGAGTTGCTGAGCACGGCCCGGCTTCGGGTGCGGGGCTCCGTGCGGGGCGTGGCG 1367 Qy 541 CGGGGCTCGCCGTGCCGGGCGGGGGGTGGCGGCAGGTGGGGGTGCCGGGCGGGGCGGGGC 600 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1368 CGGGGCTCGCCGTGCCGGGCGGGGGGTGGCGGCAGGTGGGGGTGCCGGGCGGGGCGGGGC 1427 Qy 601 CGCCTCGGGCCGGGGAGGGCTCGGGGGAGGGGCGCGGCGGCCCCCGGAGCGCCGGCGGCT 660 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1428 CGCCTCGGGCCGGGGAGGGCTCGGGGGAGGGGCGCGGCGGCCCCCGGAGCGCCGGCGGCT 1487 Qy 661 GTCGAGGCGCGGCGAGCCGCAGCCATTGCCTTTTATGGTAATCGTGCGAGAGGGCGCAGG 720 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1488 GTCGAGGCGCGGCGAGCCGCAGCCATTGCCTTTTATGGTAATCGTGCGAGAGGGCGCAGG 1547 Qy 721 GACTTCCTTTGTCCCAAATCTGTGCGGAGCCGAAATCTGGGAGGCGCCGCCGCACCCCCT 780 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1548 GACTTCCTTTGTCCCAAATCTGTGCGGAGCCGAAATCTGGGAGGCGCCGCCGCACCCCCT 1607 Qy 781 CTAGCGGGCGCGGGGCGAAGCGGTGCGGCGCCGGCAGGAAGGAAATGGGCGGGGAGGGCC 840 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1608 CTAGCGGGCGCGGGGCGAAGCGGTGCGGCGCCGGCAGGAAGGAAATGGGCGGGGAGGGCC 1667 Qy 841 TTCGTGCGTCGCCGCGCCGCCGTCCCCTTCTCCCTCTCCAGCCTCGGGGCTGTCCGCGGG 900 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1668 TTCGTGCGTCGCCGCGCCGCCGTCCCCTTCTCCCTCTCCAGCCTCGGGGCTGTCCGCGGG 1727 Qy 901 GGGACGGCTGCCTTCGGGGGGGACGGGGCAGGGCGGGGTTCGGCTTCTGGCGTGTGACCG 960 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1728 GGGACGGCTGCCTTCGGGGGGGACGGGGCAGGGCGGGGTTCGGCTTCTGGCGTGTGACCG 1787 Qy 961 GCGGCTCTAGAGCCTCTGCTAACCATGTTCATGCCTTCTTCTTTTTCCTACAG 1013 ||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1788 GCGGCTCTAGAGCCTCTGCTAACCATGTTCATGCCTTCTTCTTTTTCCTACAG 1840 SEQ ID NO 17 RESULT 1 US-18-866-969-96 Query Match 100.0%; Score 380; DB 1; Length 4744; Best Local Similarity 100.0%; Matches 380; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 GACATTGATTATTGACTAGTTATTAATAGTAATCAATTACGGGGTCATTAGTTCATAGCC 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 168 GACATTGATTATTGACTAGTTATTAATAGTAATCAATTACGGGGTCATTAGTTCATAGCC 227 Qy 61 CATATATGGAGTTCCGCGTTACATAACTTACGGTAAATGGCCCGCCTGGCTGACCGCCCA 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 228 CATATATGGAGTTCCGCGTTACATAACTTACGGTAAATGGCCCGCCTGGCTGACCGCCCA 287 Qy 121 ACGACCCCCGCCCATTGACGTCAATAATGACGTATGTTCCCATAGTAACGCCAATAGGGA 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 288 ACGACCCCCGCCCATTGACGTCAATAATGACGTATGTTCCCATAGTAACGCCAATAGGGA 347 Qy 181 CTTTCCATTGACGTCAATGGGTGGACTATTTACGGTAAACTGCCCACTTGGCAGTACATC 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 348 CTTTCCATTGACGTCAATGGGTGGACTATTTACGGTAAACTGCCCACTTGGCAGTACATC 407 Qy 241 AAGTGTATCATATGCCAAGTACGCCCCCTATTGACGTCAATGACGGTAAATGGCCCGCCT 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 408 AAGTGTATCATATGCCAAGTACGCCCCCTATTGACGTCAATGACGGTAAATGGCCCGCCT 467 Qy 301 GGCATTATGCCCAGTACATGACCTTATGGGACTTTCCTACTTGGCAGTACATCTACGTAT 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 468 GGCATTATGCCCAGTACATGACCTTATGGGACTTTCCTACTTGGCAGTACATCTACGTAT 527 Qy 361 TAGTCATCGCTATTACCATG 380 |||||||||||||||||||| Db 528 TAGTCATCGCTATTACCATG 547 Therefore the copending App969 claims recite sequences that encompass claimed SEQ ID NOs 16 and 17. Therefore the copending App969 claims recite elements (i), (ii), (iii), (iv), and (ix) of the claimed invention. Then the other prior art teaches the other claim elements that the App969 claims do not recite: WO900 teaches (¶99) an rAAV vector comprising the CLRN1 cDNA including the 5’ and 3’UTRs, and teaches driving it with the chicken β-actin promoter. WO900 teaches (¶9-10) the polynucleotide (polynt) can include a sequence having SEQ ID NO 2 (which it specifies comprises a 5’UTR and 3’UTR) and can be included on a vector that can be an adeno-associated viral vector (AAV) that can be used for transfecting ocular cells or cells of the inner ear. WO900 teaches (¶10-11) treating retinal cells. WO900 SEQ ID NO 2 comprises a polynt comprising a sequence encoding the amino acid sequence of instant SEQ ID NO 3 (which has been back-translated from AA[Wingdings font/0xE0]nucleotides). This is shown by the following sequence alignment: RESULT 7 BDA01054 ID BDA01054 standard; cDNA; 2352 BP. XX AC BDA01054; XX DT 16-JUN-2016 (first entry) XX DE Human derived clarin-1 (CLRN1) polynucleotide SEQ ID NO:2. XX KW CLRN1 gene; auditory; clarin-1; gene therapy; hearing loss; KW ophthalmological; ss; therapeutic; usher syndrome iii; vision disorder. XX OS Homo sapiens. XX CC PN WO2016073900-A1. XX CC PD 12-MAY-2016. XX CC PF 06-NOV-2015; 2015WO-US059546. XX PR 06-NOV-2014; 2014US-0076114P. PR 08-MAY-2015; 2015US-0158846P. XX CC PA (UCWR ) UNIV CASE WESTERN RESERVE. XX CC PI Alagramam KN; XX DR WPI; 2016-282935/37. XX CC PT New polynucleotide comprising a nucleic acid sequence that includes a CC PT cDNA coding sequence of a clarin-1 gene, useful for treating vision CC PT and/or hearing loss associated with Usher syndrome III. XX CC PS Claim 9; SEQ ID NO 2; 43pp; English. XX CC The invention relates to a novel polynucleotide, used for treating vision CC and/or hearing loss associated with Usher syndrome III. This CC polynucleotide comprises a nucleic acid sequence that includes a cDNA CC coding sequence of a clarin-1 (CLRN1) gene and a 3' untranslated region CC (UTR) nucleic acid that is derived from the 3' UTR of the clarin-1 gene, CC where the 3' UTR nucleic acid enhances expression of clarin-1 in a cell CC transfected with the polynucleotide compared to a cell transfected with a CC similar polynucleotide devoid of the 3' UTR nucleic acid. The invention CC further claims: a nucleic acid construct comprising a polynucleotide CC defined above; a vector for transfecting a cell, comprising a CC polynucleotide defined above, where the transfected cell expresses clarin CC -1; and a method of treating vision and/or hearing loss associated with CC Usher syndrome III in a subject by administering to the ocular cells CC and/or cells of the inner ear of the subject, a vector that promotes CC expression of clarin-1 in the cells. The present sequence is a clarin-1 CC polynucleotide, used for treating vision and/or hearing loss associated CC with Usher syndrome III in a subject. XX SQ Sequence 2352 BP; 705 A; 475 C; 484 G; 688 T; 0 U; 0 Other; Alignment Scores: Length: 2352 Score: 1214.00 Matches: 232 Percent Similarity: 100.0% Conservative: 0 Best Local Similarity: 100.0% Mismatches: 0 Query Match: 100.0% Indels: 0 Gaps: 0 US-17-253-658-3 (1-232) x BDA01054 (1-2352) Qy 1 MetProSerGlnGlnLysLysIleIlePheCysMetAlaGlyValPheSerPheAlaCys 20 SEQ ID NO 3 translated[Wingdings font/0xE0]NT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 282 ATGCCAAGCCAACAGAAGAAAATCATTTTTTGCATGGCCGGAGTGTTCAGTTTTGCATGT 341 WO900 SEQ ID NO 2 Qy 21 AlaLeuGlyValValThrAlaLeuGlyThrProLeuTrpIleLysAlaThrValLeuCys 40 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 342 GCCCTCGGAGTTGTGACAGCCTTGGGGACACCGTTGTGGATCAAAGCCACTGTCCTCTGC 401 Qy 41 LysThrGlyAlaLeuLeuValAsnAlaSerGlyGlnGluLeuAspLysPheMetGlyGlu 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 402 AAAACGGGAGCTCTGCTCGTCAATGCCTCAGGGCAGGAGCTGGACAAGTTTATGGGTGAA 461 Qy 61 MetGlnTyrGlyLeuPheHisGlyGluGlyValArgGlnCysGlyLeuGlyAlaArgPro 80 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 462 ATGCAGTACGGGCTTTTCCACGGAGAGGGTGTGAGGCAGTGTGGGTTGGGAGCAAGGCCC 521 Qy 81 PheArgPheSerPhePheProAspLeuLeuLysAlaIleProValSerIleHisValAsn 100 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 522 TTTCGGTTCTCATTTTTTCCAGATTTGCTCAAAGCAATCCCAGTGAGCATCCACGTCAAT 581 Qy 101 ValIleLeuPheSerAlaIleLeuIleValLeuThrMetValGlyThrAlaPhePheMet 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 582 GTCATTCTCTTCTCTGCCATCCTTATTGTGTTAACCATGGTGGGGACAGCCTTCTTCATG 641 Qy 121 TyrAsnAlaPheGlyLysProPheGluThrLeuHisGlyProLeuGlyLeuTyrLeuLeu 140 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 642 TACAATGCTTTTGGAAAACCTTTTGAAACTCTGCATGGTCCCCTAGGGCTGTACCTTTTG 701 Qy 141 SerPheIleSerGlySerCysGlyCysLeuValMetIleLeuPheAlaSerGluValLys 160 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 702 AGCTTCATTTCAGGCTCCTGTGGCTGTCTTGTCATGATATTGTTTGCCTCTGAAGTGAAA 761 Qy 161 IleHisHisLeuSerGluLysIleAlaAsnTyrLysGluGlyThrTyrValTyrLysThr 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 762 ATCCATCACCTCTCAGAAAAAATTGCAAATTATAAAGAAGGGACTTATGTCTACAAAACG 821 Qy 181 GlnSerGluLysTyrThrThrSerPheTrpValIlePhePheCysPhePheValHisPhe 200 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 822 CAAAGTGAAAAATATACCACCTCATTCTGGGTCATTTTCTTTTGCTTTTTTGTTCATTTT 881 Qy 201 LeuAsnGlyLeuLeuIleArgLeuAlaGlyPheGlnPheProPheAlaLysSerLysAsp 220 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 882 CTGAATGGGCTCCTAATACGACTTGCTGGATTTCAGTTCCCTTTTGCAAAATCTAAAGAC 941 Qy 221 AlaGluThrThrAsnValAlaAlaAspLeuMetTyr 232 |||||||||||||||||||||||||||||||||||| Db 942 GCAGAAACAACTAATGTAGCTGCAGATCTAATGTAC 977 That alignment shows that the composition of WO900 comprises SEQ ID NO 3 itself, a 5’UTR, and a 3’UTR. Those are elements (v), (vi), and (vii) of the instant claims. Powell teaches (§Polyadenylation Signal Sequences and Upstream Enhancer) one study, in human epithelial-like cells, found that a transgene had a 2.5-fold increase in expression with … bovine growth hormone polyA (bGHpA) signal sequences compared to a minimal synthetic polyA (SPA) signal. App178 teaches SEQ ID NO 30 which comprises a bovine growth hormone polyA signal and is 100% identical to instant SEQ ID NO 20, as shown by the following sequence alignment: RESULT 1 AXQ64086 (NOTE: this sequence has 272 duplicates in the database searched. See complete list at the end of this report) ID AXQ64086 standard; DNA; 225 BP. XX AC AXQ64086; XX DT 29-OCT-2009 (first entry) XX DE BGH polyA Yes1 supplementary expression cassette 3' UTR, SEQ:30 #2. XX KW 3'-utr; Yes1; dna cassette; gene expression; gene silencing; KW protein production; rna interference; ss. XX OS Bos taurus. OS Synthetic. XX CC PN US2009215178-A1. XX CC PD 27-AUG-2009. XX CC PF 22-FEB-2008; 2008US-00035437. XX PR 22-FEB-2008; 2008US-00035437. XX CC PA (TANG/) TANG Z. XX CC PI Tang Z; XX DR WPI; 2009-M96179/59. XX CC PT Generating cell clones with stable transgene (Gene of Interest (GOI)) CC PT expression comprises inactivation of endogenous essential genes of cell CC PT substrate and trans-complementation of essential genes products. XX CC PS Example 3; SEQ ID NO 30; 9pp; English. XX CC The present invention relates to a method for generating cell clones with CC stable transgene (Gene Of Interest (GOI)) expression. The method of the CC invention comprises: (i) inactivation of endogenous essential genes of CC cell substrate through Gene Inactivation Cassettes (GIC), (ii) trans- CC complementation of essential gene products through Gene Supplementary CC Cassettes (GSC), alternatively, the cassette codes for the gene product CC that is capable of inactivating GIC function, (iii) the GOI expression CC cassettes are preferably, physically linked to GSC to take advantage of CC favourable selective pressure, (iv) GIC could be preferably physically CC linked to GSC and GOI expression cassettes, where the endogenous CC essential genes of cell substrate refer to genes or combination of genes CC that are essential for cell survival and / or cell proliferation. The GIC CC comprises a vector comprising a promoter operably linked to RNA CC interference, RNAi (shRNA) / dsRNA / ribozyme molecule, or tandem repeats CC of such transcript units, targeted to cell endogenous essential mRNA. The CC invention provides strategies for increasing the productivity of CC recombinant protein expression in isogenic cell-lines, and a novel CC selection system for the improved stability and homogeneity of transgene CC expression in isogenic cells without dependence on continuous selective CC drugs. An example of the invention provides an essential gene knock-down CC cassette, targeted at 3' UTR of human endogenous Yes1 gene, and a CC supplementary Yes1 expression cassette which uses a 3' UTR from bovine CC growth hormone (BGH) polyA. The present sequence is a bovine growth CC hormone (BGH) polyA Yes1 supplementary expression cassette 3' UTR, used CC in an example of the invention. Note: This version of SEQ ID 30 is given CC in example 3, but it is not the same as the sequence referred to as SEQ CC ID 30 (seeAXQ61560) in the sequence listing. XX SQ Sequence 225 BP; 41 A; 53 C; 72 G; 59 T; 0 U; 0 Other; Query Match 100.0%; Score 225; Length 225; Best Local Similarity 100.0%; Matches 225; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 CTGTGCCTTCTAGTTGCCAGCCATCTGTTGTTTGCCCCTCCCCCGTGCCTTCCTTGACCC 60 SEQ ID NO 20 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 CTGTGCCTTCTAGTTGCCAGCCATCTGTTGTTTGCCCCTCCCCCGTGCCTTCCTTGACCC 60 Prior art SEQ Qy 61 TGGAAGGTGCCACTCCCACTGTCCTTTCCTAATAAAATGAGGAAATTGCATCGCATTGTC 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 TGGAAGGTGCCACTCCCACTGTCCTTTCCTAATAAAATGAGGAAATTGCATCGCATTGTC 120 Qy 121 TGAGTAGGTGTCATTCTATTCTGGGGGGTGGGGTGGGGCAGGACAGCAAGGGGGAGGATT 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 TGAGTAGGTGTCATTCTATTCTGGGGGGTGGGGTGGGGCAGGACAGCAAGGGGGAGGATT 180 Qy 181 GGGAAGACAATAGCAGGCATGCTGGGGATGCGGTGGGCTCTATGG 225 ||||||||||||||||||||||||||||||||||||||||||||| Db 181 GGGAAGACAATAGCAGGCATGCTGGGGATGCGGTGGGCTCTATGG 225 A poly-A sequence comprising SEQ ID NO 20 is component (viii) of the instant claims. It would have been obvious to an artisan before the effective filing date of the claimed invention to modify the invention of the App969 claims with the sequence encoding CLRN1 of WO900 and the teachings about a polyA sequence of Powell and App178 for the benefits of using the App969 vectors to treat Usher syndrome and to increase transgene expression. One would have been motivated to do so with a reasonable expectation of success because Powell teaches that a bovine growth hormone polyA signal can increase transgene expression. One would have been motivated to do so with a reasonable expectation of success because WO900 teaches (¶3-4) expressing CLRN1 had known usage in treating Usher syndrome, including (¶11) for both hearing and vision losses, and it would have been a simple matter to swap the sequence encoding CLRN1 of WO900 for the sequence encoding otoferlin of the App969 claims. An artisan would have known that they need only use one AAV vector to encode CLRN1 because WO900 teaches (¶99, 108-111) the entire mCLRN1 cDNA was placed on a single AAV vector, indicating the entire CLRN1 cDNA could fit on a single AAV vector. They would have been motivated to use a single vector because it is simpler to administer a single vector gene therapy than a dual vector gene therapy. US952 teaches (Col 11 L3-15) a kit that comprises nucleic acid compounds within a container of solution and that the kit can comprise a pre-loaded syringe comprising the compounds. An artisan would have put their compounds into a kit comprising a pre-loaded syringe for the benefit of ensuring that the recipient has the exact dosage ready to administer and because doing so would have prevented any complications that arise from mixing a solution and then getting the mixed solution into a syringe. Therefore the instant claims would have been obvious in view of the App969 claims, WO900, Powell, App178, and US952. This is a provisional nonstatutory double patenting rejection. Claims 229-232, 247-254, and 259-270 are provisionally rejected on the ground of nonstatutory double patenting as being unpatentable over claims 44, 49-56, 58-61, 66-77 of copending Application No. 19098662 (“App662”) in view of WO900, Powell, and US952. This rejection is maintained and updated in response to the claim amendments. All supporting references are of record. Although the claims at issue are not identical, they are directed to overlapping subject matter because the instant claims recite a composition comprising an AAV nucleic acid vector wherein the vector comprises a 5’ ITR, a CMV enhancer, a CBA promoter, a chimeric intron according to SEQ ID NO 16, a 5’UTR, a coding sequence (CDS) encoding a CLRN1 protein according to SEQ ID NO 3, a 3’UTR, a polyA signal, and a 3’ITR, wherein the CDS comprises a nt sequence spanning 2 consecutive exons of CLRN1 genomic DNA and lacks an intron sequence between them; wherein the composition can comprise other components such as SEQ ID NOs 17 or 20; to the composition comprising an excipient; to an AAV2 capsid comprising the composition, to an Anc80 capsid comprising the composition; to a kit comprising the composition; and to methods of introducing it to a cochlea of a mammal that can be a human who can have been previously identified as having a defective endogenous CLRN1 gene; to methods of increasing CLRN1 expression in the ear or eye; and to methods of treating hearing or vision loss. The App662 claims are drawn to a plurality of recombinant AAV vectors: a first vector comprising a 5’ITR, a 3’ITR, a CAG promoter comprising SEQ ID NO 61, and a second vector that can comprise a bovine polyA signal, wherein each of the vectors is encapsulated by an AAV capsid having a certain serotype, wherein the capsid can be an AAV2 or Anc80 capsid, to a composition comprising the vectors, wherein the composition can be formulated for intra-cochlear administration. Both claim sets are directed to AAV vectors for administering a gene therapy to the cochlea. An artisan would not know what is US191 SEQ ID NO 61 so they would consult the App662 Spec. and SEQ listing and find (p. 121; SEQ listing) SEQ ID NO 61 comprises a CAG promoter comprising: a CMV enhancer, chicken β-actin gene sequence, and a chimeric intron. App662 SEQ ID NO 61 comprises claimed SEQ ID NOs 16 and 17 as shown by the following alignments: US-19-098-662-61 Filing date in PALM: N/A Sequence 61, US/19098662 GENERAL INFORMATION APPLICANT: AKOUOS, INC. (en) TITLE OF INVENTION: COMPOSITIONS AND METHODS FOR TREATING NON-AGE-ASSOCIATED HEARING IMPAIRMENT IN A HUMAN SUBJECT (en) FILE REFERENCE: 4833.0050005 CURRENT APPLICATION NUMBER: US/19/098,662 CURRENT FILING DATE: 2025-04-02 NUMBER OF SEQ ID NOS: 110 SEQ ID NO 61 LENGTH: 1671 TYPE: DNA FEATURE: NAME/KEY: source LOCATION: 1..1671 QUALIFIERS: mol_type = other DNA organism = synthetic construct ALIGNMENT: Query Match 100.0%; Score 1013; Length 1671; Best Local Similarity 100.0%; Matches 1013; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 GGAGTCGCTGCGTTGCCTTCGCCCCGTGCCCCGCTCCGCGCCGCCTCGCGCCGCCCGCCC 60 SEQ ID NO 16 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 659 GGAGTCGCTGCGTTGCCTTCGCCCCGTGCCCCGCTCCGCGCCGCCTCGCGCCGCCCGCCC 718 SEQ ID NO 61 Qy 61 CGGCTCTGACTGACCGCGTTACTCCCACAGGTGAGCGGGCGGGACGGCCCTTCTCCTCCG 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 719 CGGCTCTGACTGACCGCGTTACTCCCACAGGTGAGCGGGCGGGACGGCCCTTCTCCTCCG 778 Qy 121 GGCTGTAATTAGCGCTTGGTTTAATGACGGCTCGTTTCTTTTCTGTGGCTGCGTGAAAGC 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 779 GGCTGTAATTAGCGCTTGGTTTAATGACGGCTCGTTTCTTTTCTGTGGCTGCGTGAAAGC 838 Qy 181 CTTAAAGGGCTCCGGGAGGGCCCTTTGTGCGGGGGGGAGCGGCTCGGGGGGTGCGTGCGT 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 839 CTTAAAGGGCTCCGGGAGGGCCCTTTGTGCGGGGGGGAGCGGCTCGGGGGGTGCGTGCGT 898 Qy 241 GTGTGTGTGCGTGGGGAGCGCCGCGTGCGGCCCGCGCTGCCCGGCGGCTGTGAGCGCTGC 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 899 GTGTGTGTGCGTGGGGAGCGCCGCGTGCGGCCCGCGCTGCCCGGCGGCTGTGAGCGCTGC 958 Qy 301 GGGCGCGGCGCGGGGCTTTGTGCGCTCCGCGTGTGCGCGAGGGGAGCGCGGCCGGGGGCG 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 959 GGGCGCGGCGCGGGGCTTTGTGCGCTCCGCGTGTGCGCGAGGGGAGCGCGGCCGGGGGCG 1018 Qy 361 GTGCCCCGCGGTGCGGGGGGGCTGCGAGGGGAACAAAGGCTGCGTGCGGGGTGTGTGCGT 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1019 GTGCCCCGCGGTGCGGGGGGGCTGCGAGGGGAACAAAGGCTGCGTGCGGGGTGTGTGCGT 1078 Qy 421 GGGGGGGTGAGCAGGGGGTGTGGGCGCGGCGGTCGGGCTGTAACCCCCCCCTGCACCCCC 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1079 GGGGGGGTGAGCAGGGGGTGTGGGCGCGGCGGTCGGGCTGTAACCCCCCCCTGCACCCCC 1138 Qy 481 CTCCCCGAGTTGCTGAGCACGGCCCGGCTTCGGGTGCGGGGCTCCGTGCGGGGCGTGGCG 540 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1139 CTCCCCGAGTTGCTGAGCACGGCCCGGCTTCGGGTGCGGGGCTCCGTGCGGGGCGTGGCG 1198 Qy 541 CGGGGCTCGCCGTGCCGGGCGGGGGGTGGCGGCAGGTGGGGGTGCCGGGCGGGGCGGGGC 600 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1199 CGGGGCTCGCCGTGCCGGGCGGGGGGTGGCGGCAGGTGGGGGTGCCGGGCGGGGCGGGGC 1258 Qy 601 CGCCTCGGGCCGGGGAGGGCTCGGGGGAGGGGCGCGGCGGCCCCCGGAGCGCCGGCGGCT 660 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1259 CGCCTCGGGCCGGGGAGGGCTCGGGGGAGGGGCGCGGCGGCCCCCGGAGCGCCGGCGGCT 1318 Qy 661 GTCGAGGCGCGGCGAGCCGCAGCCATTGCCTTTTATGGTAATCGTGCGAGAGGGCGCAGG 720 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1319 GTCGAGGCGCGGCGAGCCGCAGCCATTGCCTTTTATGGTAATCGTGCGAGAGGGCGCAGG 1378 Qy 721 GACTTCCTTTGTCCCAAATCTGTGCGGAGCCGAAATCTGGGAGGCGCCGCCGCACCCCCT 780 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1379 GACTTCCTTTGTCCCAAATCTGTGCGGAGCCGAAATCTGGGAGGCGCCGCCGCACCCCCT 1438 Qy 781 CTAGCGGGCGCGGGGCGAAGCGGTGCGGCGCCGGCAGGAAGGAAATGGGCGGGGAGGGCC 840 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1439 CTAGCGGGCGCGGGGCGAAGCGGTGCGGCGCCGGCAGGAAGGAAATGGGCGGGGAGGGCC 1498 Qy 841 TTCGTGCGTCGCCGCGCCGCCGTCCCCTTCTCCCTCTCCAGCCTCGGGGCTGTCCGCGGG 900 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1499 TTCGTGCGTCGCCGCGCCGCCGTCCCCTTCTCCCTCTCCAGCCTCGGGGCTGTCCGCGGG 1558 Qy 901 GGGACGGCTGCCTTCGGGGGGGACGGGGCAGGGCGGGGTTCGGCTTCTGGCGTGTGACCG 960 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1559 GGGACGGCTGCCTTCGGGGGGGACGGGGCAGGGCGGGGTTCGGCTTCTGGCGTGTGACCG 1618 Qy 961 GCGGCTCTAGAGCCTCTGCTAACCATGTTCATGCCTTCTTCTTTTTCCTACAG 1013 ||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1619 GCGGCTCTAGAGCCTCTGCTAACCATGTTCATGCCTTCTTCTTTTTCCTACAG 1671 SEQ ID NO 17 Query Match 100.0%; Score 380; DB 1; Length 1671; Best Local Similarity 100.0%; Matches 380; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 GACATTGATTATTGACTAGTTATTAATAGTAATCAATTACGGGGTCATTAGTTCATAGCC 60 SEQ ID NO 17 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 GACATTGATTATTGACTAGTTATTAATAGTAATCAATTACGGGGTCATTAGTTCATAGCC 60 SEQ ID NO 61 Qy 61 CATATATGGAGTTCCGCGTTACATAACTTACGGTAAATGGCCCGCCTGGCTGACCGCCCA 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 CATATATGGAGTTCCGCGTTACATAACTTACGGTAAATGGCCCGCCTGGCTGACCGCCCA 120 Qy 121 ACGACCCCCGCCCATTGACGTCAATAATGACGTATGTTCCCATAGTAACGCCAATAGGGA 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 ACGACCCCCGCCCATTGACGTCAATAATGACGTATGTTCCCATAGTAACGCCAATAGGGA 180 Qy 181 CTTTCCATTGACGTCAATGGGTGGACTATTTACGGTAAACTGCCCACTTGGCAGTACATC 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 CTTTCCATTGACGTCAATGGGTGGACTATTTACGGTAAACTGCCCACTTGGCAGTACATC 240 Qy 241 AAGTGTATCATATGCCAAGTACGCCCCCTATTGACGTCAATGACGGTAAATGGCCCGCCT 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 AAGTGTATCATATGCCAAGTACGCCCCCTATTGACGTCAATGACGGTAAATGGCCCGCCT 300 Qy 301 GGCATTATGCCCAGTACATGACCTTATGGGACTTTCCTACTTGGCAGTACATCTACGTAT 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 GGCATTATGCCCAGTACATGACCTTATGGGACTTTCCTACTTGGCAGTACATCTACGTAT 360 Qy 361 TAGTCATCGCTATTACCATG 380 |||||||||||||||||||| Db 361 TAGTCATCGCTATTACCATG 380 Furthermore, App662 Claim 49 (and others) recite a polyA sequence that has SEQ ID NO 108. That is 100% identical to claimed SEQ ID NO 20 as shown by the following alignment: RESULT 1 US-19-098-662-108 Query Match 100.0%; Score 225; DB 1; Length 225; Best Local Similarity 100.0%; Matches 225; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 CTGTGCCTTCTAGTTGCCAGCCATCTGTTGTTTGCCCCTCCCCCGTGCCTTCCTTGACCC 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 CTGTGCCTTCTAGTTGCCAGCCATCTGTTGTTTGCCCCTCCCCCGTGCCTTCCTTGACCC 60 Qy 61 TGGAAGGTGCCACTCCCACTGTCCTTTCCTAATAAAATGAGGAAATTGCATCGCATTGTC 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 TGGAAGGTGCCACTCCCACTGTCCTTTCCTAATAAAATGAGGAAATTGCATCGCATTGTC 120 Qy 121 TGAGTAGGTGTCATTCTATTCTGGGGGGTGGGGTGGGGCAGGACAGCAAGGGGGAGGATT 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 TGAGTAGGTGTCATTCTATTCTGGGGGGTGGGGTGGGGCAGGACAGCAAGGGGGAGGATT 180 Qy 181 GGGAAGACAATAGCAGGCATGCTGGGGATGCGGTGGGCTCTATGG 225 ||||||||||||||||||||||||||||||||||||||||||||| Db 181 GGGAAGACAATAGCAGGCATGCTGGGGATGCGGTGGGCTCTATGG 225 Therefore the copending App662 claims recite elements (i), (ii), (iii), (iv), (viii), and (ix) of the claimed invention. Then the other prior art teaches the other claim elements that the App662 claims do not recite: WO900 teaches an rAAV vector comprising the CLRN1 cDNA including the 5’ and 3’UTRs. WO900 teaches (¶9-10) the polynucleotide (polynt) can include a sequence having SEQ ID NO 2 (which it specifies comprises a 5’UTR and 3’UTR) and can be included on a vector that can be an adeno-associated viral vector (AAV) that can be used for transfecting ocular cells or cells of the inner ear. WO900 teaches (¶21) that the heterologous polynucleotide comprised in the AAV vector is flanked by at least one, and generally by two AAV inverted terminal repeat sequence (ITRs); an artisan would realize that being flanked by two ITRs refers to one ITR on either side, which is a 5’ITR and a 3’ITR. WO900 teaches (¶10-11) treating retinal cells. WO900 SEQ ID NO 2 comprises a polynt comprising a sequence encoding the amino acid sequence of instant SEQ ID NO 3 (which has been back-translated from AA[Wingdings font/0xE0]nucleotides). This is shown by the following sequence alignment: RESULT 7 BDA01054 ID BDA01054 standard; cDNA; 2352 BP. XX AC BDA01054; XX DT 16-JUN-2016 (first entry) XX DE Human derived clarin-1 (CLRN1) polynucleotide SEQ ID NO:2. XX KW CLRN1 gene; auditory; clarin-1; gene therapy; hearing loss; KW ophthalmological; ss; therapeutic; usher syndrome iii; vision disorder. XX OS Homo sapiens. XX CC PN WO2016073900-A1. XX CC PD 12-MAY-2016. XX CC PF 06-NOV-2015; 2015WO-US059546. XX PR 06-NOV-2014; 2014US-0076114P. PR 08-MAY-2015; 2015US-0158846P. XX CC PA (UCWR ) UNIV CASE WESTERN RESERVE. XX CC PI Alagramam KN; XX DR WPI; 2016-282935/37. XX CC PT New polynucleotide comprising a nucleic acid sequence that includes a CC PT cDNA coding sequence of a clarin-1 gene, useful for treating vision CC PT and/or hearing loss associated with Usher syndrome III. XX CC PS Claim 9; SEQ ID NO 2; 43pp; English. XX CC The invention relates to a novel polynucleotide, used for treating vision CC and/or hearing loss associated with Usher syndrome III. This CC polynucleotide comprises a nucleic acid sequence that includes a cDNA CC coding sequence of a clarin-1 (CLRN1) gene and a 3' untranslated region CC (UTR) nucleic acid that is derived from the 3' UTR of the clarin-1 gene, CC where the 3' UTR nucleic acid enhances expression of clarin-1 in a cell CC transfected with the polynucleotide compared to a cell transfected with a CC similar polynucleotide devoid of the 3' UTR nucleic acid. The invention CC further claims: a nucleic acid construct comprising a polynucleotide CC defined above; a vector for transfecting a cell, comprising a CC polynucleotide defined above, where the transfected cell expresses clarin CC -1; and a method of treating vision and/or hearing loss associated with CC Usher syndrome III in a subject by administering to the ocular cells CC and/or cells of the inner ear of the subject, a vector that promotes CC expression of clarin-1 in the cells. The present sequence is a clarin-1 CC polynucleotide, used for treating vision and/or hearing loss associated CC with Usher syndrome III in a subject. XX SQ Sequence 2352 BP; 705 A; 475 C; 484 G; 688 T; 0 U; 0 Other; Alignment Scores: Length: 2352 Score: 1214.00 Matches: 232 Percent Similarity: 100.0% Conservative: 0 Best Local Similarity: 100.0% Mismatches: 0 Query Match: 100.0% Indels: 0 Gaps: 0 US-17-253-658-3 (1-232) x BDA01054 (1-2352) Qy 1 MetProSerGlnGlnLysLysIleIlePheCysMetAlaGlyValPheSerPheAlaCys 20 SEQ ID NO 3 translated[Wingdings font/0xE0]NT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 282 ATGCCAAGCCAACAGAAGAAAATCATTTTTTGCATGGCCGGAGTGTTCAGTTTTGCATGT 341 WO900 SEQ ID NO 2 Qy 21 AlaLeuGlyValValThrAlaLeuGlyThrProLeuTrpIleLysAlaThrValLeuCys 40 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 342 GCCCTCGGAGTTGTGACAGCCTTGGGGACACCGTTGTGGATCAAAGCCACTGTCCTCTGC 401 Qy 41 LysThrGlyAlaLeuLeuValAsnAlaSerGlyGlnGluLeuAspLysPheMetGlyGlu 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 402 AAAACGGGAGCTCTGCTCGTCAATGCCTCAGGGCAGGAGCTGGACAAGTTTATGGGTGAA 461 Qy 61 MetGlnTyrGlyLeuPheHisGlyGluGlyValArgGlnCysGlyLeuGlyAlaArgPro 80 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 462 ATGCAGTACGGGCTTTTCCACGGAGAGGGTGTGAGGCAGTGTGGGTTGGGAGCAAGGCCC 521 Qy 81 PheArgPheSerPhePheProAspLeuLeuLysAlaIleProValSerIleHisValAsn 100 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 522 TTTCGGTTCTCATTTTTTCCAGATTTGCTCAAAGCAATCCCAGTGAGCATCCACGTCAAT 581 Qy 101 ValIleLeuPheSerAlaIleLeuIleValLeuThrMetValGlyThrAlaPhePheMet 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 582 GTCATTCTCTTCTCTGCCATCCTTATTGTGTTAACCATGGTGGGGACAGCCTTCTTCATG 641 Qy 121 TyrAsnAlaPheGlyLysProPheGluThrLeuHisGlyProLeuGlyLeuTyrLeuLeu 140 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 642 TACAATGCTTTTGGAAAACCTTTTGAAACTCTGCATGGTCCCCTAGGGCTGTACCTTTTG 701 Qy 141 SerPheIleSerGlySerCysGlyCysLeuValMetIleLeuPheAlaSerGluValLys 160 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 702 AGCTTCATTTCAGGCTCCTGTGGCTGTCTTGTCATGATATTGTTTGCCTCTGAAGTGAAA 761 Qy 161 IleHisHisLeuSerGluLysIleAlaAsnTyrLysGluGlyThrTyrValTyrLysThr 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 762 ATCCATCACCTCTCAGAAAAAATTGCAAATTATAAAGAAGGGACTTATGTCTACAAAACG 821 Qy 181 GlnSerGluLysTyrThrThrSerPheTrpValIlePhePheCysPhePheValHisPhe 200 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 822 CAAAGTGAAAAATATACCACCTCATTCTGGGTCATTTTCTTTTGCTTTTTTGTTCATTTT 881 Qy 201 LeuAsnGlyLeuLeuIleArgLeuAlaGlyPheGlnPheProPheAlaLysSerLysAsp 220 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 882 CTGAATGGGCTCCTAATACGACTTGCTGGATTTCAGTTCCCTTTTGCAAAATCTAAAGAC 941 Qy 221 AlaGluThrThrAsnValAlaAlaAspLeuMetTyr 232 |||||||||||||||||||||||||||||||||||| Db 942 GCAGAAACAACTAATGTAGCTGCAGATCTAATGTAC 977 That alignment shows that the composition of WO900 comprises SEQ ID NO 3 itself, a 5’UTR, and a 3’UTR. Those are elements (v), (vi), and (vii) of the instant claims. Powell teaches (§Polyadenylation Signal Sequences and Upstream Enhancer) one study, in human epithelial-like cells, found that a transgene had a 2.5-fold increase in expression with … bovine growth hormone polyA (bGHpA) signal sequences compared to a minimal synthetic polyA (SPA) signal. It would have been obvious to an artisan before the effective filing date of the claimed invention to modify the invention of the App662 claims with the sequence encoding CLRN1 of WO900 and teachings of Powell for the benefits of using the App662 vectors to treat Usher syndrome and to increase transgene expression. One would have been motivated to do so with a reasonable expectation of success because WO900 teaches (¶3-4) expressing CLRN1 had known usage in treating Usher syndrome, including (¶11) for both hearing and vision losses, and it would have been a simple matter to swap the sequence encoding CLRN1 of WO900 for the sequence encoding otoferlin of App662 . An artisan would know that they need only use one AAV vector to encode CLRN1 because WO900 teaches (¶99, 108-111) the entire mCLRN1 cDNA was placed on a single AAV vector, indicating the entire CLRN1 cDNA could fit on a single AAV vector. They would have been motivated to use a single vector because it is simpler to administer a single vector gene therapy than a dual vector gene therapy. Using the bovine growth hormone polyA signal of App178 would have been of benefit based on the teachings of Powell. US952 teaches (Col 11 L3-15) a kit that comprises nucleic acid compounds within a container of solution and that the kit can comprise a pre-loaded syringe comprising the compounds. An artisan would have put their compounds into a kit comprising a pre-loaded syringe for the benefit of ensuring that the recipient has the exact dosage ready to administer and because doing so would have prevented any complications that arise from mixing a solution and then getting the mixed solution into a syringe. Therefore the instant claims would have been obvious in view of the App662 claims, WO900, Powell, and US952. This is a provisional nonstatutory double patenting rejection. Potentially Allowable Subject Matter SEQ ID NO 16 was searched and found to be nonobvious over the prior art of record within the context of Claims 229, 232, and 259. International Patent Application Publication No WO2011061937 (“WO937”) teaches SEQ ID NOs 10, 13, 18, and 20 which are promoters that comprise instant SEQ ID NO 16. An alignment of SEQ ID NO 16 with WO937’s SEQ ID NO 20 is shown here: RESULT 70 AZI43343 ID AZI43343 standard; DNA; 6871 BP. XX AC AZI43343; XX DT 07-JUL-2011 (first entry) XX DE Gallus gallus antibody variable light chain targeting vector 2, SEQ 20. XX KW antibody production; ds; recombinant dna; recombination. XX OS Unidentified. XX FH Key Location/Qualifiers FT sig_peptide 1869..1914 FT /*tag= a FT /product= "Antibody variable region signal peptide" FT intron 1915..2039 FT /*tag= b FT sig_peptide 2040..2056 FT /*tag= c FT /product= "Antibody variable region signal peptide" FT misc_feature 2076..2109 FT /*tag= d FT /note= "LoxP_LE" FT promoter 2137..3478 FT /*tag= e FT /note= "Marker gene promoter" FT misc_feature 3967..4953 FT /*tag= f FT /note= "marker gene" FT /note= "Poly A additon of marker gene" FT misc_feature 4960..4993 FT /*tag= g FT /note= "LoxP_RE" FT misc_feature 5002..6861 FT /*tag= h FT /note= "3' homologous DNA of antibody variable region" XX CC PN WO2011061937-A1. XX CC PD 26-MAY-2011. XX CC PF 18-NOV-2010; 2010WO-JP006759. XX PR 19-NOV-2009; 2009JP-00264398. PR 20-NOV-2009; 2009US-0263285P. XX CC PA (IMMU-) IMMUNO TEC LAB CO LTD. XX CC PI Fujii S, Kanayama N, Ohmori H; XX DR WPI; 2011-F88240/36. XX CC PT Homologously recombining a DNA construct and a region comprising a DNA CC PT encoding an antibody variable region of an antibody-producing cell by CC PT introducing into the antibody-producing cell a targeting vector. XX CC PS Example; SEQ ID NO 20; 121pp; English. XX CC The present invention relates to a method for homologously recombining a CC DNA construct and a region comprising a DNA encoding an antibody variable CC region of an antibody-producing cell which comprises introducing into an CC antibody-producing cell a targeting vector comprising a DNA construct CC that comprises: (a) a promoter DNA that functions in the cell; (b) a DNA CC that encodes a desired amino acid sequence; and (c) a DNA that inhibits CC the production of a polypeptide comprising the desired amino acid CC sequence, and can be removed from the DNA construct. The invention also CC includes: (1) a method for selecting a cell; (2) a method for producing CC an antibody-producing cell or polypeptide that produces a polypeptide CC into which a mutation is introduced; (3) a method for producing a DNA CC encoding a polypeptide or a polypeptide into which a mutation is CC introduced; (4) an antibody-producing cell in which a region comprising a CC DNA encoding an antibody variable region is homologously recombined with CC a DNA construct; (5) a kit comprising the cell and targeting vector; and CC (6) a gene targeting vector comprising the DNA construct. The methods of CC the invention are useful for targeting vectors for introducing a DNA CC encoding a desired amino acid sequence into the antibody variable region CC gene locus of an antibody producing cells. The present sequence is a CC Gallus gallus antibody variable light chain targeting vector 2 which is CC used to allow insertion of a foreign antibody variable region gene CC immediately after the signal peptide, the nucleotide sequence of the end CC of the signal peptide is modified to have an SphI site. XX SQ Sequence 6871 BP; 1609 A; 1538 C; 1907 G; 1817 T; 0 U; 0 Other; Query Match 100.0%; Score 1013; Length 6871; Best Local Similarity 100.0%; Matches 1013; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 GGAGTCGCTGCGTTGCCTTCGCCCCGTGCCCCGCTCCGCGCCGCCTCGCGCCGCCCGCCC 60 SEQ ID NO 16 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 2408 GGAGTCGCTGCGTTGCCTTCGCCCCGTGCCCCGCTCCGCGCCGCCTCGCGCCGCCCGCCC 2467 prior art SEQ Qy 61 CGGCTCTGACTGACCGCGTTACTCCCACAGGTGAGCGGGCGGGACGGCCCTTCTCCTCCG 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 2468 CGGCTCTGACTGACCGCGTTACTCCCACAGGTGAGCGGGCGGGACGGCCCTTCTCCTCCG 2527 Qy 121 GGCTGTAATTAGCGCTTGGTTTAATGACGGCTCGTTTCTTTTCTGTGGCTGCGTGAAAGC 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 2528 GGCTGTAATTAGCGCTTGGTTTAATGACGGCTCGTTTCTTTTCTGTGGCTGCGTGAAAGC 2587 Qy 181 CTTAAAGGGCTCCGGGAGGGCCCTTTGTGCGGGGGGGAGCGGCTCGGGGGGTGCGTGCGT 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 2588 CTTAAAGGGCTCCGGGAGGGCCCTTTGTGCGGGGGGGAGCGGCTCGGGGGGTGCGTGCGT 2647 Qy 241 GTGTGTGTGCGTGGGGAGCGCCGCGTGCGGCCCGCGCTGCCCGGCGGCTGTGAGCGCTGC 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 2648 GTGTGTGTGCGTGGGGAGCGCCGCGTGCGGCCCGCGCTGCCCGGCGGCTGTGAGCGCTGC 2707 Qy 301 GGGCGCGGCGCGGGGCTTTGTGCGCTCCGCGTGTGCGCGAGGGGAGCGCGGCCGGGGGCG 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 2708 GGGCGCGGCGCGGGGCTTTGTGCGCTCCGCGTGTGCGCGAGGGGAGCGCGGCCGGGGGCG 2767 Qy 361 GTGCCCCGCGGTGCGGGGGGGCTGCGAGGGGAACAAAGGCTGCGTGCGGGGTGTGTGCGT 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 2768 GTGCCCCGCGGTGCGGGGGGGCTGCGAGGGGAACAAAGGCTGCGTGCGGGGTGTGTGCGT 2827 Qy 421 GGGGGGGTGAGCAGGGGGTGTGGGCGCGGCGGTCGGGCTGTAACCCCCCCCTGCACCCCC 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 2828 GGGGGGGTGAGCAGGGGGTGTGGGCGCGGCGGTCGGGCTGTAACCCCCCCCTGCACCCCC 2887 Qy 481 CTCCCCGAGTTGCTGAGCACGGCCCGGCTTCGGGTGCGGGGCTCCGTGCGGGGCGTGGCG 540 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 2888 CTCCCCGAGTTGCTGAGCACGGCCCGGCTTCGGGTGCGGGGCTCCGTGCGGGGCGTGGCG 2947 Qy 541 CGGGGCTCGCCGTGCCGGGCGGGGGGTGGCGGCAGGTGGGGGTGCCGGGCGGGGCGGGGC 600 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 2948 CGGGGCTCGCCGTGCCGGGCGGGGGGTGGCGGCAGGTGGGGGTGCCGGGCGGGGCGGGGC 3007 Qy 601 CGCCTCGGGCCGGGGAGGGCTCGGGGGAGGGGCGCGGCGGCCCCCGGAGCGCCGGCGGCT 660 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3008 CGCCTCGGGCCGGGGAGGGCTCGGGGGAGGGGCGCGGCGGCCCCCGGAGCGCCGGCGGCT 3067 Qy 661 GTCGAGGCGCGGCGAGCCGCAGCCATTGCCTTTTATGGTAATCGTGCGAGAGGGCGCAGG 720 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3068 GTCGAGGCGCGGCGAGCCGCAGCCATTGCCTTTTATGGTAATCGTGCGAGAGGGCGCAGG 3127 Qy 721 GACTTCCTTTGTCCCAAATCTGTGCGGAGCCGAAATCTGGGAGGCGCCGCCGCACCCCCT 780 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3128 GACTTCCTTTGTCCCAAATCTGTGCGGAGCCGAAATCTGGGAGGCGCCGCCGCACCCCCT 3187 Qy 781 CTAGCGGGCGCGGGGCGAAGCGGTGCGGCGCCGGCAGGAAGGAAATGGGCGGGGAGGGCC 840 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3188 CTAGCGGGCGCGGGGCGAAGCGGTGCGGCGCCGGCAGGAAGGAAATGGGCGGGGAGGGCC 3247 Qy 841 TTCGTGCGTCGCCGCGCCGCCGTCCCCTTCTCCCTCTCCAGCCTCGGGGCTGTCCGCGGG 900 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3248 TTCGTGCGTCGCCGCGCCGCCGTCCCCTTCTCCCTCTCCAGCCTCGGGGCTGTCCGCGGG 3307 Qy 901 GGGACGGCTGCCTTCGGGGGGGACGGGGCAGGGCGGGGTTCGGCTTCTGGCGTGTGACCG 960 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3308 GGGACGGCTGCCTTCGGGGGGGACGGGGCAGGGCGGGGTTCGGCTTCTGGCGTGTGACCG 3367 Qy 961 GCGGCTCTAGAGCCTCTGCTAACCATGTTCATGCCTTCTTCTTTTTCCTACAG 1013 ||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3368 GCGGCTCTAGAGCCTCTGCTAACCATGTTCATGCCTTCTTCTTTTTCCTACAG 3420 However, WO937 provides no reason for an artisan to choose specifically bp 2408-3420 from SEQ ID NO 20, bp 2417-3429 from SEQ ID NO 18, bp 3233-4245 from SEQ ID NO 13, 3244-4256 from SEQ ID NO 10 and use them in the instant invention. Response to Arguments Applicant's arguments filed 10 October 2025 have been fully considered but they are not persuasive. Each rejection is addressed below. Arguments that are no longer relevant are not addressed. NSDP rejections Regarding the NSDP rejections, Applicant has disagreed with them because, they argue (pp. 10-14) the instantly claimed invention is filed earlier than any of the reference applications. That is not found persuasive because NSDP rejections over other applications and issued patents is necessary. The claims of issued US Patents US867, US773, and US191 and copending applications App969 and App662 disclose vector sequences that comprise claimed SEQ ID NO 16 and all of the other claim elements would have been obvious in view of the cited prior art. Furthermore, it would have been obvious to an artisan to use a single vector to express CLRN1 because the prior art (i.e., WO900) discloses single AAV vectors for expressing CLRN1 and because it is simpler to administer a single vector gene therapy rather than a dual vector gene therapy. For example, WO900 teaches (¶85) vectors can be associated with immunogenic response and although AAV presents low risk for pathogenic reactions, (¶82) therapeutic effects must be balanced with toxic or detrimental effects from a vector. Since the art teaches that expressing CLRN1 requires only a single AAV vector, an artisan would have found it obvious and beneficial to do so. The other prior art teaches the other elements of the claimed invention: WO900 teaches a nt sequence encoding 5’- and 3’-UTRs and claimed SEQ ID NO 3. WO900 teaches administration to retinal cells. Landegger teaches administering an Anc80 serotype. Powell teaches benefits of using a polyA signal and App178 teaches the polyA sequence that is claimed SEQ ID NO 20. US952 teaches a kit that comprises a pre-loaded syringe. Regarding App095 (now issued as US Pat. No. 12365726), those claims are broadly directed to an AAV particle wherein the nucleic acid construct comprises SEQ ID NOs 91 or 92. As discussed in the NSDP rejection, those SEQ ID NOs comprise claimed SEQ ID NOs 16, 17, and 20. Like the other NSDP rejections, the other cited prior art teaches the remaining claim limitations that the reference application claims do not teach. It would have been obvious to swap the CLRN1 sequence of WO900 for the coding sequences within SEQ ID NOs 91 or 92. Regarding the copending applications, MPEP §804(I)(B)(1)(b)(i) does not yet apply because those NSDP rejections are not the sole rejections remaining; there are NSDP rejections over issued patents. Regarding App266, those claims are broadly directed to a construct for expressing a coding sequence of a secreted target protein. The App266 claims recite a chimeric intron sequence that is the same as claimed SEQ ID NO 16 and a CVM enhancer that is the same as claimed SEQ ID NO 17. There is no reason why an artisan could not use the construct of App266 claims to express any protein, including the CLRN1 protein of WO900. Regarding App131, those claims are very broadly directed to a construct or AAV particle comprising SEQ ID NO 333 which, as discussed, comprises many of the instantly claimed elements, including SEQ ID NOs 16 and 17. Like the other NSDP rejections, the other cited prior art teaches the remaining claim limitations that the reference application claims do not teach and it would have been obvious to swap the CLRN1 sequence of WO900 for the coding sequences within SEQ ID NO 333. Regarding App307, the NSDP rejection explains that those claims recite all the elements of the claimed invention besides for the kit and preloaded syringe. Regarding App671 and App425, the NSDP rejections explain that those claims are broadly directed to AAV expression constructs for hearing loss would have made instant claims 259-260 obvious in view of the cited prior art. In each case it would have been obvious to use the sequence encoding a CLRN1 protein of WO900 with the patented/copending inventions because WO900 teaches (¶3-4) expressing CLRN1 had known usage in treating Usher syndrome, including (¶11) for both hearing and vision losses, and it would have been a simple matter to swap the sequence encoding CLRN1 of WO900 for the sequences of the patented/copending claims. Applicant argues (pp. 10-11) the rejections over the issued patents should be removed because double patenting is to avoid an unjustified extension or improper timewise extension of the right to exclude granted by a patent. Applicant argues that the granted patents have a later expiration date than the instant claims would have if they were granted. Those arguments are not found persuasive. The following chart from MPEP 804 indicates than NSDP rejections should be made over the issued patents: PNG media_image1.png 2200 1700 media_image1.png Greyscale Note that withdrawal of an NSDP rejection when the application under examination has the earlier patent term filing date applies to provisional NSDP rejections, not rejections over issued patents: If a provisional nonstatutory double patenting rejection is the only rejection remaining in an application having the earlier patent term filing date, the examiner should withdraw the rejection in the application having the earlier patent term filing date and permit that application to issue as a patent, thereby converting the provisional nonstatutory double patenting rejection in the other application into a nonstatutory double patenting rejection upon issuance of the patent. [emphasis added.] MPEP 804(I)(B)(1)(b)(i) Furthermore, Applicant should note that the instant claims, if allowed, would improperly extend the "right to exclude" already granted in the issued patents. The subject matter claimed in the instant application would have been obvious in view of the issued patents and the prior art, as discussed in each NSDP rejection. Furthermore, there is no apparent reason why applicant was prevented from presenting claims corresponding to those of the instant application during prosecution of the applications which each matured into a patent. See In re Schneller, 397 F.2d 350, 158 USPQ 210 (CCPA 1968). See also MPEP § 804. Information in the § about Terminal Disclaimers touches on the right to exclude (MPEP 804.02[IV]): Each one of the commonly owned conflicting nonstatutory double patenting references must be included in the terminal disclaimer to avoid the problem of dual ownership of patents to patentably indistinct inventions in the event that the patent issuing from the application being examined ceases to be commonly owned with any one of the double patenting references that have issued or may issue as a patent. Note that 37 CFR 1.321(c)(3) requires that a terminal disclaimer for commonly owned conflicting claims "[i]nclude a provision that any patent granted on that application or any patent subject to the reexamination proceeding shall be enforceable only for and during such period that said patent is commonly owned with the application or patent which formed the basis for the judicially created double patenting." Filing a terminal disclaimer including each one of the conflicting nonstatutory double patenting references is also necessary to avoid the problem of separate enforcement of patents to patentably indistinct inventions by parties to a joint research agreement. MPEP 804.02(IV) Note that the only way to overcome the NSDP rejections over the issued US patents is with persuasive arguments or a terminal disclaimer (TD). Therefore all the NSDP rejections must be maintained until all the claims are ready to allow. The NSDP rejections over the issued patents must be maintained until they are either persuasively argued or a TD is filed. Conclusion Claims 229, 232, 257, and 259-270 are rejected. Applicant's amendment necessitated the new ground(s) of rejection presented in this Office action. Accordingly, THIS ACTION IS MADE FINAL. See MPEP § 706.07(a). Applicant is reminded of the extension of time policy as set forth in 37 CFR 1.136(a). A shortened statutory period for reply to this final action is set to expire THREE MONTHS from the mailing date of this action. In the event a first reply is filed within TWO MONTHS of the mailing date of this final action and the advisory action is not mailed until after the end of the THREE-MONTH shortened statutory period, then the shortened statutory period will expire on the date the advisory action is mailed, and any nonprovisional extension fee (37 CFR 1.17(a)) pursuant to 37 CFR 1.136(a) will be calculated from the mailing date of the advisory action. In no event, however, will the statutory period for reply expire later than SIX MONTHS from the mailing date of this final action. Any inquiry concerning this communication or earlier communications from the examiner should be directed to RUTHIE S ARIETI whose telephone number is (571)272-1293. The examiner can normally be reached M-Th 8:30AM-4PM, alternate Fridays 8:30AM-4PM (ET). Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Ram R Shukla can be reached on (571)272-0735. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. RUTHIE S ARIETI Examiner (Ruth.Arieti@uspto.gov) Art Unit 1635 /RUTH SOPHIA ARIETI/Examiner, Art Unit 1635 /NANCY J LEITH/Primary Examiner, Art Unit 1636
Read full office action

Prosecution Timeline

Dec 18, 2020
Application Filed
Feb 28, 2024
Non-Final Rejection — §DP
Jun 04, 2024
Response Filed
Sep 10, 2024
Final Rejection — §DP
Dec 13, 2024
Request for Continued Examination
Dec 18, 2024
Response after Non-Final Action
Jul 01, 2025
Non-Final Rejection — §DP
Oct 07, 2025
Response Filed
Dec 08, 2025
Examiner Interview (Telephonic)
Dec 15, 2025
Final Rejection — §DP (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12594349
COMPOSITIONS AND METHODS FOR THE TARGETING OF PCSK9
2y 5m to grant Granted Apr 07, 2026
Patent 12584134
COMPOSITION FOR REGULATING PRODUCTION OF INTERFERING RIBONUCLEIC ACID
2y 5m to grant Granted Mar 24, 2026
Patent 12540324
COMPOSITION FOR REGULATING PRODUCTION OF INTERFERING RIBONUCLEIC ACID
2y 5m to grant Granted Feb 03, 2026
Patent 12540326
COMPOSITION FOR REGULATING PRODUCTION OF INTERFERING RIBONUCLEIC ACID
2y 5m to grant Granted Feb 03, 2026
Patent 12534728
RNAi Agents for Inhibiting Expression of 17beta-HSD Type 13 (HSD17B13), Compositions Thereof, and Methods of Use
2y 5m to grant Granted Jan 27, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

AI Strategy Recommendation

Get an AI-powered prosecution strategy using examiner precedents, rejection analysis, and claim mapping.
Powered by AI — typically takes 5-10 seconds

Prosecution Projections

5-6
Expected OA Rounds
46%
Grant Probability
99%
With Interview (+72.7%)
2y 7m
Median Time to Grant
High
PTA Risk
Based on 81 resolved cases by this examiner. Grant probability derived from career allow rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month