Office Action Predictor
Application No. 17/354,442

Anti-Tumor Combination Therapy comprising Anti-CD19 Antibody and Polypeptides Blocking the SIRPalpha-CD47 Innate Immune Checkpoint

Final Rejection §103
Filed
Jun 22, 2021
Examiner
HALVORSON, MARK
Art Unit
1646
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
Gilead Sciences, INC.
OA Round
4 (Final)
48%
Grant Probability
Moderate
5-6
OA Rounds
3y 8m
To Grant
58%
With Interview

Examiner Intelligence

48%
Career Allow Rate
385 granted / 804 resolved
Without
With
+10.2%
Interview Lift
avg trend
3y 8m
Avg Prosecution
42 pending
846
Total Applications
career history

Statute-Specific Performance

§101
8.8%
-31.2% vs TC avg
§103
34.3%
-5.7% vs TC avg
§102
14.7%
-25.3% vs TC avg
§112
27.0%
-13.0% vs TC avg
Black line = Tech Center average estimate • Based on career data

Office Action

§103
DETAILED ACTION The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . Claims 4-6, 13, 14 and 16 are pending and under examination. 35 USC § 112 1st paragraph rejections withdrawn The rejection of claims 4-6 and 16 for failing to comply with the written requirement are withdrawn in view of Applicant’s amendment to the claims 35 USC § 103(a) rejections maintained The rejection of claims 4-6, 13,14 and 16 under 35 U.S.C. 103 as being unpatentable over Grosveld et al (US 2017/0081407, published March 23, 2017, IDS, cited previously) in view of Chu et al (US 8,063187, issued November 22, 2011), Bernett et al (US 8,524,867, issued September 3, 2013), Liu et al (US 9,017,675, issued April 28, 2015) and Frazier et al (US 10,669,336, issued January 2020) in further view of Xu et al (Biochim Biophys Res Comm 509:739-745, 2019, IDS) are maintained. Grosveld teach the treatment of lymphomas with the sequential or concurrent administration of a combination of anti-CD47 antibodies and anti-CD19 antibodies (paragraphs 52, 184-196). Grosveld does not specifically disclose the amino acid sequences of the listed anti-CD19 and anti-CD47 antibodies. Chu disclose anti-CD19 antibodies comprising a heavy chain variable region comprising an HCDR1 region comprising the sequence SYVMH (SEQ ID NO: 1), an HCDR2 region comprising the sequence NPYNDG (SEQ ID NO: 2), and an HCDR3 region comprising the sequence GTYYYGTRVFDY (SEQ ID NO: 3) and a light chain variable region comprising an LCDR1 region comprising the sequence RSSKSLQNVNGNTYL Y (SEQ ID NO: 4), an LCDR2 region comprising the sequence RMSNLNS (SEQ ID NO: 5), and an LCDR3 region comprising the sequence MQHLEYPIT (SEQ ID NO: 6) (see sequence comparison below). Chu discloses heavy chain variable domain comprising the amino acid sequence of SEQ ID No: 7 and the light chain variable domain comprising the amino acid sequence of SEQ ID Nos: 8 and the light chain comprising the amino acid sequence of 12 (see sequence comparisons below). Bernett discloses the light chain comprising the amino acid sequence of SEQ ID No: 11 (see sequence comparison below) that comprises the heavy chain variable domain comprising the amino acid sequence of SEQ ID Nos: 7 (see sequence comparisons below). Liu disclose anti-CD47 antibodies comprising a heavy chain variable region comprising an HCDR1 region comprising the sequence NYNMH (SEQ ID NO: 22), an HCDR2 region comprising the sequence TIYPGNDDTSYNQKFKD (SEQ ID NO: 23), and an HCDR3 region comprising the sequence GGYRAMDY (SEQ ID NO: 24) and a light chain variable region comprising an LCDR1 region comprising the sequence RSSQSIVYSNGNTYLG (SEQ ID NO: 25), an LCDR2 region comprising the sequence KVSNRFS (SEQ ID NO: 26), and an LCDR3 region comprising the sequence FQGSHVPYT (SEQ ID NO: 27) ( see sequence comparison below). Liu further disclose a heavy chain variable region comprising the amino acid sequence of SEQ ID NO:30 and a light chain variable region comprising the amino acid sequence of SEQ ID NO:31 (see sequence comparison below). Liu doesn’t disclose the constant regions of the heavy chain comprising the amino acid sequence of SEQ ID NO:34 and the constant region of the light chain comprising the amino acid sequence of SEQ ID NO:35. However, this was made up by Frazier who disclose the heavy chain comprising the amino acid sequence of SEQ ID NO:34 and the constant region of the light chain comprising the amino acid sequence of SEQ ID NO:35. One of ordinary skill in the art would have been motivated to apply Frazier’s heavy and light constant regions with Liu’s heavy and light chain variable regions because both Liu and Frazier disclose anti-CD47 antibodies. Absent unexpected results it would have been obvious to combine Liu’s heavy and light chain variable regions with Frazier’s heavy and light constant regions. Furthermore, it would have been obvious to apply the anti-CD19 antibodies of Chu and Bennett with Liu and Frazier’s anti-CD47 antibodies because in addition to Grosveld’s disclosure of the treatment of lymphoma with anti-CD47 and anti-CD19 antibodies, Xu discloses that anti-CD47 antibodies enhanced the effectiveness of a CD19/cd3 bispecific T cell engage antibody (page 740, 2nd column to page 742, 2nd column; Figures 1 and 2). Thus, all of the listed amino acid sequences of the heavy and light chains of the anti-CD19 and anti-CD47 antibodies were known in the art and there was ample motivation to combine the anti-CD19 and anti-CD47 antibodies to treat lymphoma in a subject. Applicant argues that the working examples of the present application describe experimental results for the combination of the anti-CD19 antibody MOR208 (also known as tafasitamab and Monjuvi®) and the anti-CD47 antibody magrolimab (5F9) and unexpected properties that the inventors found to be associated with this combination. Applicant argues that as described in the working examples of the present application, four B-cell lymphoma cell lines (Raji, RCK8, Toledo, and U2932) showed enhanced phagocytosis when treated with the combination of magrolimab (5F9) and tafasitamab (MOR208) as compared to treatment with either antibody alone (see Example 3 and Fig. 9). Applicant argues that nothing in the cited references would have led the person of ordinary skill in the art to expect the effects on phagocytosis of B cell lymphoma cells associated with the combination of the anti-CD19 antibody MOR208 and the anti-CD47 antibody magrolimab. The Office Action stated that "Xu discloses that anti-CD47 antibodies enhanced the effectiveness of a CD19/Cd3 bispecific T cell engage antibody." Applicant states that. Xu describes treatments with a CD19/CD3-Bispecific T cell Engager (blinatumomab), but not with a monospecific anti-CD19 antibody. Blinatumomab targets and kills B-cell leukemia cells by binding to CD19 on B-cell leukemia cells and CD3 on T cells and bringing the cells into close proximity so that the T cells can kill the leukemia cells. Applicant argues that given the CD3-dependent mechanism of action of blinatumomab, Xu would have given rise to no expectation as to how MOR208 (a monospecific anti-CD19 antibody at does not contain an anti-CD3-binding portion) would perform when used in combination with an anti-CD47 antibody. Applicant further argues that Xu assessed the ability of an anti-CD47 antibody and blinatumomab individually and in combination to enable phagocytosis of Raji cells (a human non-Hodgkin's lymphoma cell line). In this assay, Xu found that combining blinatumomab with the anti-CD47 antibody resulted in no enhancement of phagocytosis of Raji cells as compared to treatment with the anti-CD47 antibody alone Applicant argues that in the present application the inventors found that addition of tafasitamab (MOR208) to the anti-CD47 antibody magrolimab (5F9) resulted in enhanced phagocytosis of Raji cells as compared to treatment with magrolimab alone (see Fig. 9A of the present application). Applicant argues that nothing in Xu or any of the other cited references would have led the skilled person to expect the enhanced effect on phagocytosis associated with combined use of the antibodies recited in the claims. Applicant argues that because the enhanced effect on phagocytosis resulting from the combination of MOR00208 and the anti-CD47 antibody magrolimab (5F9) would have been unexpected to one of ordinary skill in the art at the time of filing of the present application, the experimental data contained in the application rebuts any possible prima facie case of obviousness and overcomes the rejection under 35 U.S.C. §103(a). Applicant’s arguments have been considered but are not persuasive. Grosveld teach the treatment of lymphomas with the sequential or concurrent administration of a combination of anti-CD47 antibodies and anti-CD19 antibodies (paragraphs 52, 184-196). As previously discussed, one of ordinary skill in the art would have been motivated to apply Frazier’s heavy and light constant regions with Liu’s heavy and light chain variable regions because both Liu and Frazier disclose anti-CD47 antibodies. Absent unexpected results it would have been obvious to combine Liu’s heavy and light chain variable regions with Frazier’s heavy and light constant regions. Given that Grosveld teach the administration of a combination of anti-CD47 antibodies and anti-CD19 antibodies Applicant must demonstrate that the particular combination of magrolimab (5F9) and tafasitamab exhibited unexpected results compared to combinations of other anti-CD47 antibodies and anti-CD19 antibodies. Neither Example 3 nor Fig. 9 disclose such results. In addition, as previously discussed it is not clear that the results from Figure 9 of the present application that the combination of B6H12 (the anti-CD47 antibody comprising a VH SEQ ID NO.20 and a VL of SEQ ID NO:21) (Table 2) and tafasitamab (anti-CD19 antibody) resulted in a synergistic effect or even a greater effect than the combination of other anti-CD47 antibodies and anti-CD19 antibodies. Wiesenthal (cited previously) states that most "classic" drug combinations are only additive or are, at most, minimally synergistic. In particular, Weisenthal states that combination chemotherapy frequently, but not always, has produced greater degrees of clinical benefit than single agent therapy.” Wiesenthal further states that most “classic” drug combinations are only additive or are at most, minimally synergistic. Berenbaum (cited previously) disclose that to demonstrate the synergistic effect of two treatment agents, one must first prepare a dose-response curve for each agent alone. The figures cited by Applicant appear to show additive effects of the claimed anti-CD47 antibodies and anti-CD19 antibodies. In response to Applicant’s argument that given the CD3-dependent mechanism of action of blinatumomab, Xu would have given rise to no expectation as to how MOR208 (a monospecific anti-CD19 antibody at does not contain an anti-CD3-binding portion) would perform when used in combination with an anti-CD47 antibody, in response to applicant's arguments against the Xu individually, one cannot show nonobviousness by attacking references individually where the rejections are based on combinations of references. See In re Keller, 642 F.2d 413, 208 USPQ 871 (CCPA 1981); In re Merck & Co., 800 F.2d 1091, 231 USPQ 375 (Fed. Cir. 1986). Grosveld teach the treatment of lymphomas with the sequential or concurrent administration of a combination of anti-CD47 antibodies and anti-CD19 antibodies. Absent unexpected results it would have been obvious to combine Liu’s heavy and light chain variable regions with Frazier’s heavy and light constant regions. Furthermore, Xu discloses that anti-CD47 antibodies enhanced the effectiveness of a CD19/cd3 bispecific T cell engage antibody which would provide motivation for combining the anti-CD47 antibodies and anti-CD19 antibodies. However, as previous discussed Grosveld teach the treatment of lymphomas with the sequential or concurrent administration of a combination of anti-CD47 antibodies and anti-CD19 antibodies. Applicant has not specifically demonstrated that treatment of lymphoma with the particular combination of claimed anti-CD47 antibodies and anti-CD19 antibodies was unexpected compared with other anti-CD47 antibodies and anti-CD19 antibodies. In addition, MPEP 2143.01 (I)states that The disclosure of desirable alternatives does not necessarily negate a suggestion for modifying the prior art to arrive at the claimed invention. In In re Fulton, 391 F.3d 1195, 73 USPQ2d 1141 (Fed. Cir. 2004), the claims of a utility patent application were directed to a shoe sole with increased traction having hexagonal projections in a "facing orientation." 391 F.3d at 1196-97, 73 USPQ2d at 1142. The Board combined a design patent having hexagonal projections in a facing orientation with a utility patent having other limitations of the independent claim. 391 F.3d at 1199, 73 USPQ2d at 1144. Applicant argued that the combination was improper because (1) the prior art did not suggest having the hexagonal projections in a facing (as opposed to a "pointing") orientation was the "most desirable" configuration for the projections, and (2) the prior art "taught away" by showing desirability of the "pointing orientation." 391 F.3d at 1200-01, 73 USPQ2d at 1145-46. The court stated that "the prior art’s mere disclosure of more than one alternative does not constitute a teaching away from any of these alternatives because such disclosure does not criticize, discredit, or otherwise discourage the solution claimed…." Id. In affirming the Board’s obviousness rejection, the court held that the prior art as a whole suggested the desirability of the combination of shoe sole limitations claimed, thus providing a motivation to combine, which need not be supported by a finding that the prior art suggested that the combination claimed by the applicant was the preferred, or most desirable combination over the other alternatives. Id. See also In re Urbanski, 809 F.3d 1237, 1244, 117 USPQ2d 1499, 1504 (Fed. Cir. 2016). Xu does not criticize, discredit, or otherwise discourage the use of a monomeric anti-CD19 antibody in combination with an anti-CD47 antibody for the treatment of a non-Hodgkin’s lymphoma. SEQ ID Nos: 2, 3, 4 US-12-156-183A-2 (NOTE: this sequence has 17 duplicates in the database searched. See complete list at the end of this report) Sequence 2, US/12156183A Patent No. 8063187 GENERAL INFORMATION APPLICANT: CHU, Seung Yup APPLICANT: DESJARLAIS, John R APPLICANT: KARKI, Sher Bahadur APPLICANT: LAZAR, Gregory Alan APPLICANT: MOORE, Gregory L. APPLICANT: VOSTIAR, Igor TITLE OF INVENTION: Methods and Compositions for Inhibiting CD32B Expressing Cells FILE REFERENCE: 190323/US/8 CURRENT APPLICATION NUMBER: US/12/156,183A CURRENT FILING DATE: 2009-01-21 PRIOR APPLICATION NUMBER: 60/940,776 PRIOR FILING DATE: 2007-05-30 PRIOR APPLICATION NUMBER: 60/953,174 PRIOR FILING DATE: 2007-07-31 PRIOR APPLICATION NUMBER: 60/970,413 PRIOR FILING DATE: 2007-09-06 PRIOR APPLICATION NUMBER: 60/976,279 PRIOR FILING DATE: 2007-09-28 PRIOR APPLICATION NUMBER: 60/990,509 PRIOR FILING DATE: 2007-11-27 PRIOR APPLICATION NUMBER: 61/012,035 PRIOR FILING DATE: 2007-12-06 PRIOR APPLICATION NUMBER: 61/013,775 PRIOR FILING DATE: 2007-12-14 PRIOR APPLICATION NUMBER: 61/019,395 PRIOR FILING DATE: 2008-01-07 PRIOR APPLICATION NUMBER: 61/032,059 PRIOR FILING DATE: 2008-02-27 PRIOR APPLICATION NUMBER: 61/043,585 PRIOR FILING DATE: 2008-04-09 Remaining Prior Application data removed - See File Wrapper or PALM. NUMBER OF SEQ ID NOS: 40 SEQ ID NO 2 LENGTH: 121 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: Synthesized HuAM4G7 VH Query Match 81.2%; Score 111.3; Length 121; Best Local Similarity 28.8%; Matches 23; Conservative 0; Mismatches 0; Indels 57; Gaps 2; Qy 1 SYVMH----------------NPYNDG--------------------------------- 11 ||||| |||||| Db 31 SYVMHWVRQAPGKGLEWIGYINPYNDGTKYNEKFQGRVTISSDKSISTAYMELSSLRSED 90 Qy 12 --------GTYYYGTRVFDY 23 |||||||||||| Db 91 TAMYYCARGTYYYGTRVFDY 110 SEQ ID Nos: 4, 5, 6 US-12-156-183A-1 (NOTE: this sequence has 17 duplicates in the database searched. See complete list at the end of this report) Sequence 1, US/12156183A Patent No. 8063187 GENERAL INFORMATION APPLICANT: CHU, Seung Yup APPLICANT: DESJARLAIS, John R APPLICANT: KARKI, Sher Bahadur APPLICANT: LAZAR, Gregory Alan APPLICANT: MOORE, Gregory L. APPLICANT: VOSTIAR, Igor TITLE OF INVENTION: Methods and Compositions for Inhibiting CD32B Expressing Cells FILE REFERENCE: 190323/US/8 CURRENT APPLICATION NUMBER: US/12/156,183A CURRENT FILING DATE: 2009-01-21 PRIOR APPLICATION NUMBER: 60/940,776 PRIOR FILING DATE: 2007-05-30 PRIOR APPLICATION NUMBER: 60/953,174 PRIOR FILING DATE: 2007-07-31 PRIOR APPLICATION NUMBER: 60/970,413 PRIOR FILING DATE: 2007-09-06 PRIOR APPLICATION NUMBER: 60/976,279 PRIOR FILING DATE: 2007-09-28 PRIOR APPLICATION NUMBER: 60/990,509 PRIOR FILING DATE: 2007-11-27 PRIOR APPLICATION NUMBER: 61/012,035 PRIOR FILING DATE: 2007-12-06 PRIOR APPLICATION NUMBER: 61/013,775 PRIOR FILING DATE: 2007-12-14 PRIOR APPLICATION NUMBER: 61/019,395 PRIOR FILING DATE: 2008-01-07 PRIOR APPLICATION NUMBER: 61/032,059 PRIOR FILING DATE: 2008-02-27 PRIOR APPLICATION NUMBER: 61/043,585 PRIOR FILING DATE: 2008-04-09 Remaining Prior Application data removed - See File Wrapper or PALM. NUMBER OF SEQ ID NOS: 40 SEQ ID NO 1 LENGTH: 112 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: Synthesized HuAM4G7 VL Query Match 85.1%; Score 141.3; Length 112; Best Local Similarity 40.5%; Matches 32; Conservative 0; Mismatches 0; Indels 47; Gaps 2; Qy 1 RSSKSLQNVNGNTYL---------------YRMSNLNS---------------------- 23 ||||||||||||||| |||||||| Db 24 RSSKSLQNVNGNTYLYWFQQKPGQSPQLLIYRMSNLNSGVPDRFSGSGSGTEFTLTISSL 83 Qy 24 ----------MQHLEYPIT 32 ||||||||| Db 84 EPEDFAVYYCMQHLEYPIT 102 SEQ ID NO:7 US-12-156-183A-2 (NOTE: this sequence has 17 duplicates in the database searched. See complete list at the end of this report) Sequence 2, US/12156183A Patent No. 8063187 GENERAL INFORMATION APPLICANT: CHU, Seung Yup APPLICANT: DESJARLAIS, John R APPLICANT: KARKI, Sher Bahadur APPLICANT: LAZAR, Gregory Alan APPLICANT: MOORE, Gregory L. APPLICANT: VOSTIAR, Igor TITLE OF INVENTION: Methods and Compositions for Inhibiting CD32B Expressing Cells FILE REFERENCE: 190323/US/8 CURRENT APPLICATION NUMBER: US/12/156,183A CURRENT FILING DATE: 2009-01-21 PRIOR APPLICATION NUMBER: 60/940,776 PRIOR FILING DATE: 2007-05-30 PRIOR APPLICATION NUMBER: 60/953,174 PRIOR FILING DATE: 2007-07-31 PRIOR APPLICATION NUMBER: 60/970,413 PRIOR FILING DATE: 2007-09-06 PRIOR APPLICATION NUMBER: 60/976,279 PRIOR FILING DATE: 2007-09-28 PRIOR APPLICATION NUMBER: 60/990,509 PRIOR FILING DATE: 2007-11-27 PRIOR APPLICATION NUMBER: 61/012,035 PRIOR FILING DATE: 2007-12-06 PRIOR APPLICATION NUMBER: 61/013,775 PRIOR FILING DATE: 2007-12-14 PRIOR APPLICATION NUMBER: 61/019,395 PRIOR FILING DATE: 2008-01-07 PRIOR APPLICATION NUMBER: 61/032,059 PRIOR FILING DATE: 2008-02-27 PRIOR APPLICATION NUMBER: 61/043,585 PRIOR FILING DATE: 2008-04-09 Remaining Prior Application data removed - See File Wrapper or PALM. NUMBER OF SEQ ID NOS: 40 SEQ ID NO 2 LENGTH: 121 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: Synthesized HuAM4G7 VH Query Match 100.0%; Score 648; Length 121; Best Local Similarity 100.0%; Matches 121; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 EVQLVESGGGLVKPGGSLKLSCAASGYTFTSYVMHWVRQAPGKGLEWIGYINPYNDGTKY 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 EVQLVESGGGLVKPGGSLKLSCAASGYTFTSYVMHWVRQAPGKGLEWIGYINPYNDGTKY 60 Qy 61 NEKFQGRVTISSDKSISTAYMELSSLRSEDTAMYYCARGTYYYGTRVFDYWGQGTLVTVS 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 NEKFQGRVTISSDKSISTAYMELSSLRSEDTAMYYCARGTYYYGTRVFDYWGQGTLVTVS 120 Qy 121 S 121 | Db 121 S 121 SEQ ID NO:8 US-12-156-183A-1 (NOTE: this sequence has 17 duplicates in the database searched. See complete list at the end of this report) Sequence 1, US/12156183A Patent No. 8063187 GENERAL INFORMATION APPLICANT: CHU, Seung Yup APPLICANT: DESJARLAIS, John R APPLICANT: KARKI, Sher Bahadur APPLICANT: LAZAR, Gregory Alan APPLICANT: MOORE, Gregory L. APPLICANT: VOSTIAR, Igor TITLE OF INVENTION: Methods and Compositions for Inhibiting CD32B Expressing Cells FILE REFERENCE: 190323/US/8 CURRENT APPLICATION NUMBER: US/12/156,183A CURRENT FILING DATE: 2009-01-21 PRIOR APPLICATION NUMBER: 60/940,776 PRIOR FILING DATE: 2007-05-30 PRIOR APPLICATION NUMBER: 60/953,174 PRIOR FILING DATE: 2007-07-31 PRIOR APPLICATION NUMBER: 60/970,413 PRIOR FILING DATE: 2007-09-06 PRIOR APPLICATION NUMBER: 60/976,279 PRIOR FILING DATE: 2007-09-28 PRIOR APPLICATION NUMBER: 60/990,509 PRIOR FILING DATE: 2007-11-27 PRIOR APPLICATION NUMBER: 61/012,035 PRIOR FILING DATE: 2007-12-06 PRIOR APPLICATION NUMBER: 61/013,775 PRIOR FILING DATE: 2007-12-14 PRIOR APPLICATION NUMBER: 61/019,395 PRIOR FILING DATE: 2008-01-07 PRIOR APPLICATION NUMBER: 61/032,059 PRIOR FILING DATE: 2008-02-27 PRIOR APPLICATION NUMBER: 61/043,585 PRIOR FILING DATE: 2008-04-09 Remaining Prior Application data removed - See File Wrapper or PALM. NUMBER OF SEQ ID NOS: 40 SEQ ID NO 1 LENGTH: 112 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: Synthesized HuAM4G7 VL Query Match 100.0%; Score 585; Length 112; Best Local Similarity 100.0%; Matches 112; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 DIVMTQSPATLSLSPGERATLSCRSSKSLQNVNGNTYLYWFQQKPGQSPQLLIYRMSNLN 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 DIVMTQSPATLSLSPGERATLSCRSSKSLQNVNGNTYLYWFQQKPGQSPQLLIYRMSNLN 60 Qy 61 SGVPDRFSGSGSGTEFTLTISSLEPEDFAVYYCMQHLEYPITFGAGTKLEIK 112 |||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 SGVPDRFSGSGSGTEFTLTISSLEPEDFAVYYCMQHLEYPITFGAGTKLEIK 112 US-12-377-251A-87 (NOTE: this sequence has 4 duplicates in the database searched. See complete list at the end of this report) Sequence 87, US/12377251A Patent No. 8524867 GENERAL INFORMATION APPLICANT: XENCOR, INC. APPLICANT: BERNETT, Matthew J. APPLICANT: CHU, Seung Yup APPLICANT: DESJARLAIS, John R. APPLICANT: KARKI, Sher Bahadur APPLICANT: LAZAR, Gregory Alan APPLICANT: PONG, Erik Weiking APPLICANT: RICHARDS, John O. APPLICANT: ZHUKOVSKY, Eugene Alexander TITLE OF INVENTION: OPTIMIZED ANTIBODIES THAT TARGET CD19 FILE REFERENCE: 189519/PCT CURRENT APPLICATION NUMBER: US/12/377,251A CURRENT FILING DATE: 2011-08-30 PRIOR APPLICATION NUMBER: PCT/US2007/075932 PRIOR FILING DATE: 2007-08-14 PRIOR APPLICATION NUMBER: US 60/822,362 PRIOR FILING DATE: 2006-08-14 NUMBER OF SEQ ID NOS: 147 SEQ ID NO 87 LENGTH: 451 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: 4G7 H1.52 Hybrid S239D/I332E Query Match 100.0%; Score 648; Length 451; Best Local Similarity 100.0%; Matches 121; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 EVQLVESGGGLVKPGGSLKLSCAASGYTFTSYVMHWVRQAPGKGLEWIGYINPYNDGTKY 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 EVQLVESGGGLVKPGGSLKLSCAASGYTFTSYVMHWVRQAPGKGLEWIGYINPYNDGTKY 60 Qy 61 NEKFQGRVTISSDKSISTAYMELSSLRSEDTAMYYCARGTYYYGTRVFDYWGQGTLVTVS 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 NEKFQGRVTISSDKSISTAYMELSSLRSEDTAMYYCARGTYYYGTRVFDYWGQGTLVTVS 120 Qy 121 S 121 | Db 121 S 121 SEQ ID NO:11 US-12-377-251A-87 (NOTE: this sequence has 4 duplicates in the database searched. See complete list at the end of this report) Sequence 87, US/12377251A Patent No. 8524867 GENERAL INFORMATION APPLICANT: XENCOR, INC. APPLICANT: BERNETT, Matthew J. APPLICANT: CHU, Seung Yup APPLICANT: DESJARLAIS, John R. APPLICANT: KARKI, Sher Bahadur APPLICANT: LAZAR, Gregory Alan APPLICANT: PONG, Erik Weiking APPLICANT: RICHARDS, John O. APPLICANT: ZHUKOVSKY, Eugene Alexander TITLE OF INVENTION: OPTIMIZED ANTIBODIES THAT TARGET CD19 FILE REFERENCE: 189519/PCT CURRENT APPLICATION NUMBER: US/12/377,251A CURRENT FILING DATE: 2011-08-30 PRIOR APPLICATION NUMBER: PCT/US2007/075932 PRIOR FILING DATE: 2007-08-14 PRIOR APPLICATION NUMBER: US 60/822,362 PRIOR FILING DATE: 2006-08-14 NUMBER OF SEQ ID NOS: 147 SEQ ID NO 87 LENGTH: 451 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: 4G7 H1.52 Hybrid S239D/I332E Query Match 100.0%; Score 2418; Length 451; Best Local Similarity 100.0%; Matches 451; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 EVQLVESGGGLVKPGGSLKLSCAASGYTFTSYVMHWVRQAPGKGLEWIGYINPYNDGTKY 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 EVQLVESGGGLVKPGGSLKLSCAASGYTFTSYVMHWVRQAPGKGLEWIGYINPYNDGTKY 60 Qy 61 NEKFQGRVTISSDKSISTAYMELSSLRSEDTAMYYCARGTYYYGTRVFDYWGQGTLVTVS 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 NEKFQGRVTISSDKSISTAYMELSSLRSEDTAMYYCARGTYYYGTRVFDYWGQGTLVTVS 120 Qy 121 SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS 180 Qy 181 SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLG 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLG 240 Qy 241 GPDVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQF 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 GPDVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQF 300 Qy 301 NSTFRVVSVLTVVHQDWLNGKEYKCKVSNKALPAPEEKTISKTKGQPREPQVYTLPPSRE 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 NSTFRVVSVLTVVHQDWLNGKEYKCKVSNKALPAPEEKTISKTKGQPREPQVYTLPPSRE 360 Qy 361 EMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSR 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 EMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSR 420 Qy 421 WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 451 ||||||||||||||||||||||||||||||| Db 421 WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 451 SEQ ID NO:12 US-12-156-183A-7 (NOTE: this sequence has 59 duplicates in the database searched. See complete list at the end of this report) Sequence 7, US/12156183A Patent No. 8063187 GENERAL INFORMATION APPLICANT: CHU, Seung Yup APPLICANT: DESJARLAIS, John R APPLICANT: KARKI, Sher Bahadur APPLICANT: LAZAR, Gregory Alan APPLICANT: MOORE, Gregory L. APPLICANT: VOSTIAR, Igor TITLE OF INVENTION: Methods and Compositions for Inhibiting CD32B Expressing Cells FILE REFERENCE: 190323/US/8 CURRENT APPLICATION NUMBER: US/12/156,183A CURRENT FILING DATE: 2009-01-21 PRIOR APPLICATION NUMBER: 60/940,776 PRIOR FILING DATE: 2007-05-30 PRIOR APPLICATION NUMBER: 60/953,174 PRIOR FILING DATE: 2007-07-31 PRIOR APPLICATION NUMBER: 60/970,413 PRIOR FILING DATE: 2007-09-06 PRIOR APPLICATION NUMBER: 60/976,279 PRIOR FILING DATE: 2007-09-28 PRIOR APPLICATION NUMBER: 60/990,509 PRIOR FILING DATE: 2007-11-27 PRIOR APPLICATION NUMBER: 61/012,035 PRIOR FILING DATE: 2007-12-06 PRIOR APPLICATION NUMBER: 61/013,775 PRIOR FILING DATE: 2007-12-14 PRIOR APPLICATION NUMBER: 61/019,395 PRIOR FILING DATE: 2008-01-07 PRIOR APPLICATION NUMBER: 61/032,059 PRIOR FILING DATE: 2008-02-27 PRIOR APPLICATION NUMBER: 61/043,585 PRIOR FILING DATE: 2008-04-09 Remaining Prior Application data removed - See File Wrapper or PALM. NUMBER OF SEQ ID NOS: 40 SEQ ID NO 7 LENGTH: 219 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: Synthesized HuAM4G7 light chain (VH-C ) Query Match 100.0%; Score 1138; Length 219; Best Local Similarity 100.0%; Matches 219; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 DIVMTQSPATLSLSPGERATLSCRSSKSLQNVNGNTYLYWFQQKPGQSPQLLIYRMSNLN 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 DIVMTQSPATLSLSPGERATLSCRSSKSLQNVNGNTYLYWFQQKPGQSPQLLIYRMSNLN 60 Qy 61 SGVPDRFSGSGSGTEFTLTISSLEPEDFAVYYCMQHLEYPITFGAGTKLEIKRTVAAPSV 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 SGVPDRFSGSGSGTEFTLTISSLEPEDFAVYYCMQHLEYPITFGAGTKLEIKRTVAAPSV 120 Qy 121 FIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSL 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 FIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSL 180 Qy 181 SSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 219 ||||||||||||||||||||||||||||||||||||||| Db 181 SSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 219 SEQ ID Nos: 22, 23, 24 US-13-675-274-18 (NOTE: this sequence has 3 duplicates in the database searched. See complete list at the end of this report) Sequence 18, US/13675274 Patent No. 9017675 GENERAL INFORMATION APPLICANT: The Board of Trustees of the Leland Stanford Junior University APPLICANT: Liu, Jie APPLICANT: WEISSMAN, IRVING L. APPLICANT: Majeti, Ravindra TITLE OF INVENTION: Humanized and Chimeric Monoclonal TITLE OF INVENTION: Antibodies to CD47 FILE REFERENCE: STAN-737CIP CURRENT APPLICATION NUMBER: US/13/675,274 CURRENT FILING DATE: 2012-11-13 PRIOR APPLICATION NUMBER: PCT/US2011/036535 PRIOR FILING DATE: 2011-05-13 PRIOR APPLICATION NUMBER: US 61/395,652 PRIOR FILING DATE: 2010-05-14 NUMBER OF SEQ ID NOS: 78 SEQ ID NO 18 LENGTH: 116 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: 5F9 heavy chain variable region Query Match 85.9%; Score 149.4; Length 116; Best Local Similarity 39.5%; Matches 30; Conservative 0; Mismatches 0; Indels 46; Gaps 2; Qy 1 NYNMH--------------TIYPGNDDTSYNQKFKD------------------------ 22 ||||| ||||||||||||||||| Db 31 NYNMHWVKQTPGQGLEWIGTIYPGNDDTSYNQKFKDKATLTADKSSSAAYMQLSSLTSED 90 Qy 23 --------GGYRAMDY 30 |||||||| Db 91 SAVYYCARGGYRAMDY 106 SEQ ID Nos: 25, 26, 27 US-13-675-274-43 (NOTE: this sequence has 4 duplicates in the database searched. See complete list at the end of this report) Sequence 43, US/13675274 Patent No. 9017675 GENERAL INFORMATION APPLICANT: The Board of Trustees of the Leland Stanford Junior University APPLICANT: Liu, Jie APPLICANT: WEISSMAN, IRVING L. APPLICANT: Majeti, Ravindra TITLE OF INVENTION: Humanized and Chimeric Monoclonal TITLE OF INVENTION: Antibodies to CD47 FILE REFERENCE: STAN-737CIP CURRENT APPLICATION NUMBER: US/13/675,274 CURRENT FILING DATE: 2012-11-13 PRIOR APPLICATION NUMBER: PCT/US2011/036535 PRIOR FILING DATE: 2011-05-13 PRIOR APPLICATION NUMBER: US 61/395,652 PRIOR FILING DATE: 2010-05-14 NUMBER OF SEQ ID NOS: 78 SEQ ID NO 43 LENGTH: 112 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: Humanized antibody hu5F9-vl3 Query Match 85.2%; Score 142.3; Length 112; Best Local Similarity 40.5%; Matches 32; Conservative 0; Mismatches 0; Indels 47; Gaps 2; Qy 1 RSSQSIVYSNGNTYLG---------------KVSNRFS---------------------- 23 |||||||||||||||| ||||||| Db 24 RSSQSIVYSNGNTYLGWYLQKPGQSPQLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRV 83 Qy 24 ----------FQGSHVPYT 32 ||||||||| Db 84 EAEDVGVYHCFQGSHVPYT 102 SEQ ID NO: 30 US-13-675-274-37 (NOTE: this sequence has 10 duplicates in the database searched. See complete list at the end of this report) Sequence 37, US/13675274 Patent No. 9017675 GENERAL INFORMATION APPLICANT: The Board of Trustees of the Leland Stanford Junior University APPLICANT: Liu, Jie APPLICANT: WEISSMAN, IRVING L. APPLICANT: Majeti, Ravindra TITLE OF INVENTION: Humanized and Chimeric Monoclonal TITLE OF INVENTION: Antibodies to CD47 FILE REFERENCE: STAN-737CIP CURRENT APPLICATION NUMBER: US/13/675,274 CURRENT FILING DATE: 2012-11-13 PRIOR APPLICATION NUMBER: PCT/US2011/036535 PRIOR FILING DATE: 2011-05-13 PRIOR APPLICATION NUMBER: US 61/395,652 PRIOR FILING DATE: 2010-05-14 NUMBER OF SEQ ID NOS: 78 SEQ ID NO 37 LENGTH: 117 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: Humanized antibody hu5F9-vh2 Query Match 100.0%; Score 621; Length 117; Best Local Similarity 100.0%; Matches 117; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYNMHWVRQAPGQRLEWMGTIYPGNDDTSY 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYNMHWVRQAPGQRLEWMGTIYPGNDDTSY 60 Qy 61 NQKFKDRVTITADTSASTAYMELSSLRSEDTAVYYCARGGYRAMDYWGQGTLVTVSS 117 ||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 NQKFKDRVTITADTSASTAYMELSSLRSEDTAVYYCARGGYRAMDYWGQGTLVTVSS 117 SEQ ID NO: 31 US-13-675-274-42 (NOTE: this sequence has 10 duplicates in the database searched. See complete list at the end of this report) Sequence 42, US/13675274 Patent No. 9017675 GENERAL INFORMATION APPLICANT: The Board of Trustees of the Leland Stanford Junior University APPLICANT: Liu, Jie APPLICANT: WEISSMAN, IRVING L. APPLICANT: Majeti, Ravindra TITLE OF INVENTION: Humanized and Chimeric Monoclonal TITLE OF INVENTION: Antibodies to CD47 FILE REFERENCE: STAN-737CIP CURRENT APPLICATION NUMBER: US/13/675,274 CURRENT FILING DATE: 2012-11-13 PRIOR APPLICATION NUMBER: PCT/US2011/036535 PRIOR FILING DATE: 2011-05-13 PRIOR APPLICATION NUMBER: US 61/395,652 PRIOR FILING DATE: 2010-05-14 NUMBER OF SEQ ID NOS: 78 SEQ ID NO 42 LENGTH: 112 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: Humanized antibody hu5F9-vl2 Query Match 100.0%; Score 590; Length 112; Best Local Similarity 100.0%; Matches 112; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 DIVMTQSPLSLPVTPGEPASISCRSSQSIVYSNGNTYLGWYLQKPGQSPQLLIYKVSNRF 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 DIVMTQSPLSLPVTPGEPASISCRSSQSIVYSNGNTYLGWYLQKPGQSPQLLIYKVSNRF 60 Qy 61 SGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSHVPYTFGQGTKLEIK 112 |||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 SGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSHVPYTFGQGTKLEIK 112 Constant region of SEQ ID NO: 34 US-15-723-523-121 (NOTE: this sequence has 1 duplicate in the database searched. See complete list at the end of this report) Sequence 121, US/15723523 Patent No. 10669336 GENERAL INFORMATION APPLICANT: Vasculox, Inc. APPLICANT: Frazier, William APPLICANT: Manning, Pamela APPLICANT: Frey, Gerhard APPLICANT: Chang, Hwai Wen TITLE OF INVENTION: Therapeutic CD47 Antibodies FILE REFERENCE: VLX0001-201CIP2-US CURRENT APPLICATION NUMBER: US/15/723,523 CURRENT FILING DATE: 2017-10-03 PRIOR APPLICATION NUMBER: 14/302,348 PRIOR FILING DATE: 2014-06-11 PRIOR APPLICATION NUMBER: PCT/US2013/074766 PRIOR FILING DATE: 2013-12-12 PRIOR APPLICATION NUMBER: 61/833,691 PRIOR FILING DATE: 2013-06-11 PRIOR APPLICATION NUMBER: 61/736,301 PRIOR FILING DATE: 2012-12-12 NUMBER OF SEQ ID NOS: 124 SEQ ID NO 121 LENGTH: 334 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: heavy chain constant region Query Match 100.0%; Score 1746; Length 334; Best Local Similarity 100.0%; Matches 327; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 8 ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS 67 Qy 61 GLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSV 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 68 GLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSV 127 Qy 121 FLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTY 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 128 FLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTY 187 Qy 181 RVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTK 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 188 RVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTK 247 Qy 241 NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEG 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 248 NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEG 307 Qy 301 NVFSCSVMHEALHNHYTQKSLSLSLGK 327 ||||||||||||||||||||||||||| Db 308 NVFSCSVMHEALHNHYTQKSLSLSLGK 334 Constant region of SEQ ID NO: 35 US-15-723-523-117 (NOTE: this sequence has 2 duplicates in the database searched. See complete list at the end of this report) Sequence 117, US/15723523 Patent No. 10669336 GENERAL INFORMATION APPLICANT: Vasculox, Inc. APPLICANT: Frazier, William APPLICANT: Manning, Pamela APPLICANT: Frey, Gerhard APPLICANT: Chang, Hwai Wen TITLE OF INVENTION: Therapeutic CD47 Antibodies FILE REFERENCE: VLX0001-201CIP2-US CURRENT APPLICATION NUMBER: US/15/723,523 CURRENT FILING DATE: 2017-10-03 PRIOR APPLICATION NUMBER: 14/302,348 PRIOR FILING DATE: 2014-06-11 PRIOR APPLICATION NUMBER: PCT/US2013/074766 PRIOR FILING DATE: 2013-12-12 PRIOR APPLICATION NUMBER: 61/833,691 PRIOR FILING DATE: 2013-06-11 PRIOR APPLICATION NUMBER: 61/736,301 PRIOR FILING DATE: 2012-12-12 NUMBER OF SEQ ID NOS: 124 SEQ ID NO 117 LENGTH: 113 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: light chain constant region Query Match 100.0%; Score 553; Length 113; Best Local Similarity 100.0%; Matches 107; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 RTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQD 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 7 RTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQD 66 Qy 61 SKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 107 ||||||||||||||||||||||||||||||||||||||||||||||| Db 67 SKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 113 Summary Claims 3-6, 8-14 and 16-19 stand rejected THIS ACTION IS MADE FINAL. Applicant is reminded of the extension of time policy as set forth in 37 CFR 1.136(a). A shortened statutory period for reply to this final action is set to expire THREE MONTHS from the mailing date of this action. In the event a first reply is filed within TWO MONTHS of the mailing date of this final action and the advisory action is not mailed until after the end of the THREE-MONTH shortened statutory period, then the shortened statutory period will expire on the date the advisory action is mailed, and any extension fee pursuant to 37 CFR 1.136(a) will be calculated from the mailing date of the advisory action. In no event, however, will the statutory period for reply expire later than SIX MONTHS from the mailing date of this final action. Summary Claims 4-6, 13, 14 and 16 stand rejected. THIS ACTION IS MADE FINAL. Applicant is reminded of the extension of time policy as set forth in 37 CFR 1.136(a). A shortened statutory period for reply to this final action is set to expire THREE MONTHS from the mailing date of this action. In the event a first reply is filed within TWO MONTHS of the mailing date of this final action and the advisory action is not mailed until after the end of the THREE-MONTH shortened statutory period, then the shortened statutory period will expire on the date the advisory action is mailed, and any nonprovisional extension fee (37 CFR 1.17(a)) pursuant to 37 CFR 1.136(a) will be calculated from the mailing date of the advisory action. In no event, however, will the statutory period for reply expire later than SIX MONTHS from the mailing date of this final action. Any inquiry concerning this communication or earlier communications from the examiner should be directed to Mark Halvorson whose telephone number is (571) 272-6539. The examiner can normally be reached on Monday through Friday from 9:00 am to 6:00 pm. If attempts to reach the examiner by telephone are unsuccessful, the examiner's supervisor, Janet Epps-Smith, can be reached at (571) 272-0757. The fax phone number for this Art Unit is (571) 273-8300. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. Information regarding the status of an application may be obtained from the Patent Application Information Retrieval (PAIR) system. Status information for published applications may be obtained from either Private PAIR or Public PAIR. Status information for unpublished applications is available through Private PAIR only. For more information about the PAIR system, see http://pair-direct.uspto.gov. Should you have questions on access to the Private PAIR system, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative or access to the automated information system, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /MARK HALVORSON/ Primary Examiner, Art Unit 1646
Read full office action

Prosecution Timeline

Jun 22, 2021
Application Filed
Dec 01, 2023
Non-Final Rejection — §103
Mar 06, 2024
Response Filed
Apr 07, 2024
Final Rejection — §103
Oct 10, 2024
Request for Continued Examination
Oct 15, 2024
Response after Non-Final Action
Feb 27, 2025
Non-Final Rejection — §103
Sep 03, 2025
Response Filed
Oct 02, 2025
Final Rejection — §103 (current)

Precedent Cases

Applications granted by this same examiner with similar technology. Study what changed to get past this examiner.

Patent 12595510
METHODS AND COMPOSITIONS FOR PREDICTION OF RESPONSE TO A THERAPY OF AN INFLAMMATORY BOWEL DISEASE
2y 5m to grant Granted Apr 07, 2026
Patent 12583938
PROTEIN BIOMARKER AND USES THEREOF
2y 5m to grant Granted Mar 24, 2026
Patent 12577302
ANTI-TIM-3 ANTIBODIES AND COMPOSITIONS
2y 5m to grant Granted Mar 17, 2026
Patent 12570736
COMPOSITIONS
2y 5m to grant Granted Mar 10, 2026
Patent 12558421
ANTI-TIGIT ANTIBODIES, ANTI-PVRIG ANTIBODIES AND COMBINATIONS THEREOF
2y 5m to grant Granted Feb 24, 2026

AI Strategy Recommendation

Click below to generate an AI-powered prosecution strategy using examiner precedents, rejection analysis, and claim mapping.
Powered by AI — typically takes 5-10 seconds

Prosecution Projections

5-6
Expected OA Rounds
48%
Grant Probability
58%
With Interview (+10.2%)
3y 8m
Median Time to Grant
High
PTA Risk
Based on 804 resolved cases by this examiner