Prosecution Insights
Last updated: April 19, 2026
Application No. 17/403,846

Fusion Protein

Final Rejection §102
Filed
Aug 16, 2021
Examiner
DESAI, ANAND U
Art Unit
1655
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
VIRAVAXX AG
OA Round
2 (Final)
79%
Grant Probability
Favorable
3-4
OA Rounds
3y 4m
To Grant
91%
With Interview

Examiner Intelligence

Grants 79% — above average
79%
Career Allow Rate
712 granted / 898 resolved
+19.3% vs TC avg
Moderate +12% lift
Without
With
+11.6%
Interview Lift
resolved cases with interview
Typical timeline
3y 4m
Avg Prosecution
33 currently pending
Career history
931
Total Applications
across all art units

Statute-Specific Performance

§101
2.6%
-37.4% vs TC avg
§103
18.1%
-21.9% vs TC avg
§102
20.8%
-19.2% vs TC avg
§112
34.8%
-5.2% vs TC avg
Black line = Tech Center average estimate • Based on career data from 898 resolved cases

Office Action

§102
DETAILED ACTION Notice of Pre-AIA or AIA Status The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . This office action is in response to the amendment filed on April 22, 2025 and June 30, 2025. Claims 8-15 are currently pending and are under examination. Any objections or rejections not reiterated below are hereby withdrawn. Pending Objections and Rejections Claim Objections Claims 8-11 are objected to because of the following informalities: the identifier is recited as SEQ ID No. and should be identified as SEQ ID NO: based on the sequence rules. Appropriate correction is required. Claim Rejections - 35 USC § 102 In the event the determination of the status of the application as subject to AIA 35 U.S.C. 102 and 103 (or as subject to pre-AIA 35 U.S.C. 102 and 103) is incorrect, any correction of the statutory basis (i.e., changing from AIA to pre-AIA ) for the rejection will not be considered a new ground of rejection if the prior art relied upon, and the rationale supporting the rejection, would be the same under either status. The following is a quotation of the appropriate paragraphs of 35 U.S.C. 102 that form the basis for the rejections under this section made in this Office action: A person shall be entitled to a patent unless – (a)(1) the claimed invention was patented, described in a printed publication, or in public use, on sale, or otherwise available to the public before the effective filing date of the claimed invention. (a)(2) the claimed invention was described in a patent issued under section 151, or in an application for patent published or deemed published under section 122(b), in which the patent or application, as the case may be, names another inventor and was effectively filed before the effective filing date of the claimed invention. Claim(s) 8-15 stand rejected under 35 U.S.C. 102(a)(1) and 35 U.S.C. 102(a)(2) as being anticipated by Niespodziana et al. (US 2014/0193450 A1). The rejection was explained in the office action mailed on October 22, 2024. Niespodziana et al. disclose a polypeptide comprising at least four peptide fragments consisting of 20 to 50 consecutive amino acid residues of a wild-type allergen fused to the N- and C-terminus of a surface polypeptide of a virus of a hepadnaviridae family or a fragment of the surface polypeptide. The virus of the hepadnaviridae family is Hepatitis B virus. The surface polypeptide of the virus of the hepadnaviridae family is PreS. The polypeptide is a vaccine formulation. The polypeptide can be formulated to comprises at least one adjuvant, pharmaceutical acceptable excipient and/or preservative. The formulation can be administered to an individual in amount of 0.01 µg/kg body weight to 5 mg/kg body weight, preferably 0.1 µg/kg body weight to 10 µg/kg body weight (see claims 1-4 and 22, [0316], and [0319]). Response to Remarks Applicants state that Niespodziana et al. do not contain any (experimental) evidence at all showing that fusion proteins comprising a viral capsid flanked by at least two allergen fragments at the N-terminal end and at least two allergen fragments at the C-terminal end are able to induce the formation of antibodies binding to said capsid protein. Niespodziana et al. show only that such fusion proteins may induce the production of antibodies binding specifically to the flanking allergen fragments. This means that the inventors of Niespodziana et al. had no proof that the fusion proteins disclosed therein can be used as a potential vaccine for hepadnaviruses at the filing date of said document. Hence, Niespodziana et al. cannot be considered as novelty destroying for the subject matter claimed in the present patent application. Applicants further state that there is no direct and unambiguous disclosure of the subject mater of claim 1 in Niespodziana et al. Applicant's arguments filed April 22, 2025 have been fully considered but they are not persuasive. Niespodziana et al. disclose a polypeptide comprising at least four peptide fragments consisting of 20 to 50 consecutive amino acid residues of a wild-type allergen fused to the N- and C-terminus of a surface polypeptide of a virus of a hepadnaviridae family or a fragment of the surface polypeptide. The virus of the hepadnaviridae family is Hepatitis B virus. The surface polypeptide of the virus of the hepadnaviridae family is PreS. The polypeptide is a vaccine formulation. The polypeptide can be formulated to comprises at least one adjuvant, pharmaceutical acceptable excipient and/or preservative. The formulation can be administered to an individual in amount of 0.01 µg/kg body weight to 5 mg/kg body weight, preferably 0.1 µg/kg body weight to 10 µg/kg body weight (see claims 1-4 and 22, [0316], and [0319]). SEQ ID NO: 16 has 100% identity to SEQ ID NO: 6 of the instant application. US-14-124-925A-16 ; Sequence 16, Application US/14124925A ; Patent No. 9308251 ; GENERAL INFORMATION ; APPLICANT: Biomay AG ; TITLE OF INVENTION: Peptide carrier fusion proteins as allergy vaccines ; FILE REFERENCE: 425829US58PCT ; CURRENT APPLICATION NUMBER: US/14/124,925A ; CURRENT FILING DATE: 2013-12-09 ; PRIOR APPLICATION NUMBER: EP 11169365.1 ; PRIOR FILING DATE: 2011-06-09 ; PRIOR APPLICATION NUMBER: PCT/EP2012/061040 ; PRIOR FILING DATE: 2012-06-11 ; NUMBER OF SEQ ID NOS: 152 ; SOFTWARE: PatentIn version 3.5 ; SEQ ID NO 16 ; LENGTH: 307 ; TYPE: PRT ; ORGANISM: Artificial Sequence ; FEATURE: ; OTHER INFORMATION: Synthetic Peptide US-14-124-925A-16 Query Match 100.0%; Score 1619; DB 7; Length 307; Best Local Similarity 100.0%; Matches 307; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 MEAAFNDAIKASTGGAYESYKFIPALEAAVKAEEVKVIPAGELQVIEKVDAAFKVAATAA 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MEAAFNDAIKASTGGAYESYKFIPALEAAVKAEEVKVIPAGELQVIEKVDAAFKVAATAA 60 Qy 61 NAAPANDKGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKDHWP 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 NAAPANDKGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKDHWP 120 Qy 121 AANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQSGRQPTPISPPLR 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 AANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQSGRQPTPISPPLR 180 Qy 181 DSHPQAMQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVT 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 DSHPQAMQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTGDPVT 240 Qy 241 NADLGYGPATPAAPAAGYTPATPAAPAEAAPAGKATTEEQKLIEKINAGFKAALAAAAGV 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 NADLGYGPATPAAPAAGYTPATPAAPAEAAPAGKATTEEQKLIEKINAGFKAALAAAAGV 300 Qy 301 QPADKYR 307 ||||||| Db 301 QPADKYR 307 Where the claimed and prior art products are identical or substantially identical in structure or composition, or are produced by identical or substantially identical processes, a prima facie case of either anticipation or obviousness has been established. In re Best, 562 F.2d 1252, 1255, 195 USPQ 430, 433 (CCPA 1977). “When the PTO shows a sound basis for believing that the products of the applicant and the prior art are the same, the applicant has the burden of showing that they are not.” In re Spada, 911 F.2d 705, 709, 15 USPQ2d 1655, 1658 (Fed. Cir.1990). Therefore, the prima facie case can be rebutted by evidence showing that the prior art products do not necessarily possess the characteristics of the claimed product. In re Best, 562 F.2d at 1255, 195 USPQ at 433. It is recognized that structure will lead to functional effect. Since the structure is disclosed the composition will necessarily have the functional effect as currently claimed. Conclusion No claims are allowed. THIS ACTION IS MADE FINAL. Applicant is reminded of the extension of time policy as set forth in 37 CFR 1.136(a). A shortened statutory period for reply to this final action is set to expire THREE MONTHS from the mailing date of this action. In the event a first reply is filed within TWO MONTHS of the mailing date of this final action and the advisory action is not mailed until after the end of the THREE-MONTH shortened statutory period, then the shortened statutory period will expire on the date the advisory action is mailed, and any nonprovisional extension fee (37 CFR 1.17(a)) pursuant to 37 CFR 1.136(a) will be calculated from the mailing date of the advisory action. In no event, however, will the statutory period for reply expire later than SIX MONTHS from the mailing date of this final action. Any inquiry concerning this communication or earlier communications from the examiner should be directed to ANAND U DESAI whose telephone number is (571)272-0947. The examiner can normally be reached 10:30-9:30 EST. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Manjunath Rao can be reached at 571-272-0939. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /ANAND U DESAI/Primary Examiner, Art Unit 1656
Read full office action

Prosecution Timeline

Aug 16, 2021
Application Filed
Aug 16, 2021
Response after Non-Final Action
Oct 18, 2024
Non-Final Rejection — §102
Apr 22, 2025
Response after Non-Final Action
Apr 22, 2025
Response Filed
Jun 30, 2025
Response Filed
Sep 02, 2025
Final Rejection — §102 (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12600754
Protein Fiber Production Method
2y 5m to grant Granted Apr 14, 2026
Patent 12594346
CROSSLINKED HYDROGEL FOR IMMUNE CHECKPOINT BLOCKADE DELIVERY
2y 5m to grant Granted Apr 07, 2026
Patent 12595441
AUTOMATIC DISHWASHING COMPOSITION COMPRISING A PROTEASE
2y 5m to grant Granted Apr 07, 2026
Patent 12582703
BLOOD SUBSTITUTES COMPRISING HEMOGLOBIN AND METHOGS OF MAKING
2y 5m to grant Granted Mar 24, 2026
Patent 12577354
METHODS AND COMPOSITIONS FOR SYNTHESIZING IMPROVED SILK FIBERS
2y 5m to grant Granted Mar 17, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

AI Strategy Recommendation

Get an AI-powered prosecution strategy using examiner precedents, rejection analysis, and claim mapping.
Powered by AI — typically takes 5-10 seconds

Prosecution Projections

3-4
Expected OA Rounds
79%
Grant Probability
91%
With Interview (+11.6%)
3y 4m
Median Time to Grant
Moderate
PTA Risk
Based on 898 resolved cases by this examiner. Grant probability derived from career allow rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month