Prosecution Insights
Last updated: April 19, 2026
Application No. 17/416,798

AGERITIN AS BIOINSECTICIDE AND METHODS OF GENERATING AND USING IT

Final Rejection §101§103
Filed
Jun 21, 2021
Examiner
KUMAR, VINOD
Art Unit
1663
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
Senckenberg Gesellschaft Fuer Naturforschung
OA Round
4 (Final)
83%
Grant Probability
Favorable
5-6
OA Rounds
2y 2m
To Grant
99%
With Interview

Examiner Intelligence

Grants 83% — above average
83%
Career Allow Rate
1170 granted / 1416 resolved
+22.6% vs TC avg
Strong +20% interview lift
Without
With
+20.3%
Interview Lift
resolved cases with interview
Typical timeline
2y 2m
Avg Prosecution
22 currently pending
Career history
1438
Total Applications
across all art units

Statute-Specific Performance

§101
6.0%
-34.0% vs TC avg
§103
19.3%
-20.7% vs TC avg
§102
16.4%
-23.6% vs TC avg
§112
47.0%
+7.0% vs TC avg
Black line = Tech Center average estimate • Based on career data from 1416 resolved cases

Office Action

§101 §103
Notice of Pre-AIA or AIA Status The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . DETAILED ACTION Status of Objections and Rejections 1. Applicant’s response filed December 29, 2025 is acknowledged. Claims 22, 24, 25-34, 36, 37 and newly added claims 41-44 are pending. Claims 1-21, 23, 35 and 38-40 are cancelled. Claims 25-34 and 37 are previously withdrawn as directed to non-elected inventions. Newly added claims 41-44 fall within the scope of elected invention. Accordingly, claims 22, 24, 36 and newly added claims 41-44 are examined on merits in the present Office action. 2. The text of those sections of Title 35, U.S. Code not included in this action can be found in a prior Office action. Claim Objections 3. Newly added claim 44 is objected to because of the following informalities: Newly added claim 44 is objected for reciting “consists of an amino acid sequence and a His-tag, wherein the amino acid sequence has at least 95% sequence identity to the amino acid sequence of SEQ ID NO: 1”. The recitation “consists” is a closed translational phrase. This implies the single amino acid sequence. However, 95% would encompass variant sequences other than SEQ ID NO: 1. There is an issue of closed composition with broad sequence variability. Appropriate correction is required. Claim Rejections - 35 USC § 101 4. Claims 22, 24 and 36 remain, and newly added claims 41-44 are rejected under 35 U.S.C. 101 because the claimed invention is directed to non-statutory subject matter. The claimed invention is directed to a judicial exception (i.e., a law of nature, a natural phenomenon, or an abstract idea) without significantly more for the reasons of record stated in the Office action mailed October 3, 2025. Applicant traverses the rejection in the papers filed December 29, 2025. Applicant primarily argues that (i) fungal proteins would not naturally express in bacteria, (ii) His-tag unexpectedly increases expression and insecticidal activity, and (iii) recombinant protein has different origin than fungi (pages 7-9). Applicant’s arguments are carefully considered but are deemed to be unpersusaive. These arguments fail to overcome the §101 rejection for the following legally and technically grounded reasons: (A) A claim is not eligible merely because expression occurs in a heterologous host While Applicant states that “fungal proteins would not naturally express in bacteria”, the eligibility analysis does not turn on the host cell, but on whether the claimed product itself has markedly different structural or functional characteristics from the naturally occurring molecule. In the instant case, the claims still encompass the native ageritin sequence (SEQ ID NO:1 / SEQ ID NO:2) fused to a routine purification tag, without any required structural re-engineering that alters folding, active domain configuration, cleavage pattern, or molecular mechanism of action. As discussed and established in previous Office action that Applicant has not rebutted with intrinsic evidence from the specification that: (i) The specification does not define “tag” structurally (Gupta et al. could still fall within scope); (ii) The recombinant ageritin remains structurally and functionally identical to the native fungal toxin; (iii) Any activity increase is explained by purification and expression concentration, not a new mechanism introduced by the tag (Applicant admitted this); and (iv) His-tags are routine fusion elements used for purification, not structural modifiers. Under In re Roslin and Myriad, a recombinant protein remains a product of nature exception when it retains native sequence + native biological function, even if synthetically produced. The origin (bacterial vs fungal) is irrelevant for §101, as held in In re Roslin Institute. Thus, Step 2A = YES (judicial exception) and Step 2B = NO (no significantly more) remain unchanged. (B) Applicant’s own specification admits His-tag does NOT change structure or mechanism Applicant relies on expression improvement as “unexpected”, but the claims do not require any structural change, nor do they claim a new biochemical function beyond the native toxin activity. Critically, Applicant previously acknowledged: “The weaker entomotoxic activity of the untagged versus a His-tagged version can be explained by significantly lower expression in E. coli.” See specification at page 24, last two lines of paragraph 5. This is a binding admission that the His-tag did not create a new functional property, but only increased yield, which is a routine result of purification. A concentration-based improvement in a native biological assay is not a “markedly different characteristic” under §101, because the purified protein still operates exactly like the natural toxin once isolated. (C) His-tag expression improvement is not a new functional attribute Applicant argues that His-tag “unexpectedly increases expression”, but: (i) The claims do not require a modified expression system, codon optimization, secretion signal, chaperone co-expression, inducible cassette, or engineered promoter-tag synergy; (ii) His-tag does not change ribotoxin enzymatic function, target binding site, or mode of insecticidal action; and (iii) Expression variability from a routine tag is a host-dependent experimental observation, not a claimed functional transformation of the molecule itself. Functional changes must arise from molecular design, not experimental purification side effects. In conclusion, Applicant has not demonstrated any claim-mandated structural modification that creates a new molecular function, nor any new mechanism beyond the natural entomotoxic activity. Accordingly, the §101 rejection is maintained. Claim Rejections - 35 USC § 103 5A. Claims 22, 24 and 36 remain, and newly added claims 41-44 are rejected under 35 U.S.C. 103 as being unpatentable over Gupta et al. (BMC Genomics 19:1-13, January 15, 2018), in view of Bornhorst et al. (Methods in Enzymology, 326:246-254, 2000), and further in view of Landi et al. (Biochimica et Biophysica, 1861(5), (Part A): 113-1121, May 2017) and Tegel et al. (FEBS Journal, 278:729-739, 2011) for the reasons of record stated in the Office action mailed October 3, 2025. Applicant traverses the rejection in the papers filed December 29, 2025. Gupta et al. teach a nucleotide sequence and encoded protein from Agrocybe aegerita having 100% amino acid sequence identity to instant SEQ ID NO: 1, and wherein the nucleotide sequence has 100% nucleotide sequence identity to instant SEQ ID NO: 2. The nucleotide sequence (ds DNA, cDNA, mRNA) disclose in the reference is a part of large BAC clone (same as vector) having native promoter and native terminator sequence (regulatory sequences) operably linked to it and cloned into a bacterial (E.coli) host. See in particular, abstract, methods, discussion and conclusions at pages 2-13; Figures 1-3, Tables 1-3. The complete nucleotide sequence is available as stated following under “availability of data and materials” at the bottom of left column at page 11: “Availability of data and materials The nucleotide sequences of all scaffolds of all three genome-sequenced strains of A aegerita supporting the conclusions of this article are available in the European Nucleotide Archive (ENA) repository under the BioProject accession number PRJEB21917 and are also available through our A aegerita Genome Browser: http://www.thines-lab.senckenberg.de/agrocybe_genome Phylogeny data including alignments have been deposited in the TreeBASE repository under the submission ID 22045: http://purl.org/phylo/treebase/ phylows/study/TB2:S22045” Sequence homology results are as follows: Query Match 100.0%; Score 794; Length 156; Best Local Similarity 100.0%; Matches 156; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 MSESSTFTTAVVPEGEGVAPMAETVQYYNSYSDASIASCAFVDSGKDKIDKTKLVTYTSR 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MSESSTFTTAVVPEGEGVAPMAETVQYYNSYSDASIASCAFVDSGKDKIDKTKLVTYTSR 60 Qy 61 LAASPAYQKVVGVGLKTAAGSIVPYVRLDMDNTGKGIHFNATKLSDSSAKLAAVLKTTVS 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 LAASPAYQKVVGVGLKTAAGSIVPYVRLDMDNTGKGIHFNATKLSDSSAKLAAVLKTTVS 120 Qy 121 MTEAQRTQLYMEYIKGIENRSAQFIWDWWRTGKAPA 156 |||||||||||||||||||||||||||||||||||| Db 121 MTEAQRTQLYMEYIKGIENRSAQFIWDWWRTGKAPA 156 Gupta et al. do no teach that their disclosed protein comprises His-tag. Gupta et al. also do not teach ageritin toxin activity of the protein having 100% identity to instant SEQ ID NO: 1. Bornhorst et al. clearly teach that attaching affinity tags, such as polyhistidine affinity tags were well known, and routinely used in in the art prior to earliest filing date of the claimed invention to purify a protein of interest by making translational fusion with said protein of interest. As shown in the Fig. 2; a protein of interest (ERK2 protein) tagged with six N-terminal histidine residues is overexpressed in a host (E.coli), and subsequently purified by utilizing a Ni2+-NTA resin under nondenaturing conditions. See in particular, page 246 through first paragraph of page 247; Figure 2 at page 252. Landi et al. isolation and purification of the protein taught by Gupta et al. having 100% identity to instant SEQ ID NO: 1. Gupta et al. further teach ribotoxin activity of the same protein. Landi et al. further teaches that said protein with ribotoxin activity significantly inhibited tumor growth in animal system, including humans. See in particular, abstract, results & discussion and figures 1-5). Tegel et al. teach expressing and enhancing protein production levels in bacteria using strong promoters. See in particular, abstract, introduction, Tables 1-3, Figures 1-3, materials & methods, results and discussion. Bornhorst et al. (see in particular pp. 246–247 and Fig. 2 at p. 252) clearly teach that affinity tags, including polyhistidine (His) tags, were well known in the art prior to the earliest effective filing date of the claimed invention. Bornhorst et al. further teach that a protein of interest may be expressed as a translational fusion with a His-tag and subsequently purified using Ni²⁺-NTA resin under non-denaturing conditions. It would have been understood by a person of ordinary skill in the art that purification of a protein obviously increases its activity in assays due to the increased concentration of the purified protein relative to crude extracts. Accordingly, one of ordinary skill in the art would have found it obvious to express the Gupta et al. protein fused to a poly-His tag for the purpose of purification using the well-established method of Bornhorst et al. Applicant’s own specification supports this reasoning, acknowledging at page 24, paragraph 5, lines 2–3 from the bottom, that: “The weaker entomotoxic activity of the untagged versus a His-tagged version can be explained by its significantly lower expression in E. coli (Figure 4A).” This admission confirms that any observed differences in activity are attributable to expression levels rather than an unexpected property of the His-tagged protein. Furthermore, Landi et al. teach ribotoxins and their use in treating tumor cells. Tegel et al. teach expression of ribotoxin proteins in bacterial cells under the control of strong heterologous promoters to achieve overproduction. It would have been obvious to one of ordinary skill in the art to combine these teachings with Gupta et al., by overexpressing the Gupta ribotoxin protein in a bacterial system under the control of a strong heterologous promoter, with or without a His-tag, in order to obtain high yields of protein suitable for therapeutic applications. Thus, one of ordinary skill in the art, motivated by the therapeutic applications described by Landi et al., and employing routine techniques for expression and purification as taught by Bornhorst et al. and Tegel et al., would have arrived at the claimed invention with a reasonable expectation of success. No evidence of unexpected results is present, since the increased activity of the tagged protein is explained by increased expression and concentration, as admitted in the specification. Accordingly, the claimed invention would have been obvious to a person of ordinary skill in the art in view of the combined teachings of Bornhorst et al., Landi et al., and Tegel et al. It may be noted that claim 42 has been included in this rejection because claim 42 reads on any type of substitution, including conserved substitutions. 5B. Response to Applicant’s arguments: Applicant asserts that the combination of references fails due to “unexpected expression increase”, “no motivation to combine”, “teaching away”, and “Gupta contains an intron leading to non-functional protein.” These arguments are not persuasive for the following reasons: (i) Motivation to combine exists because protein tagging is a predictable and routine optimization Bornhorst et al. explicitly establishes that His-tag fusion to enable Ni-NTA purification was standard practice in bacterial expression systems prior to filing. A POSITA would have been motivated to tag the Gupta protein to purify it, especially when Landi et al. and Tegel et al. demonstrate therapeutic interest in ribotoxins and bacterial overexpression systems. The combination follows the predictable workflow: (a) obtain gene sequence from fungus (Gupta et al.); (b) clone into bacterial system (Tegel et al./Tegel et al. + ERK2 example); (c) fuse His-tag (Bornhorst); (d) purify by Ni-NTA (Bornhorst et al.); and (e) test toxin activity (Landi et al. shows ribotoxin biological relevance). This is exactly the type of routine optimization KSR deems obvious, where techniques are well-known and applied for their expected purpose. (ii) Applicant’s “unexpected result” is not commensurate with claim scope Even if Applicant observed expression increase in one construct, POSITA would still reasonably expect successful expression, because: (i) Bornhorst et al. shows His-tag does not prevent bacterial expression, proving feasibility; (ii) Applicant admitted activity increase was due to expression level, not a new molecular property; (iii) The claims cover any ≥95% identity ageritin + His-tag, not a specific expression cassette; and (iv) No evidence shows that His-tag fusion produces an unpredictable structural change or new toxin mechanism. At best, Applicant has shown degree of expression improvement, but not failure of the prior art combination, nor any result that falls outside predictable optimization. (iii) “Teaching away” does not apply because Bornhorst et al. do not discourage His-tags—it only states alternatives may also work It is important to note that a reference teaches away only when it criticizes, discredits, or discourages the claimed path. Bornhorst et al. states that other tags may yield higher enrichment, but this is not a criticism of His-tags, nor a statement that His-tags are unsuitable for ribotoxins or Agrocybe proteins. It merely expresses multiple known options, which under KSR actually supports obviousness, since a POSITA would select among finite known choices. Thus, teaching away is not established. (iv) Gupta et al. sequence containing an intron does not defeat obviousness Applicant argues Gupta would lead to a non-functional protein, but the rejection is based on Gupta’s disclosure of the protein sequence itself (100% identical to SEQ ID NO:1), not the unspliced genomic context. A POSITA would obviously use the encoded protein sequence or spliced cDNA for expression, especially when Gupta et al. make the sequence publicly available and identifies it as a coding scaffold. There is no requirement that POSITA would naively express an unspliced genomic BAC when the reference clearly identifies the coding region. Thus, the intron argument does not negate reasonable expectation of success. (v) Combining routine expression + purification methods is exactly what Alice/KSR/IVAX/Pfizer precedent considers obvious Contrary to Applicant’s arguments, it is noted that Applicant has not provided evidence of: (a)structural change altering mechanism; (b) new binding domain created by tag; (iii) loss of activity in tagged version; (iv) or any unexpected result that is outside routine optimization effects. Accordingly, the §103 rejection is fully maintained. Conclusions 6. Claims 22, 24 and 36 remain, and newly added claims 41-44 are rejected. THIS ACTION IS MADE FINAL. Applicant is reminded of the extension of time policy as set forth in 37 CFR 1.136(a). A shortened statutory period for reply to this final action is set to expire THREE MONTHS from the mailing date of this action. In the event a first reply is filed within TWO MONTHS of the mailing date of this final action and the advisory action is not mailed until after the end of the THREE-MONTH shortened statutory period, then the shortened statutory period will expire on the date the advisory action is mailed, and any nonprovisional extension fee (37 CFR 1.17(a)) pursuant to 37 CFR 1.136(a) will be calculated from the mailing date of the advisory action. In no event, however, will the statutory period for reply expire later than SIX MONTHS from the mailing date of this final action. Contact Information Any inquiry concerning this communication or earlier communications from the examiner should be directed to Vinod Kumar whose telephone number is (571)272-4445. The examiner can normally be reached on 8:30 am - 5.00 pm. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Amjad A. Abraham can be reached on (571) 270-7058 The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of an application may be obtained from the Patent Application Information Retrieval (PAIR) system. Status information for published applications may be obtained from either Private PAIR or Public PAIR. Status information for unpublished applications is available through Private PAIR only. For more information about the PAIR system, see http://pair-direct.uspto.gov. Should you have questions on access to the Private PAIR system, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative or access to the automated information system, call 800-786-9199 (IN USA OR CANADA). /VINOD KUMAR/ Primary Examiner, Art Unit 1663
Read full office action

Prosecution Timeline

Jun 21, 2021
Application Filed
Oct 20, 2024
Non-Final Rejection — §101, §103
Jan 21, 2025
Response Filed
Feb 26, 2025
Final Rejection — §101, §103
Sep 02, 2025
Request for Continued Examination
Sep 08, 2025
Response after Non-Final Action
Oct 01, 2025
Non-Final Rejection — §101, §103
Dec 29, 2025
Response Filed
Feb 26, 2026
Final Rejection — §101, §103 (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12599087
SOYBEAN CULTIVAR 24230716
2y 5m to grant Granted Apr 14, 2026
Patent 12599090
SOYBEAN CULTIVAR 21430029
2y 5m to grant Granted Apr 14, 2026
Patent 12599092
SOYBEAN CULTIVAR 25140606
2y 5m to grant Granted Apr 14, 2026
Patent 12599097
SOYBEAN CULTIVAR 28180826
2y 5m to grant Granted Apr 14, 2026
Patent 12593810
ALFALFA VARIETY C0317A3152
2y 5m to grant Granted Apr 07, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

AI Strategy Recommendation

Get an AI-powered prosecution strategy using examiner precedents, rejection analysis, and claim mapping.
Powered by AI — typically takes 5-10 seconds

Prosecution Projections

5-6
Expected OA Rounds
83%
Grant Probability
99%
With Interview (+20.3%)
2y 2m
Median Time to Grant
High
PTA Risk
Based on 1416 resolved cases by this examiner. Grant probability derived from career allow rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month