Prosecution Insights
Last updated: April 19, 2026
Application No. 17/416,975

TRYPSIN VARIANTS WITH IMPROVED ENZYMATIC PROPERTIES

Final Rejection §112
Filed
Jun 21, 2021
Examiner
PAK, YONG D
Art Unit
1652
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
BIOPHARMA TRANSLATIONSINSTITUT DESSAU FORSCHUNGS GMBH
OA Round
4 (Final)
74%
Grant Probability
Favorable
5-6
OA Rounds
3y 0m
To Grant
88%
With Interview

Examiner Intelligence

Grants 74% — above average
74%
Career Allow Rate
685 granted / 924 resolved
+14.1% vs TC avg
Moderate +14% lift
Without
With
+14.0%
Interview Lift
resolved cases with interview
Typical timeline
3y 0m
Avg Prosecution
55 currently pending
Career history
979
Total Applications
across all art units

Statute-Specific Performance

§101
7.0%
-33.0% vs TC avg
§103
21.0%
-19.0% vs TC avg
§102
21.8%
-18.2% vs TC avg
§112
32.6%
-7.4% vs TC avg
Black line = Tech Center average estimate • Based on career data from 924 resolved cases

Office Action

§112
Notice of Pre-AIA or AIA Status The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . DETAILED ACTION This application is a 371 of PCT/EP2019/086425. The response filed on October 15, 2025 has been entered. Election/Restrictions Applicant elected without traverse of Group I with a species election of A2C8 mutant trypsin (SEQ ID NO:1 as the parent polypeptide and Y39H, Y59H, K60E, D189K, H40F, R96E, K97D, L99F, N143E, E151Y, S190V, Q192A, S214G, G219Q, and A221T amino acid substitutions made in the parent) in the reply filed on October 6, 2023. The elected species, A2C8 mutant trypsin (mutant of SEQ ID NO:1, wherein the mutant consists of Y39H, Y59H, K60E, D189K, H40F, R96E, K97D, L99F, N143E, E151Y, S190V, Q192A, S214G, G219Q, and A221T amino acid substitutions (correlating to chymotrypsin nomenclature), is free of the prior art. Therefore, examination has been extended to subsequent species, a mutant trypsin of SEQ ID NO:1, wherein said mutant comprises K60E + D189K +N143H + E151H or K60E + D189K +Y39H + Y59H (correlating to chymotrypsin nomenclature), which are disclosed in the prior art. See the rejections under 102 in the Office Action mailed on July 19, 2024. The amendment filed on December 19, 2024 amended the claims to require at least 6 amino acid substitutions recited in claim 1. Thus, examination has been extended to a subsequent species comprising a combination of at least six amino acid substitutions recited in claim 1. Claims 2 and 27-28 are withdrawn from further consideration pursuant to 37 CFR 1.142(b) as being drawn to a nonelected invention, there being no allowable generic or linking claim. Election was made without traverse in the reply filed on October 6, 2023. Status of Claims Claims 1-2, 15-25, and 27-28 are pending. Claims 2 and 27-28 are withdrawn. Claims 1 and 15-25 are under examination. Response to Amendments/Arguments Claim Rejections - 35 USC § 112(a) The following is a quotation of the first paragraph of 35 U.S.C. 112(a): (a) IN GENERAL.—The specification shall contain a written description of the invention, and of the manner and process of making and using it, in such full, clear, concise, and exact terms as to enable any person skilled in the art to which it pertains, or with which it is most nearly connected, to make and use the same, and shall set forth the best mode contemplated by the inventor or joint inventor of carrying out the invention. The following is a quotation of the first paragraph of pre-AIA 35 U.S.C. 112: The specification shall contain a written description of the invention, and of the manner and process of making and using it, in such full, clear, concise, and exact terms as to enable any person skilled in the art to which it pertains, or with which it is most nearly connected, to make and use the same, and shall set forth the best mode contemplated by the inventor of carrying out his invention. Claims 1 and 15-25 are rejected under 35 U.S.C. 112(a) or 35 U.S.C. 112 (pre-AIA ), first paragraph, as failing to comply with the written description requirement. The claim(s) contains subject matter which was not described in the specification in such a way as to reasonably convey to one skilled in the relevant art that the inventor or a joint inventor, or for pre-AIA the inventor(s), at the time the application was filed, had possession of the claimed invention. MPEP 2111.01 states that ''[d]uring examination, the claims must be interpreted as broadly as their terms reasonably allow.'' In this case, the claims have been broadly interpreted to encompass a mutant of any trypsin, wherein the mutant trypsin comprises a combination of at least six amino acid substitutions recited in claim 1, optionally the amino acid substitutions recited in claims 15-25, and any other amino acid modifications, wherein the mutant trypsin has increased affinity for any nucleophilic substrates and/or reduced hydrolysis activity compared to the trypsin of SEQ ID NO:1. Therefore, the claims are directed to a genus of mutant trypsin having unknown structure but having the function of having increased affinity for any nucleophilic substrates and/or reduced hydrolysis activity compared to the trypsin of SEQ ID NO. MPEP 2163 I. states that to “satisfy the written description requirement, a patent specification must describe the claimed invention in sufficient detail that one skilled in the art can reasonably conclude that the inventor had possession of the claimed invention. MPEP 2163. II.A.3.(a) sates that “Possession may be shown in many ways. For example, possession may be shown by describing an actual reduction to practice of the claimed invention. Possession may also be shown by a clear depiction of the invention in detailed drawings or in structural chemical formulas which permit a person skilled in the art to clearly recognize that inventor had possession of the claimed invention. An adequate written description of the invention may be shown by any description of sufficient, relevant, identifying characteristics so long as a person skilled in the art would recognize that the inventor had possession of the claimed invention. According to MPEP 2163.II.A.3.(a).ii), “Satisfactory disclosure of a ‘representative number’ depends on whether one of skill in the art would recognize that the applicant was in possession of the necessary common attributes or features possessed by the members of the genus in view of the species disclosed. For inventions in an unpredictable art, adequate written description of a genus which embraces widely variant species cannot be achieved by disclosing only one species within the genus…Instead, the disclosure must adequately reflect the structural diversity of the claimed genus, either through the disclosure of sufficient species that are ‘representative of the full variety or scope of the genus,’ or by the establishment of ‘a reasonable structure-function correlation.’" The recitation of “increased affinity for the nucleophilic substrate” and “reduced hydrolysis activity” fails to provide a sufficient description of the genus of the mutant trypsin as it merely describes the functional features of the genus without providing any definition of the structural features of the species within the genus. The specification does not specifically define any of the species that fall within the genus. The specification does not define any structural features commonly possessed by members of the genus that distinguish them from others. One skilled in the art therefore cannot, as one can do with a fully described genus, visualize or recognize the identity of the members of the genus. Rat anionic trypsin II having 100% sequence identity to the Rat anionic trypsin II of SEQ ID NO:1 of the instant application was known in the art, see TRY2_RAT (UnitProtKB/Swiss-Prot. October 25, 2017 – cited previously on form PTO-892 and the sequence alignment below). However, mutant trypsin having unknown structure but having increased affinity for any nucleophilic substrates and/or reduced hydrolysis activity were not known in the art. Fransceus (J Ind Microbiol Biotechnol. 2017 May;44(4-5):687-695. – cited previously on form PTO-892) reviews protein engineering techniques, such as random mutagenesis and recombination, directed evolution and iterative or combinatory saturation “hotspots”. Fransceus states that “a recurring problem, however, is choosing which amino acid positions should be targeted. Answering this question is not an easy feat and requires substantial insight in the relationship between an enzyme’s sequence or structure and its properties.” Sanavia (Computational and Structural Biotechnology Journal, Volume 18, 2020, Pages 1968-1979. – cited previously on form PTO-892) discloses challenges in the prediction of protein stability in the occurrence of multiple mutations. “Multiple-point mutations are common variations of the protein sequence that may be needed in protein engineering when a single-point mutation is not enough to yield the desired stability change. Dealing with multiple-site variations adds another level of complexity beyond the prediction of the effect of a single variant on protein stability, since it requires the learning of many types of combinatorial effects”. The specification is limited to a mutant trypsin of SEQ ID NO:1, wherein the mutant trypsin consists of H23F/Y, A38A/V/S/T, R78E/P, K79H/D/F, L81F/Y/W/M, N123V/D/E/T, E131D/A/T/Y, S172A/V, Q174A/V/F/W, S192G/A, G196Q/P, and A198Q/T which correlate to chymosin nomenclature of H40, A55, R96, K97, L99, N143, E151, S190, Q192, S214, G219, and A221 (see Table 4 at pages 23-24 of the specification and Table 5 at pages) and wherein the mutant trypsin has increased affinity for a nucleophilic substrates and reduced hydrolysis activity compared to the trypsin of SEQ ID NO:1. While MPEP 2163 acknowledges that in certain situations “one species adequately supports a genus,” it also acknowledges that “[f]or inventions in an unpredictable art, adequate written description of a genus which embraces widely variant species cannot be achieved by disclosing only one species within the genus.” In view of the widely variant species encompassed by the genus, the two mutant trypsin of SEQ ID NO:1 described above are not enough and does not constitute a representative number of species to describe the whole genus. Therefore, the specification fails to describe a representative species of the claimed genus. Further, with the aid of a computer, one of skill in the art could identify mutants of trypsin or the rat trypsin of SEQ ID NO:1. However, there is no teaching regarding which amino acids of any trypsin or the trypsin of SEQ ID NO:1, other than H23F/Y, A38A/V/S/T, R78E/P, K79H/D/F, L81F/Y/W/M, N123V/D/E/T, E131D/A/T/Y, S172A/V, Q174A/V/F/W, S192G/A, G196Q/P, and A198Q/T, that can be modified and result in polypeptide having increased affinity for a nucleophilic substrates and reduced hydrolysis activity compared to the unmodified trypsin. An important consideration is that structure is not necessarily a reliable indicator of function. In the instant case, there is no disclosure relating similarity of structure to conservation of function. Conservation of structure is not necessarily a surrogate for conservation of function. Given this lack of description of the representative species encompassed by the genus of the claims, the specification fails to sufficiently describe the claimed invention in such full, clear, concise, and exact terms that a skilled artisan would recognize that applicants were in possession of the inventions of claims 1 and 15-25. Applicant's arguments filed October 15, 2025 have been fully considered but they are not persuasive. Applicant submits that the claims meet the written description requirement because the specification discloses a representative species and the claims recite mutated trypsin comprises (a) at least three of position 78 E/P; position 79 H/D/F; position 81 F/Y/VW/M; position 123 V/D/E/T; position 131 D/A/T/Y; position 172 A/V; and position 174 A/V/F/W; and (b) at least three of position 23 F/Y; position 38 A/V/S/T: position 192 G/A; position 196 Q/P; and position 198 Q/T, and thus 384 species. This is not found persuasive. The claims are not limited to a trypsin variant of SEQ ID NO:1, wherein the trypsin variant consists of the amino acid substitutions recited in claim 1. Instead, the claims are directed to a mutant of any trypsin, wherein the trypsin mutant comprises a combination of at least six amino acid substitutions recited in claim 1 compared to SEQ ID NO:1, optionally the amino acid substitutions recited in claims 15-25, and any other amino acid modifications, wherein the mutant trypsin has increased affinity for any nucleophilic substrates and/or reduced hydrolysis activity compared to the trypsin of SEQ ID NO:1. In view of the widely variant species encompassed by the genus, the trypsin mutants of SEQ ID NO:1 described above are not enough and does not constitute a representative number of species to describe the whole genus. Therefore, the specification fails to describe a representative species of the claimed genus. Further, one of skill in the art could identify mutants of trypsin or the rat trypsin of SEQ ID NO:1. However, there is no teaching regarding which amino acids of any trypsin or the trypsin of SEQ ID NO:1, other than H23F/Y, A38A/V/S/T, R78E/P, K79H/D/F, L81F/Y/W/M, N123V/D/E/T, E131D/A/T/Y, S172A/V, Q174A/V/F/W, S192G/A, G196Q/P, and A198Q/T, that can be modified and result in polypeptide having increased affinity for a nucleophilic substrates and reduced hydrolysis activity compared to the unmodified trypsin. Fransceus (J Ind Microbiol Biotechnol. 2017 May;44(4-5):687-695. – cited previously on form PTO-892) reviews protein engineering techniques, such as random mutagenesis and recombination, directed evolution and iterative or combinatory saturation “hotspots”. Fransceus states that “a recurring problem, however, is choosing which amino acid positions should be targeted. Answering this question is not an easy feat and requires substantial insight in the relationship between an enzyme’s sequence or structure and its properties.” Sanavia (Computational and Structural Biotechnology Journal, Volume 18, 2020, Pages 1968-1979. – cited previously on form PTO-892) discloses challenges in the prediction of protein stability in the occurrence of multiple mutations. “Multiple-point mutations are common variations of the protein sequence that may be needed in protein engineering when a single-point mutation is not enough to yield the desired stability change. Dealing with multiple-site variations adds another level of complexity beyond the prediction of the effect of a single variant on protein stability, since it requires the learning of many types of combinatorial effects”. Hence the rejection is maintained. Conclusion Claims 1-2, 15-25, and 27-28 are pending. Claims 2 and 27-28 are withdrawn. Claims 1 and 15-25 are rejected. THIS ACTION IS MADE FINAL. Applicant is reminded of the extension of time policy as set forth in 37 CFR 1.136(a). A shortened statutory period for reply to this final action is set to expire THREE MONTHS from the mailing date of this action. In the event a first reply is filed within TWO MONTHS of the mailing date of this final action and the advisory action is not mailed until after the end of the THREE-MONTH shortened statutory period, then the shortened statutory period will expire on the date the advisory action is mailed, and any nonprovisional extension fee (37 CFR 1.17(a)) pursuant to 37 CFR 1.136(a) will be calculated from the mailing date of the advisory action. In no event, however, will the statutory period for reply expire later than SIX MONTHS from the mailing date of this final action. Any inquiry concerning this communication or earlier communications from the examiner should be directed to YONG D PAK whose telephone number is (571)272-0935. The examiner can normally be reached M-Th: 5:30 am - 3:30 pm. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Robert Mondesi can be reached on 408-918-7584. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /YONG D PAK/Primary Examiner, Art Unit 1652 Sequence alignment of SEQ ID NO:1 of the instant application (“Qy”) and the trypsin of TRY2_RAT (“Db”) TRY2_RAT ID TRY2_RAT Reviewed; 246 AA. AC P00763; DT 21-JUL-1986, integrated into UniProtKB/Swiss-Prot. DT 15-JUL-1998, sequence version 2. DT 13-SEP-2023, entry version 206. DE RecName: Full=Anionic trypsin-2; DE EC=3.4.21.4; DE AltName: Full=Anionic trypsin II; DE AltName: Full=Pretrypsinogen II; DE AltName: Full=Serine protease 2; DE Flags: Precursor; GN Name=Prss2; Synonyms=Try2; OS Rattus norvegicus (Rat). OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; OC Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; OC Murinae; Rattus. OX NCBI_TaxID=10116; RN [1] RP NUCLEOTIDE SEQUENCE [GENOMIC DNA]. RX PubMed=6094547; DOI=10.1016/s0021-9258(18)89886-6; RA Craik C.S., Choo Q.L., Swift G.H., Quinto C., MacDonald R.J., Rutter W.J.; RT "Structure of two related rat pancreatic trypsin genes."; RL J. Biol. Chem. 259:14255-14264(1984). RN [2] RP NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] OF 9-246. RC STRAIN=Sprague-Dawley; TISSUE=Pancreas; RX PubMed=6896710; DOI=10.1016/s0021-9258(18)34133-4; RA MacDonald R.J., Stary S.J., Swift G.H.; RT "Two similar but nonallelic rat pancreatic trypsinogens. Nucleotide RT sequences of the cloned cDNAs."; RL J. Biol. Chem. 257:9724-9732(1982). RN [3] RP X-RAY CRYSTALLOGRAPHY (2.8 ANGSTROMS). RX PubMed=3112942; DOI=10.1126/science.3112942; RA Sprang S., Standing T., Fletterick R.J., Stroud R.M., Finer-Moore J., RA Xuong N.-H., Hamlin R., Rutter W.J., Craik C.S.; RT "The three-dimensional structure of Asn102 mutant of trypsin: role of RT Asp102 in serine protease catalysis."; RL Science 237:905-909(1987). RN [4] RP X-RAY CRYSTALLOGRAPHY (1.59 ANGSTROMS). RX PubMed=1881877; DOI=10.1002/prot.340100303; RA Earnest T., Fauman E., Craik C.S., Stroud R.; RT "1.59-A structure of trypsin at 120 K: comparison of low temperature and RT room temperature structures."; RL Proteins 10:171-187(1991). RN [5] RP X-RAY CRYSTALLOGRAPHY (2.3 ANGSTROMS). RX PubMed=8634241; DOI=10.1021/bi9530200; RA Brinen L.S., Willett W.S., Craik C.S., Fletterick R.J.; RT "X-ray structures of a designed binding site in trypsin show metal- RT dependent geometry."; RL Biochemistry 35:5999-6009(1996). CC -!- CATALYTIC ACTIVITY: CC Reaction=Preferential cleavage: Arg-|-Xaa, Lys-|-Xaa.; EC=3.4.21.4; CC -!- COFACTOR: CC Name=Ca(2+); Xref=ChEBI:CHEBI:29108; CC Note=Binds 1 Ca(2+) ion per subunit.; CC -!- INTERACTION: CC P00763; P23827: eco; Xeno; NbExp=2; IntAct=EBI-1029166, EBI-1029159; CC -!- SUBCELLULAR LOCATION: Secreted, extracellular space. CC -!- SIMILARITY: Belongs to the peptidase S1 family. {ECO:0000255|PROSITE- CC ProRule:PRU00274}. CC --------------------------------------------------------------------------- CC Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms CC Distributed under the Creative Commons Attribution (CC BY 4.0) License CC --------------------------------------------------------------------------- DR EMBL; V01274; CAA24581.1; -; mRNA. DR EMBL; L00131; AAA98517.1; -; mRNA. DR EMBL; L00130; AAA98517.1; JOINED; Genomic_DNA. DR PIR; A22657; TRRT2. DR RefSeq; NP_036861.1; NM_012729.2. DR PDB; 1AMH; X-ray; 2.50 A; A/B=24-246. DR PDB; 1ANB; X-ray; 2.80 A; A=24-246. DR PDB; 1ANC; X-ray; 2.20 A; A=24-246. DR PDB; 1AND; X-ray; 2.30 A; A=24-246. DR PDB; 1ANE; X-ray; 2.20 A; A=24-246. DR PDB; 1BRA; X-ray; 2.20 A; A=24-246. DR PDB; 1BRB; X-ray; 2.10 A; E=24-246. DR PDB; 1BRC; X-ray; 2.50 A; E=24-246. DR PDB; 1CO7; X-ray; 1.90 A; E=2-246. DR PDB; 1DPO; X-ray; 1.59 A; A=24-246. DR PDB; 1EZS; X-ray; 2.30 A; C/D=24-246. DR PDB; 1EZU; X-ray; 2.40 A; C/D=24-246. DR PDB; 1F5R; X-ray; 1.65 A; A=15-246. DR PDB; 1F7Z; X-ray; 1.55 A; A=15-246. DR PDB; 1FY8; X-ray; 1.70 A; E=15-246. DR PDB; 1J14; X-ray; 2.40 A; A=24-246. DR PDB; 1J15; X-ray; 2.00 A; A=24-246. DR PDB; 1J16; X-ray; 1.60 A; A=24-246. DR PDB; 1J17; X-ray; 2.00 A; T=24-246. DR PDB; 1K9O; X-ray; 2.30 A; E=24-246. DR PDB; 1QL9; X-ray; 2.30 A; A=24-246. DR PDB; 1SLU; X-ray; 1.80 A; B=24-246. DR PDB; 1SLV; X-ray; 2.30 A; B=24-246. DR PDB; 1SLW; X-ray; 2.00 A; B=24-246. DR PDB; 1SLX; X-ray; 2.20 A; B=24-246. DR PDB; 1TRM; X-ray; 2.30 A; A/B=24-246. DR PDB; 1YKT; X-ray; 1.70 A; A=24-246. DR PDB; 1YLC; X-ray; 1.70 A; A=24-246. DR PDB; 1YLD; X-ray; 1.70 A; A=24-246. DR PDB; 2TRM; X-ray; 2.80 A; A=24-246. DR PDB; 3FP6; X-ray; 1.49 A; E=24-246. DR PDB; 3FP7; X-ray; 1.46 A; E=24-246. DR PDB; 3FP8; X-ray; 1.46 A; E=24-246. DR PDB; 3TGI; X-ray; 1.80 A; E=24-246. DR PDB; 3TGJ; X-ray; 2.20 A; E=15-246. DR PDB; 3TGK; X-ray; 1.70 A; E=15-246. DR PDBsum; 1AMH; -. DR PDBsum; 1ANB; -. DR PDBsum; 1ANC; -. DR PDBsum; 1AND; -. DR PDBsum; 1ANE; -. DR PDBsum; 1BRA; -. DR PDBsum; 1BRB; -. DR PDBsum; 1BRC; -. DR PDBsum; 1CO7; -. DR PDBsum; 1DPO; -. DR PDBsum; 1EZS; -. DR PDBsum; 1EZU; -. DR PDBsum; 1F5R; -. DR PDBsum; 1F7Z; -. DR PDBsum; 1FY8; -. DR PDBsum; 1J14; -. DR PDBsum; 1J15; -. DR PDBsum; 1J16; -. DR PDBsum; 1J17; -. DR PDBsum; 1K9O; -. DR PDBsum; 1QL9; -. DR PDBsum; 1SLU; -. DR PDBsum; 1SLV; -. DR PDBsum; 1SLW; -. DR PDBsum; 1SLX; -. DR PDBsum; 1TRM; -. DR PDBsum; 1YKT; -. DR PDBsum; 1YLC; -. DR PDBsum; 1YLD; -. DR PDBsum; 2TRM; -. DR PDBsum; 3FP6; -. DR PDBsum; 3FP7; -. DR PDBsum; 3FP8; -. DR PDBsum; 3TGI; -. DR PDBsum; 3TGJ; -. DR PDBsum; 3TGK; -. DR AlphaFoldDB; P00763; -. DR SMR; P00763; -. DR BioGRID; 247129; 1. DR DIP; DIP-6112N; -. DR IntAct; P00763; 2. DR MINT; P00763; -. DR STRING; 10116.ENSRNOP00000018853; -. DR BindingDB; P00763; -. DR ChEMBL; CHEMBL4290; -. DR MEROPS; S01.119; -. DR iPTMnet; P00763; -. DR PhosphoSitePlus; P00763; -. DR PaxDb; P00763; -. DR Ensembl; ENSRNOT00000095908; ENSRNOP00000082459; ENSRNOG00000064731. DR GeneID; 25052; -. DR KEGG; rno:25052; -. DR UCSC; RGD:3418; rat. DR AGR; RGD:3418; -. DR CTD; 5645; -. DR RGD; 3418; Prss2. DR eggNOG; KOG3627; Eukaryota. DR GeneTree; ENSGT01050000244883; -. DR HOGENOM; CLU_006842_7_0_1; -. DR InParanoid; P00763; -. DR OMA; HPRYSSW; -. DR OrthoDB; 4629979at2759; -. DR PhylomeDB; P00763; -. DR Reactome; R-RNO-1442490; Collagen degradation. DR Reactome; R-RNO-1462054; Alpha-defensins. DR Reactome; R-RNO-1592389; Activation of Matrix Metalloproteinases. DR Reactome; R-RNO-6798695; Neutrophil degranulation. DR Reactome; R-RNO-6803157; Antimicrobial peptides. DR SABIO-RK; P00763; -. DR EvolutionaryTrace; P00763; -. DR PRO; PR:P00763; -. DR Proteomes; UP000002494; Chromosome 4. DR Bgee; ENSRNOG00000032916; Expressed in pancreas and 10 other tissues. DR Genevisible; P00763; RN. DR GO; GO:0005576; C:extracellular region; ISS:UniProtKB. DR GO; GO:0005615; C:extracellular space; ISS:UniProtKB. DR GO; GO:0005509; F:calcium ion binding; ISS:UniProtKB. DR GO; GO:0004252; F:serine-type endopeptidase activity; ISS:UniProtKB. DR GO; GO:0030574; P:collagen catabolic process; ISS:UniProtKB. DR GO; GO:0007586; P:digestion; IEA:UniProtKB-KW. DR GO; GO:0006508; P:proteolysis; ISS:UniProtKB. DR GO; GO:0007584; P:response to nutrient; IEP:RGD. DR CDD; cd00190; Tryp_SPc; 1. DR Gene3D; 2.40.10.10; Trypsin-like serine proteases; 2. DR InterPro; IPR009003; Peptidase_S1_PA. DR InterPro; IPR043504; Peptidase_S1_PA_chymotrypsin. DR InterPro; IPR001314; Peptidase_S1A. DR InterPro; IPR001254; Trypsin_dom. DR InterPro; IPR018114; TRYPSIN_HIS. DR InterPro; IPR033116; TRYPSIN_SER. DR PANTHER; PTHR24264:SF10; PROTEASE, SERINE 1 (TRYPSIN 1)-RELATED; 1. DR PANTHER; PTHR24264; TRYPSIN-RELATED; 1. Query Match 100.0%; Score 1212; Length 246; Best Local Similarity 100.0%; Matches 223; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEG 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 24 IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEG 83 Qy 61 NEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISG 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 84 NEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISG 143 Qy 121 WGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGP 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 144 WGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGP 203 Qy 181 VVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN 223 ||||||||||||||||||||||||||||||||||||||||||| Db 204 VVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN 246 a
Read full office action

Prosecution Timeline

Jun 21, 2021
Application Filed
Nov 16, 2023
Non-Final Rejection — §112
May 21, 2024
Response Filed
Jul 16, 2024
Final Rejection — §112
Dec 19, 2024
Request for Continued Examination
Dec 30, 2024
Response after Non-Final Action
Apr 10, 2025
Non-Final Rejection — §112
Oct 15, 2025
Response Filed
Dec 10, 2025
Final Rejection — §112 (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12595472
MANNANASE VARIANTS
2y 5m to grant Granted Apr 07, 2026
Patent 12590301
METHODS FOR SAFE AND EFFECTIVE THROMBOLYSIS USING SEQUENTIAL ADMINISTRATION OF TISSUE PLASMINOGEN ACTIVATOR AND MUTANT PRO-UROKINASE
2y 5m to grant Granted Mar 31, 2026
Patent 12570964
Bacterium And Obtaining Method And Application Thereof
2y 5m to grant Granted Mar 10, 2026
Patent 12559734
Reverse Transcriptase Mutants with Increased Activity and Thermostability
2y 5m to grant Granted Feb 24, 2026
Patent 12540160
METHODS FOR THE PURIFICATION OF REFOLDED FC-PEPTIDE FUSION PROTEIN
2y 5m to grant Granted Feb 03, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

AI Strategy Recommendation

Get an AI-powered prosecution strategy using examiner precedents, rejection analysis, and claim mapping.
Powered by AI — typically takes 5-10 seconds

Prosecution Projections

5-6
Expected OA Rounds
74%
Grant Probability
88%
With Interview (+14.0%)
3y 0m
Median Time to Grant
High
PTA Risk
Based on 924 resolved cases by this examiner. Grant probability derived from career allow rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month