Prosecution Insights
Last updated: April 19, 2026
Application No. 17/491,761

MATERIALS AND METHODS FOR ENGINEERING CELLS AND USES THEREOF IN IMMUNO-ONCOLOGY

Final Rejection §103§112§DP
Filed
Oct 01, 2021
Examiner
VIJAYARAGHAVAN, JAGAMYA NMN
Art Unit
1633
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
Crispr Therapeutics AG
OA Round
2 (Final)
70%
Grant Probability
Favorable
3-4
OA Rounds
3y 9m
To Grant
99%
With Interview

Examiner Intelligence

Grants 70% — above average
70%
Career Allow Rate
19 granted / 27 resolved
+10.4% vs TC avg
Strong +35% interview lift
Without
With
+34.7%
Interview Lift
resolved cases with interview
Typical timeline
3y 9m
Avg Prosecution
52 currently pending
Career history
79
Total Applications
across all art units

Statute-Specific Performance

§101
5.3%
-34.7% vs TC avg
§103
32.0%
-8.0% vs TC avg
§102
16.5%
-23.5% vs TC avg
§112
32.9%
-7.1% vs TC avg
Black line = Tech Center average estimate • Based on career data from 27 resolved cases

Office Action

§103 §112 §DP
Notice of Pre-AIA or AIA Status The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . Status of Claims Claims 19-20 are withdrawn from further consideration pursuant to 37 CFR 1.142(b). Claims 1-18 are pending and under exam. WITHDRAWN REJECTIONS Claim Rejections - 35 USC § 112 Claims 7-8 rejected under 35 U.S.C. 112(b) or 35 U.S.C. 112 (pre-AIA ), second paragraph, as failing to set forth the subject matter which the inventor or a joint inventor, or for applications subject to pre-AIA 35 U.S.C. 112, the applicant regards as the invention. The rejection is withdrawn in view of claim amendments to clarify the antecedent basis for the nucleic acid sequence encoding CAR that binds CD70. Double Patenting Claims 1-3 and 7-9 are rejected on the ground of nonstatutory double patenting as being unpatentable over claims 1-9 and 1-18 of U.S. Patent No.12,227,763, and 11,649,438 respectively. The rejection is withdrawn in view of the terminal disclaimer filed and approved on 10/31/2025. MAINTAINED REJECTIONS Claim Rejections - 35 USC § 103 Claims 1-2, 5-6 and 9 remain rejected under 35 U.S.C. 103 as being unpatentable over Liu et al (cited in IDS of 12/27/2021, hereinafter "Liu") in view of Marcinkiewicz (Nat Biotechnol, 2017, hereinafter "Marcinkiewicz", See PTO-892), Sadelain (Cancer Discov. 2013 Apr, hereinafter "Sadelain", See PTO-892) and Wang et al (Clin Cancer Res. 2017 May 1, hereinafter "Wang", See PTO-892). Regarding claim 1: Liu Taught that “αβ T-cell receptor (TCR) on allogeneic CAR-T cells needs to be eliminated to avoid graft-versus-host-disease (GVHD), and human leukocyte antigens class I (HLA-Is) on CAR-T cells need to be removed to minimize their immunogenicity.” Liu taught to disrupt TRAC and B2M genes in CAR-T cells as a solution. (See Liu at p. 154, col. 1, 1st para). Liu also found that tumor size in a lymphoma mouse model was substantially smaller in all of the mice treated with standard CAR-T cells and TRAC and B2M disrupted CAR-T cells, whereas progressive tumor growth was observed in the control group treated with unmodified T cells or PBS. (See Liu, p. 157, col. 1, para 3). Liu taught that T R A C - B 2 M - CAR-T cells are “promising reagents for cancer therapy.” (See Liu p. 157, para 1). Liu did not teach CD70 CAR inserted in Trac locus as required by instant claims. Marcinkiewicz taught that the “CRISPR technology [can be used] to insert a B-cell-specific CAR into the TRAC locus, putting the CAR under the control of the endogenous TRAC promoter and simultaneously disrupting the endogenous TCR by knocking out one of its multiple subunits. This elegant move addressed two possible shortcomings of CAR-T cells—variable CAR expression levels and interference from TCR activity.” (See Marcinkiewicz col. 1, para 3). Marcinkiewicz further taught that whether the design can be “broadly applicable to other types of CARs and malignancies remains to be determined. It will be important to test the approach against solid tumors, which have proved difficult to target with CAR-T cells.” (See Marcinkiewicz col. 3, para 2). As such, Sadelain taught the importance of the promoter identity and strength for CAR expression. Specifically, Sadelain taught that “The titration of cytokine secretion by T cells is important because of the potential toxicity of elevated systemic levels. One may address this concern by appropriately calibrating promoter strength or through conditional cytokine release following T cell activation utilizing nuclear factor of activated T cells (NFAT)-inducible promoters.” (See Sadelain p. 5, para 3). As such, a person in reading Marcinkiewicz in view of Sadelain would have been motivated to use the trac locus for expression of a CAR and use an exogenous promoter as taught by Sadelain to optimize cytokine secretion by the CAR. It has been held that "a person with ordinary skill has good reason to pursue the known options within his or her technical grasp. If this leads to the anticipated success, it is likely the product not of innovation but of ordinary skill and common sense." See KSR International Co. v Teleflex, Inc. 82 USPQ2d 1385 at 1390. It is obvious to a person of ordinary skill in the art to try to use exogenous promoters for integration of a CAR into TRAC locus as taught by Marcinkiewicz in view of teachings of Sadelain. None of the cited references taught the use of CD70 CARs for cancer therapy. Wang taught that a lot of tumors express CD70 including solid cancers such as clear cell renal cancer (RCC), glioblastoma, and hematological malignancies, and that it is a potential immunotherapeutic target. Wang taught that CD70 CARs in which different portions of CD27 were fused with various co-stimulatory signaling domains from 41BB and/or CD28, and CD3-zeta, in a murine model was effective in vitro and in vivo, respectively. (See Wang p. 2, para 2). It would have been obvious for a person of ordinary skill in the art to use an exogenous promoter for expression of a CD70 CAR inserted in a TRAC locus of a T-cell, where the TRAC and B2M have been disrupted in view of teachings of the prior art as set forth above. Regarding claim 2: Sadelain taught a NFAT promoter, a eukaryotic promoter. Regarding claims 5 and 6: Liu taught disruption of TRAC and B2M using CRISPR/Cas9. Regarding claim 9: Wang taught CD70 CARs with various co-stimulatory signaling domains from 41BB and/or CD28, and CD3-zeta Claims 3-4, 7-8 and 14-18 are rejected under 35 U.S.C. 103 as being unpatentable over Liu et al (cited in IDS of 12/27/2021, hereinafter "Liu") in view of Marcinkiewicz (Nat Biotechnol, 2017, hereinafter "Marcinkiewicz", See PTO-892 of 5/6/2025), Sadelain (Cancer Discov. 2013 Apr, hereinafter "Sadelain", See PTO-892 of 5/6/2025); Wang et al (Clin Cancer Res. 2017 May 1, hereinafter "Wang", See PTO-892 of 5/6/2025) and Eyquem (cited in IDS of 12/27/2021, hereinafter "Eyquem"). Regarding claims 3 and 4: The teachings of Liu in view of Marcinkiewicz, Sadelain and Wang are set forth above. Briefly, the prior art taught the benefits of a TRAC, B2M disrupted CAR-T-cell for cancer therapy. Additionally, Marcinkiewicz taught the use of TRAC locus for CAR integration but indicated that it remains to be probed for all CAR expression. Sadelain taught the importance of primer strength titration for eliciting appropriate cytokine release from a CAR and Wang taught the use of CD70 CAR for certain cancers. None of the references specifically taught the use of EF-1alpha promoter for CAR expression as required by the claim. Eyquem taught an EF-1alpha promoter for expressing a CAR inserted into a TRAC locus. Eyquem taught that the EF-1alpha promoter was able to elicit much higher CAR expression compared to endogenous TRAC promoter. It would have been obvious for a person of ordinary skill in the art to use a stronger promoter for expression of a CAR. Regarding claims 7-8: Eyquem taught the design of “[a] gRNA to target the first exon of the constant chain of the TCRα gene (TRAC). The sequence targeted is located upstream of the transmembrane domain of the TCRα. This domain is required for the TCRα and β assembly and addressing to the cell-surface. Both, non-homologous end joining (NHEJ) and integration of the CAR by HDR at this locus would then efficiently disrupt the TCR complex.” As such Eyquem taught integrating a CAR at the disrupted TRAC location as required by claim 7. Regarding claim 14: Eyquem taught that a population of cells that have been modified by a CRISPR/Cas9 mediated CAR gene targeted into the TRAC locus. Eyquem observed over 70% TCR- human primary T cells (Page 10, Graph (d)), and over 90% CAR+ cells. Regarding claim 15-18: Eyquem taught that the T cells used in their experiments were taken from healthy donors, see page 7, 1st full ¶. Mice were injected with NALM-6 cells (pre-B acute lymphoblastic leukemia), followed by CAR T cells injected four days later. (Liu et al. taught wherein the cells are allogeneic and wherein the patient has a B-cell malignancy, claims 17-18, page 154, 1st col). Claim 10 are rejected under 35 U.S.C. 103 as being unpatentable over Liu et al (cited in IDS of 12/27/2021, hereinafter "Liu") in view of Marcinkiewicz (Nat Biotechnol, 2017, hereinafter "Marcinkiewicz", See PTO-892 of 5/6/2025), Sadelain (Cancer Discov. 2013 Apr, hereinafter "Sadelain", See PTO-892 of 5/6/2025) and Wang et al (Clin Cancer Res. 2017 May 1, hereinafter "Wang", See PTO-892 of 5/6/2025) and McDonagh et al (US8067546B2; Published 2011-11-29; See IDS filed 12/27/2021; hereinafter "McDonagh). Regarding claim 10: The teachings of Liu in view of Marcinkiewicz, Sadelain and Wang are set forth above. None of the cited prior art taught the use of a CAR comprising an anti-CD70 antigen binding fragment comprising the recited sequences. McDonagh taught an anti-CD70 antigen binding fragment comprising SEQ ID NO: 14 and SEQ ID NO: 24 which are 100% identical to claimed SEQ ID NO: 1592 and SEQ ID NO: 1593 (See Alignment below). McDonagh showed that the treatment of multiple myeloma mice with the CD70 antibody comprising recited sequence prolonged survival of the mice. (See McDonagh, FIGs 7A-C). As such it would have been obvious for a person of ordinary skill in the art to use a CAR comprising the claimed heavy and light chain variable regions comprising the recites sequence. Query 1 QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYGMNWVRQAPGQGLKWMGWINTYTGEPTY 60 QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYGMNWVRQAPGQGLKWMGWINTYTGEPTY Sbjct 1 QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYGMNWVRQAPGQGLKWMGWINTYTGEPTY 60 Query 61 ADAFKGRVTMTRDTSISTAYMELSRLRSDDTAVYYCARDYGDYGMDYWGQGTTVTVSS 118 ADAFKGRVTMTRDTSISTAYMELSRLRSDDTAVYYCARDYGDYGMDYWGQGTTVTVSS Sbjct 61 ADAFKGRVTMTRDTSISTAYMELSRLRSDDTAVYYCARDYGDYGMDYWGQGTTVTVSS 118 SEQ ID NO: 1592 is 100% identical to SEQ ID NO: 14 of McDonagh Query 1 DIVMTQSPDSLAVSLGERATINCRASKSVSTSGYSFMHWYQQKPGQPPKLLIYLASNLES 60 DIVMTQSPDSLAVSLGERATINCRASKSVSTSGYSFMHWYQQKPGQPPKLLIYLASNLES Sbjct 1 DIVMTQSPDSLAVSLGERATINCRASKSVSTSGYSFMHWYQQKPGQPPKLLIYLASNLES 60 Query 61 GVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQHSREVPWTFGQGTKVEIK 111 GVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQHSREVPWTFGQGTKVEIK Sbjct 61 GVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQHSREVPWTFGQGTKVEIK 111 SEQ ID NO: 1593 is 100% identical to SEQ ID NO: 24 of McDonagh Response to Arguments: Applicants argued that the cited references do not teach or suggest all the elements of the claimed invention as “the cited paragraphs from Sadelain refer to expression of exogenous cytokines, and not to expression of a CAR. Specifically, Sadelain references an "approach to enhance the potency of CAR-targeted T cells is to further genetically modify the T cells to secrete pro-inflammatory or pro-proliferative cytokines." (Emphasis added). Thus, Sadelain teaches that secretion of exogenous cytokines can be controlled by calibration of promoter strength, but contain no disclosure relevant to expression of a CAR (which is not excreted) via an exogenous promoter.” Applicant’s arguments have been fully considered but are not persuasive. Applicant’s argument regarding the use of an exogenous promoter is noted. As Applicant pointed out, Sadlein did teach the use of an exogenous promoter for a CAR; however, Sadlein employs the exogenous promoter to modulate cytokine secretion rather than to enhance CAR expression. It is also pointed out that the claims, as presently drafted, do not recite any specific purpose for the exogenous promoter, and therefore, the structural presence of an exogenous promoter in the claimed CARs does not distinguish the claimed subject matter from Sadlein. Even if the claims were amended to recite that an exogenous promoter for the purpose of enhancing CAR expression, the claims would still remain obvious, as Liu, which discloses disruption of TRAC and B2M, Marcinkiewicz, which teaches CAR insertion at the TRAC locus, and Wang, which demonstrates the utility of CD70 CARs for cancer therapy. It would have been obvious to a person of ordinary skill in the art to employ an exogenous promoter in the TRAC locus to express a CD70 CAR and achieve enhanced CAR expression, absent unexpected results. Accordingly, the claimed invention remains obvious over the cited references. As such the claims are obvious over the cited art, because the claims do not recite any specific purpose for the exogenous promoter, and the difference in functional intent between Sadlein and the claimed invention does not render the claimed subject matter non-obvious. Double Patenting The nonstatutory double patenting rejection is based on a judicially created doctrine grounded in public policy (a policy reflected in the statute) so as to prevent the unjustified or improper timewise extension of the “right to exclude” granted by a patent and to prevent possible harassment by multiple assignees. A nonstatutory double patenting rejection is appropriate where the conflicting claims are not identical, but at least one examined application claim is not patentably distinct from the reference claim(s) because the examined application claim is either anticipated by, or would have been obvious over, the reference claim(s). See, e.g., In re Berg, 140 F.3d 1428, 46 USPQ2d 1226 (Fed. Cir. 1998); In re Goodman, 11 F.3d 1046, 29 USPQ2d 2010 (Fed. Cir. 1993); In re Longi, 759 F.2d 887, 225 USPQ 645 (Fed. Cir. 1985); In re Van Ornum, 686 F.2d 937, 214 USPQ 761 (CCPA 1982); In re Vogel, 422 F.2d 438, 164 USPQ 619 (CCPA 1970); In re Thorington, 418 F.2d 528, 163 USPQ 644 (CCPA 1969). A timely filed terminal disclaimer in compliance with 37 CFR 1.321(c) or 1.321(d) may be used to overcome an actual or provisional rejection based on nonstatutory double patenting provided the reference application or patent either is shown to be commonly owned with the examined application, or claims an invention made as a result of activities undertaken within the scope of a joint research agreement. See MPEP § 717.02 for applications subject to examination under the first inventor to file provisions of the AIA as explained in MPEP § 2159. See MPEP § 2146 et seq. for applications not subject to examination under the first inventor to file provisions of the AIA . A terminal disclaimer must be signed in compliance with 37 CFR 1.321(b). The filing of a terminal disclaimer by itself is not a complete reply to a nonstatutory double patenting (NSDP) rejection. A complete reply requires that the terminal disclaimer be accompanied by a reply requesting reconsideration of the prior Office action. Even where the NSDP rejection is provisional the reply must be complete. See MPEP § 804, subsection I.B.1. For a reply to a non-final Office action, see 37 CFR 1.111(a). For a reply to final Office action, see 37 CFR 1.113(c). A request for reconsideration while not provided for in 37 CFR 1.113(c) may be filed after final for consideration. See MPEP §§ 706.07(e) and 714.13. The USPTO Internet website contains terminal disclaimer forms which may be used. Please visit www.uspto.gov/patent/patents-forms. The actual filing date of the application in which the form is filed determines what form (e.g., PTO/SB/25, PTO/SB/26, PTO/AIA /25, or PTO/AIA /26) should be used. A web-based eTerminal Disclaimer may be filled out completely online using web-screens. An eTerminal Disclaimer that meets all requirements is auto-processed and approved immediately upon submission. For more information about eTerminal Disclaimers, refer to www.uspto.gov/patents/apply/applying-online/eterminal-disclaimer. Claims indicated in the table below are provisionally rejected on the ground of nonstatutory double patenting as being unpatentable over claim pending claims of copending Application Nos. 17/776,871, 17/776,846 and 17/776,860 indicated below (reference applications). This is a provisional nonstatutory double patenting rejection because the patentably indistinct claims have not in fact been patented. Although the claims at issue are not identical, they are not patentably distinct from each other. Reference Application/Patent Claim # of reference application/patent Instant claim # 17/776,871 1 1, 18 34 9 35 10 36 11 37 12 17/776,846 1 1, 18 45 9 46 10 47 11 48 12 17/776,860 1 1, 18 34 9 35 10 36 11 37 12 Re. Reference application 17/776,860 and 17/776,846 Claim 1 of the reference applications require treatment of a cancer (as required by instant claim 1), specifically RCC (17/776,860 as required by claim 18) or hematological malignancy (17/776,846 as required by instant claim 18). The pending claim falls within the scope of pending claims 1 and 18, and represents a species of the broader claim 1 of the reference application. Issued claim 1 is therefore considered to anticipate the scope of instant claim. Further as explained below, SEQ ID Nos: 49, 50, 48 and 46 are 100% identical to instant SEQ ID Nos: 1592, 1593, 1500 and 1276 respectively. Query 1 QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYGMNWVRQAPGQGLKWMGWINTYTGEPTY 60 QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYGMNWVRQAPGQGLKWMGWINTYTGEPTY Sbjct 1 QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYGMNWVRQAPGQGLKWMGWINTYTGEPTY 60 Query 61 ADAFKGRVTMTRDTSISTAYMELSRLRSDDTAVYYCARDYGDYGMDYWGQGTTVTVSS 118 ADAFKGRVTMTRDTSISTAYMELSRLRSDDTAVYYCARDYGDYGMDYWGQGTTVTVSS Sbjct 61 ADAFKGRVTMTRDTSISTAYMELSRLRSDDTAVYYCARDYGDYGMDYWGQGTTVTVSS 118 SEQ ID NO: 1592 is 100% identical to SEQ ID NO: 49 of 17/776,871; 17/776,860 and 17/776,846 Query 1 DIVMTQSPDSLAVSLGERATINCRASKSVSTSGYSFMHWYQQKPGQPPKLLIYLASNLES 60 DIVMTQSPDSLAVSLGERATINCRASKSVSTSGYSFMHWYQQKPGQPPKLLIYLASNLES Sbjct 1 DIVMTQSPDSLAVSLGERATINCRASKSVSTSGYSFMHWYQQKPGQPPKLLIYLASNLES 60 Query 61 GVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQHSREVPWTFGQGTKVEIK 111 GVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQHSREVPWTFGQGTKVEIK Sbjct 61 GVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQHSREVPWTFGQGTKVEIK 111 SEQ ID NO: 1593 is 100% identical to SEQ ID NO: 50 of 17/776,871; 17/776,860 and 17/776,846 Query 1 QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYGMNWVRQAPGQGLKWMGWINTYTGEPTY 60 QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYGMNWVRQAPGQGLKWMGWINTYTGEPTY Sbjct 1 QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYGMNWVRQAPGQGLKWMGWINTYTGEPTY 60 Query 61 ADAFKGRVTMTRDTSISTAYMELSRLRSDDTAVYYCARDYGDYGMDYWGQGTTVTVSSGG 120 ADAFKGRVTMTRDTSISTAYMELSRLRSDDTAVYYCARDYGDYGMDYWGQGTTVTVSSGG Sbjct 61 ADAFKGRVTMTRDTSISTAYMELSRLRSDDTAVYYCARDYGDYGMDYWGQGTTVTVSSGG 120 Query 121 GGSGGGGSGGGGSGDIVMTQSPDSLAVSLGERATINCRASKSVSTSGYSFMHWYQQKPGQ 180 GGSGGGGSGGGGSGDIVMTQSPDSLAVSLGERATINCRASKSVSTSGYSFMHWYQQKPGQ Sbjct 121 GGSGGGGSGGGGSGDIVMTQSPDSLAVSLGERATINCRASKSVSTSGYSFMHWYQQKPGQ 180 Query 181 PPKLLIYLASNLESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQHSREVPWTFGQGT 240 PPKLLIYLASNLESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQHSREVPWTFGQGT Sbjct 181 PPKLLIYLASNLESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQHSREVPWTFGQGT 240 Query 241 KVEIK 245 KVEIK Sbjct 241 KVEIK 245 SEQ ID NO: 1500 is 100% identical to SEQ ID NO: 48 of 17/776,871; 17/776,860 and 17/776,846 Query 1 MALPVTALLLPLALLLHAARPQVQLVQSGAEVKKPGASVKVSCKASGYTFTNYGMNWVRQ 60 MALPVTALLLPLALLLHAARPQVQLVQSGAEVKKPGASVKVSCKASGYTFTNYGMNWVRQ Sbjct 1 MALPVTALLLPLALLLHAARPQVQLVQSGAEVKKPGASVKVSCKASGYTFTNYGMNWVRQ 60 Query 61 APGQGLKWMGWINTYTGEPTYADAFKGRVTMTRDTSISTAYMELSRLRSDDTAVYYCARD 120 APGQGLKWMGWINTYTGEPTYADAFKGRVTMTRDTSISTAYMELSRLRSDDTAVYYCARD Sbjct 61 APGQGLKWMGWINTYTGEPTYADAFKGRVTMTRDTSISTAYMELSRLRSDDTAVYYCARD 120 Query 121 YGDYGMDYWGQGTTVTVSSGGGGSGGGGSGGGGSGDIVMTQSPDSLAVSLGERATINCRA 180 YGDYGMDYWGQGTTVTVSSGGGGSGGGGSGGGGSGDIVMTQSPDSLAVSLGERATINCRA Sbjct 121 YGDYGMDYWGQGTTVTVSSGGGGSGGGGSGGGGSGDIVMTQSPDSLAVSLGERATINCRA 180 Query 181 SKSVSTSGYSFMHWYQQKPGQPPKLLIYLASNLESGVPDRFSGSGSGTDFTLTISSLQAE 240 SKSVSTSGYSFMHWYQQKPGQPPKLLIYLASNLESGVPDRFSGSGSGTDFTLTISSLQAE Sbjct 181 SKSVSTSGYSFMHWYQQKPGQPPKLLIYLASNLESGVPDRFSGSGSGTDFTLTISSLQAE 240 Query 241 DVAVYYCQHSREVPWTFGQGTKVEIKSAAAFVPVFLPAKPTTTPAPRPPTPAPTIASQPL 300 DVAVYYCQHSREVPWTFGQGTKVEIKSAAAFVPVFLPAKPTTTPAPRPPTPAPTIASQPL Sbjct 241 DVAVYYCQHSREVPWTFGQGTKVEIKSAAAFVPVFLPAKPTTTPAPRPPTPAPTIASQPL 300 Query 301 SLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRKRGRKK 360 SLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRKRGRKK Sbjct 301 SLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRKRGRKK 360 Query 361 LLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCELRVKFSRSADAPAYQQGQNQLYNEL 420 LLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCELRVKFSRSADAPAYQQGQNQLYNEL Sbjct 361 LLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCELRVKFSRSADAPAYQQGQNQLYNEL 420 Query 421 NLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGK 480 NLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGK Sbjct 421 NLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGK 480 Query 481 GHDGLYQGLSTATKDTYDALHMQALPPR 508 GHDGLYQGLSTATKDTYDALHMQALPPR Sbjct 481 GHDGLYQGLSTATKDTYDALHMQALPPR 508 SEQ ID NO: 1276 is 100% identical to SEQ ID NO: 46 of 17/776,871; 17/776,860 and 17/776,846 Re. Reference application 17/776,871 Claim 1 of the reference application requires treatment of a cancer (as required by instant claim 1 and 18), specifically a CD70+ solid tumor (as required by claim 17) using a T-cell comprising a CAR binding CD70, a disrupted TRAC gene disrupted B2M wherein the CAR is inserted into the disrupted TRAC gene. The pending claim falls within the scope of pending claims 1 and 17-18, and represents a species of the broader claim 1 of the reference application. Issued claim 1 is therefore considered to anticipate the scope of instant claim. Response to Arguments: Applicants argued that the present application has an effective filing date which is earlier than the effective filing date of U.S. Application Nos: 17/776,871, 17/776,846 and 17/776,860, for the 18/289,028. Consequently, pursuant to M.P.E.P. § 1490(VI)(D) this rejection should be withdrawn. It is submitted that according to MPEP 804(I)(B)(1)(b)(i) and MPEP 1490(VI)(D)(2)(a), a provisional nonstatutory double patenting rejection is only withdrawn when it is the only rejection remaining in an application having the earliest effective U.S. filing date (taking into account any benefit under 35 U.S.C. 120, 121, 365(c), or 386(c) ) with respect to the conflicting claims); at which point the "provisional" nonstatutory double patenting rejection in the other (later filed) application(s) will be converted into a nonstatutory double patenting rejection when the application with the earliest U.S. effective filing date issues as a patent. Conclusion Claims 11 - 13 are found free of art. THIS ACTION IS MADE FINAL. Applicant is reminded of the extension of time policy as set forth in 37 CFR 1.136(a). A shortened statutory period for reply to this final action is set to expire THREE MONTHS from the mailing date of this action. In the event a first reply is filed within TWO MONTHS of the mailing date of this final action and the advisory action is not mailed until after the end of the THREE-MONTH shortened statutory period, then the shortened statutory period will expire on the date the advisory action is mailed, and any nonprovisional extension fee (37 CFR 1.17(a)) pursuant to 37 CFR 1.136(a) will be calculated from the mailing date of the advisory action. In no event, however, will the statutory period for reply expire later than SIX MONTHS from the mailing date of this final action. Any inquiry concerning this communication or earlier communications from the examiner should be directed to JAGAMYA VIJAYARAGHAVAN whose telephone number is (703)756-5934. The examiner can normally be reached 9:00a-5:00p. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Christopher M. Babic can be reached at 571-272-8507. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /JAGAMYA NMN VIJAYARAGHAVAN/ Examiner, Art Unit 1633 /EVELYN Y PYLA/Primary Examiner, Art Unit 1633
Read full office action

Prosecution Timeline

Oct 01, 2021
Application Filed
Feb 10, 2023
Response after Non-Final Action
May 01, 2025
Non-Final Rejection — §103, §112, §DP
Oct 31, 2025
Response Filed
Dec 04, 2025
Final Rejection — §103, §112, §DP (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12590136
ENGINEERED T CELLS
2y 5m to grant Granted Mar 31, 2026
Patent 12570987
SYNTHETICALLY EVOLVED DNA CONSTRUCTS FOR REGULATING SIGNAL PEPTIDE PERFORMANCE AS WELL AS VECTORS, HOST CELLS AND RECOMBINANT PROTEINS THEREOF
2y 5m to grant Granted Mar 10, 2026
Patent 12564607
CELL POPULATION COMPRISING MESENCHYMAL CELLS, PHARMACEUTICAL COMPOSITION COMPRISING THE SAME, AND METHOD FOR PRODUCING THE SAME
2y 5m to grant Granted Mar 03, 2026
Patent 12540335
COMPOSITIONS AND METHODS FOR THE TREATMENT OF METABOLIC LIVER DISORDERS
2y 5m to grant Granted Feb 03, 2026
Patent 12527868
MESODERMAL KILLER (MK) CELL
2y 5m to grant Granted Jan 20, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

AI Strategy Recommendation

Get an AI-powered prosecution strategy using examiner precedents, rejection analysis, and claim mapping.
Powered by AI — typically takes 5-10 seconds

Prosecution Projections

3-4
Expected OA Rounds
70%
Grant Probability
99%
With Interview (+34.7%)
3y 9m
Median Time to Grant
Moderate
PTA Risk
Based on 27 resolved cases by this examiner. Grant probability derived from career allow rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month