Prosecution Insights
Last updated: April 19, 2026
Application No. 17/606,414

COMPOSITIONS USEFUL FOR TREATMENT OF POMPE DISEASE

Non-Final OA §103§112§DP
Filed
Oct 25, 2021
Examiner
ROGERS, ERIC JASON
Art Unit
1638
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
Amicus Therapeutics, Inc.
OA Round
2 (Non-Final)
62%
Grant Probability
Moderate
2-3
OA Rounds
3y 10m
To Grant
90%
With Interview

Examiner Intelligence

Grants 62% of resolved cases
62%
Career Allow Rate
56 granted / 90 resolved
+2.2% vs TC avg
Strong +28% interview lift
Without
With
+27.6%
Interview Lift
resolved cases with interview
Typical timeline
3y 10m
Avg Prosecution
51 currently pending
Career history
141
Total Applications
across all art units

Statute-Specific Performance

§101
5.0%
-35.0% vs TC avg
§103
34.6%
-5.4% vs TC avg
§102
15.4%
-24.6% vs TC avg
§112
30.7%
-9.3% vs TC avg
Black line = Tech Center average estimate • Based on career data from 90 resolved cases

Office Action

§103 §112 §DP
Notice of Pre-AIA or AIA Status The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . Claim Status Claims 34-35, 40, 42, 44, 47, 55, 57, 63-64, 71, and 84-92 are currently pending in this application. Election/Restrictions Applicant's election without traverse of Group I, claims 34-35, 40, 42, 47, 51, 55, 57, 63-64, and 71 in the reply filed on Oct. 12, 2024 is acknowledged. Applicant's election is acknowledged of the hGAA780I species encoded by SEQ ID NO: 4, the fusion protein species comprising SEQ ID NO: 6, and the vIGF2 peptide species comprising SEQ ID NO: 44. Claims 34-35, 40, 42, 44, 47, 55, 57, 63-64, 71, and 84-92 have been considered on the merits and all arguments have been fully considered. Previous Rejections Status of the rejections: The previous claim rejections under 112(b) are withdrawn in view of applicant’s claim amendments. Benefit of Priority Claim Acknowledgement is made of applicant’s claim for the benefit of the prior-filed applications US 62/840,0911 and US 62/913,401 under 35 U.S.C. 119(e) or under 35 U.S.C. 120, 121, 365(c), or 386(c). The later-filed application must be an application for a patent for an invention which is also disclosed in the prior application (the parent or original nonprovisional application or provisional application). The disclosure of the invention in the parent application and in the later-filed application must be sufficient to comply with the requirements of 35 U.S.C. 112(a) or the first paragraph of pre-AIA 35 U.S.C. 112, except for the best mode requirement. See Transco Products, Inc. v. Performance Contracting, Inc., 38 F.3d 551, 32 USPQ2d 1077 (Fed. Cir. 1994). The disclosures of US 62/840,0911 fails to provide adequate support or enablement in the manner provided by 35 U.S.C. 112(a) or pre-AIA 35 U.S.C. 112, first paragraph for one or more claims of this application with regard to SEQ ID NOs: 30, 32, 44, 49-54, and 61, therefore the earliest effective filing date of claims 47, 57, 63, 84, and 86-92 is Oct. 10, 2019 based on US 62/913,401. Claim Interpretation The term “vIGF2 peptide” in the claims is interpreted as any peptide that binds a cation-independent mannose 6-phosphate receptor (CI-MPR) as indicated in the instant application at pg. 16, line 30. Claim Rejections - 35 USC § 112(a), New Matter (new) The following is a quotation of the first paragraph of 35 U.S.C. 112(a): (a) IN GENERAL.—The specification shall contain a written description of the invention, and of the manner and process of making and using it, in such full, clear, concise, and exact terms as to enable any person skilled in the art to which it pertains, or with which it is most nearly connected, to make and use the same, and shall set forth the best mode contemplated by the inventor or joint inventor of carrying out the invention. The following is a quotation of the first paragraph of pre-AIA 35 U.S.C. 112: The specification shall contain a written description of the invention, and of the manner and process of making and using it, in such full, clear, concise, and exact terms as to enable any person skilled in the art to which it pertains, or with which it is most nearly connected, to make and use the same, and shall set forth the best mode contemplated by the inventor of carrying out his invention. Claims 44 and 91 are rejected under 35 U.S.C. 112(a) or 35 U.S.C. 112 (pre-AIA ), first paragraph, as failing to comply with the written description requirement. The claim contains subject matter which was not described in the specification in such a way as to reasonably convey to one skilled in the relevant art that the inventor or a joint inventor, or for applications subject to pre-AIA 35 U.S.C. 112, the inventor(s), at the time the application was filed, had possession of the claimed invention. The phrase “miR-183 target sequences” lacks support in the application as filed and thus constitutes new matter. 37 CFR 1.118(a) states “No amendment shall introduce new matter into the disclosure of an application after the filing date of the application”. In the instant case, the recitation of the limitation “dorsal root ganglion (DRG)-specific miR-183 target sequences” is considered new matter. Upon review of the instant specification, examiner could not find explicit or implicit support for these limitations. MPEP 2163.06 notes “If new matter is added to the claims, the examiner should reject the claims under 35 U.S.C. 112, first paragraph-written description requirement”. In re Rasmussen, 650 F.2d 1212, 211 USPQ 323 (CCPA 1981) teaches that “Whenever the issue arises, the fundamental factual inquiry is whether a claim defines an invention that is clearly conveyed to those skilled in the art at the time the application was filed…If a claim is amended to include subject matter, limitation or terminology not present in the application as filed, involving a departure from, addition to, or deletion from the disclosure of the application as filed, the examiner should conclude that the claimed subject matter is not described in that application. MPEP 2163.06 further notes, “When an amendment is filed in reply to an objection or rejection based on U.S.C. 112, first paragraph, a study of the entire application is often necessary to determine whether or not “new matter” is involved. Applicant should therefore specifically point out the support for any amendment made to the disclosure”. This is a new matter rejection. Claim Rejections - 35 USC § 112(b) (new) The following is a quotation of 35 U.S.C. 112(b): (b) CONCLUSION.—The specification shall conclude with one or more claims particularly pointing out and distinctly claiming the subject matter which the inventor or a joint inventor regards as the invention. The following is a quotation of 35 U.S.C. 112 (pre-AIA ), second paragraph: The specification shall conclude with one or more claims particularly pointing out and distinctly claiming the subject matter which the applicant regards as his invention. Claims 34-35, 40, 42, 44, 47, 55, 57, 63-64, 71, and 84-92 are rejected under 35 U.S.C. 112(b) or 35 U.S.C. 112 (pre-AIA ), second paragraph, as being indefinite for failing to particularly point out and distinctly claim the subject matter which the inventor or a joint inventor (or for applications subject to pre-AIA 35 U.S.C. 112, the applicant), regards as the invention. Claims 34 and 86 each recites the term “acid-alpha glucosidase (GAA) peptide,” which encompasses polypeptides of lengths of at least 686 amino acids (e.g., amino acids 204-890, 204-952, 123-890, 70-952 or 70-890 of SEQ ID NO: 3 as in claim 35). However, the ordinary meaning of “peptide” is a shorter polypeptide not longer than 25-50 amino acids. If the applicant acts as her own lexicographer to specifically define a term of a claim contrary to its ordinary meaning, the written description must clearly redefine the claim term and set forth the uncommon definition so as to put one reasonably skilled in the art on notice that the applicant intended to so redefine that claim term. Process Control Corp. v. HydReclaim Corp., 190 F.3d 1350, 1357, 52 USPQ2d 1029, 1033 (Fed. Cir. 1999). Thus, the terms “acid-alpha glucosidase peptide” and “GAA peptide” as used in the claims is incoherent for including much longer polypeptides. Claims 35, 40, 42, 44, 47, 55, 57, 63-64, 71, and 84-92 are included in this rejection for depending from indefinite claim 34 or 86. Claims 34 and 86 each recites the term “vIGF2 peptide,” which encompasses polypeptides of lengths of 64-67 amino acids (e.g., SEQ ID NO: 32 or 44 as in claim 47 and 84). However, the ordinary meaning of “peptide” is a shorter polypeptide not longer than 25-50 amino acids. Claims 35, 40, 42, 44, 47, 55, 57, 63-64, 71, and 84-92 are included in this rejection for depending from indefinite claim 34 or 86. Claim Rejections - 35 USC § 103 (new) The following is a quotation of 35 U.S.C. 103 which forms the basis for all obviousness rejections set forth in this Office action: A patent for a claimed invention may not be obtained, notwithstanding that the claimed invention is not identically disclosed as set forth in section 102, if the differences between the claimed invention and the prior art are such that the claimed invention as a whole would have been obvious before the effective filing date of the claimed invention to a person having ordinary skill in the art to which the claimed invention pertains. Patentability shall not be negated by the manner in which the invention was made. The factual inquiries for establishing a background for determining obviousness under 35 U.S.C. 103 are summarized as follows: 1. Determining the scope and contents of the prior art. 2. Ascertaining the differences between the prior art and the claims at issue. 3. Resolving the level of ordinary skill in the pertinent art. 4. Considering objective evidence present in the application indicating obviousness or nonobviousness. This application currently names joint inventors. In considering patentability of the claims the examiner presumes that the subject matter of the various claims was commonly owned as of the effective filing date of the claimed invention(s) absent any evidence to the contrary. Applicant is advised of the obligation under 37 CFR 1.56 to point out the inventor and effective filing dates of each claim that was not commonly owned as of the effective filing date of the later invention in order for the examiner to consider the applicability of 35 U.S.C. 102(b)(2)(C) for any potential 35 U.S.C. 102(a)(2) prior art against the later invention. Claims 34-35, 40, 42, 55, 71, and 84 are rejected under 35 U.S.C. 103 as being unpatentable over Mingozzi (WO2018/046774; IDS ref.) in view of LeBowitz (US20120148556A1) and EMA (European Medicines Agency Guidelines 2019, EMA/CAT/852602/2018). The claims are interpreted as provided in a previous section. Mingozzi teaches a recombinant adeno-associated virus (rAAV) comprising: (a) an AAV capsid which targets muscle, heart, and/or central nervous system (e.g., AAV1 and AAV8) (pg. 4, lines 10-17); and (b) a vector genome packaged in the AAV capsid (pg.36, line 3, to pg. 37, line 17), said vector genome comprising a nucleic acid sequence encoding a chimeric fusion protein comprising a signal peptide fused to a human GAA sequence (“GAA peptide”) (pg. 9, lines 7-27) (hGAA-delta-8, hGAA-delta-42, hGAA-delta-29, hGAA-delta-43, and hGAA-delta-47 (SEQ ID NOs: 27-28 and 34-36)) comprising instant SEQ ID NO: 61 in the catalytically active site (as shown below for SEQ ID NO: 27) and under control of regulatory sequences that direct its expression (pg. 2, line 21, to pg. 3, line 30), such as for use in treating Pompe disease using enzyme-replacement via gene therapy delivery of recombinant human GAA constructs (pg. 3, lines 29-30; pg. 4, lines 19-21; pg. 34, line 10, to pg. 35, line 24; pg. 44, lines 19-36; pg. 47, line 11, to pg. 48, line, to pg. 51). 99.9% identity in 917 residues overlap; Score: 4920.0; Gap frequency: 0.0% Ins. SEQ 3 36 LLVPRELSGSSPVLEETHPAHQQGASRPGPRDAQAHPGRPRAVPTQCDVPPNSRFDCAPD SEQ ID 27 1 LLVPRELSGSSPVLEETHPAHQQGASRPGPRDAQAHPGRPRAVPTQCDVPPNSRFDCAPD ************************************************************ Ins. SEQ 3 96 KAITQEQCEARGCCYIPAKQGLQGAQMGQPWCFFPPSYPSYKLENLSSSEMGYTATLTRT SEQ ID 27 61 KAITQEQCEARGCCYIPAKQGLQGAQMGQPWCFFPPSYPSYKLENLSSSEMGYTATLTRT ************************************************************ Ins. SEQ 3 156 TPTFFPKDILTLRLDVMMETENRLHFTIKDPANRRYEVPLETPHVHSRAPSPLYSVEFSE SEQ ID 27 121 TPTFFPKDILTLRLDVMMETENRLHFTIKDPANRRYEVPLETPHVHSRAPSPLYSVEFSE ************************************************************ Ins. SEQ 3 216 EPFGVIVRRQLDGRVLLNTTVAPLFFADQFLQLSTSLPSQYITGLAEHLSPLMLSTSWTR SEQ ID 27 181 EPFGVIVRRQLDGRVLLNTTVAPLFFADQFLQLSTSLPSQYITGLAEHLSPLMLSTSWTR ************************************************************ Ins. SEQ 3 276 ITLWNRDLAPTPGANLYGSHPFYLALEDGGSAHGVFLLNSNAMDVVLQPSPALSWRSTGG SEQ ID 27 241 ITLWNRDLAPTPGANLYGSHPFYLALEDGGSAHGVFLLNSNAMDVVLQPSPALSWRSTGG ************************************************************ Ins. SEQ 3 336 ILDVYIFLGPEPKSVVQQYLDVVGYPFMPPYWGLGFHLCRWGYSSTAITRQVVENMTRAH SEQ ID 27 301 ILDVYIFLGPEPKSVVQQYLDVVGYPFMPPYWGLGFHLCRWGYSSTAITRQVVENMTRAH ************************************************************ Ins. SEQ 3 396 FPLDVQWNDLDYMDSRRDFTFNKDGFRDFPAMVQELHQGGRRYMMIVDPAISSSGPAGSY SEQ ID 27 361 FPLDVQWNDLDYMDSRRDFTFNKDGFRDFPAMVQELHQGGRRYMMIVDPAISSSGPAGSY ************************************************************ Ins. SEQ 3 456 RPYDEGLRRGVFITNETGQPLIGKVWPGSTAFPDFTNPTALAWWEDMVAEFHDQVPFDGM SEQ ID 27 421 RPYDEGLRRGVFITNETGQPLIGKVWPGSTAFPDFTNPTALAWWEDMVAEFHDQVPFDGM ************************************************************ Ins. SEQ 3 516 WIDMNEPSNFIRGSEDGCPNNELENPPYVPGVVGGTLQAATICASSHQFLSTHYNLHNLY SEQ ID 27 481 WIDMNEPSNFIRGSEDGCPNNELENPPYVPGVVGGTLQAATICASSHQFLSTHYNLHNLY ************************************************************ Ins. SEQ 3 576 GLTEAIA SHRALVKARGTRPFVISRSTFAGHGRYAGHWTGDVWSSWEQLASSVPEILQFN SEQ ID 27 541 GLTEAIA SHRALVKARGTRPFVISRSTFAGHGRYAGHWTGDVWSSWEQLASSVPEILQFN ************************************************************ Ins. SEQ 3 636 LLGVPLVGADVCGFLGNTSEELCVRWTQLGAFYPFMRNHNSLLSLPQEPYSFSEPAQQAM SEQ ID 27 601 LLGVPLVGADVCGFLGNTSEELCVRWTQLGAFYPFMRNHNSLLSLPQEPYSFSEPAQQAM ************************************************************ Ins. SEQ 3 696 RKALTLRYALLPHLYTLFHQAHVAGETVARPLFLEFPKDSSTWTVDHQLLWGEALLITPV SEQ ID 27 661 RKALTLRYALLPHLYTLFHQAHVAGETVARPLFLEFPKDSSTWTVDHQLLWGEALLITPV ************************************************************ Ins. SEQ 3 756 LQAGKAEVTGYFPLGTWYDLQTVPIEALGSLPPPPAAPREPAIHSEGQWVTLPAPLDTIN SEQ ID 27 721 LQAGKAEVTGYFPLGTWYDLQTVPVEALGSLPPPPAAPREPAIHSEGQWVTLPAPLDTIN ************************ *********************************** Ins. SEQ 3 816 VHLRAGYIIPLQGPGLTTTESRQQPMALAVALTKGGEARGELFWDDGESLEVLERGAYTQ SEQ ID 27 781 VHLRAGYIIPLQGPGLTTTESRQQPMALAVALTKGGEARGELFWDDGESLEVLERGAYTQ ************************************************************ Ins. SEQ 3 876 VIFLARNNTIVNELVRVTSEGAGLQLQKVTVLGVATAPQQVLSNGVPVSNFTYSPDTKVL SEQ ID 27 841 VIFLARNNTIVNELVRVTSEGAGLQLQKVTVLGVATAPQQVLSNGVPVSNFTYSPDTKVL ************************************************************ Ins. SEQ 3 936 DICVSLLMGEQFLVSWC SEQ ID 27 901 DICVSLLMGEQFLVSWC ***************** Regarding claim 34, Mingozzi does not teach wherein the GAA fusion protein comprises a vIGF2 peptide and an isoleucine at position 780 based on the numbering of the sequence in SEQ ID NO: 3. However LeBowitz teaches hGAA fusion proteins ([0014]) comprising a peptide at least 75% identical to a human IGF2 sequence (vIGF2 peptide) (SEQ ID NO: 1) for lysosomal targeting via binding CI-MPR wherein the human GAA polypeptide component (SEQ ID NO: 2) comprises an isoleucine at position 780 based on the numbering of the positions in instant SEQ ID NO: 3, as shown below, wherein the GAA has a sequence over 95% identical to 70-952 of instant SEQ ID NO: 3 ([0014]-[0016]; [0045]-[0046]; [0064]-[0066]; [0071]; [0002]). 99.7% identity in 885 residues overlap; Score: 4734.0; Gap frequency: 0.0% Ins. SEQ 3 68 AQAHPGRPRAVPTQCDVPPNSRFDCAPDKAITQEQCEARGCCYIPAKQGLQGAQMGQPWC SEQ ID 2 63 APAHPGRPRAVPTQCDVPPNSRFDCAPDKAITQEQCEARGCCYIPAKQGLQGAQMGQPWC * ********************************************************** Ins. SEQ 3 128 FFPPSYPSYKLENLSSSEMGYTATLTRTTPTFFPKDILTLRLDVMMETENRLHFTIKDPA SEQ ID 2 123 FFPPSYPSYKLENLSSSEMGYTATLTRTTPTFFPKDILTLRLDVMMETENRLHFTIKDPA ************************************************************ Ins. SEQ 3 188 NRRYEVPLETPHVHSRAPSPLYSVEFSEEPFGVIVRRQLDGRVLLNTTVAPLFFADQFLQ SEQ ID 2 183 NRRYEVPLETPRVHSRAPSPLYSVEFSEEPFGVIVHRQLDGRVLLNTTVAPLFFADQFLQ *********** *********************** ************************ Ins. SEQ 3 248 LSTSLPSQYITGLAEHLSPLMLSTSWTRITLWNRDLAPTPGANLYGSHPFYLALEDGGSA SEQ ID 2 243 LSTSLPSQYITGLAEHLSPLMLSTSWTRITLWNRDLAPTPGANLYGSHPFYLALEDGGSA ************************************************************ Ins. SEQ 3 308 HGVFLLNSNAMDVVLQPSPALSWRSTGGILDVYIFLGPEPKSVVQQYLDVVGYPFMPPYW SEQ ID 2 303 HGVFLLNSNAMDVVLQPSPALSWRSTGGILDVYIFLGPEPKSVVQQYLDVVGYPFMPPYW ************************************************************ Ins. SEQ 3 368 GLGFHLCRWGYSSTAITRQVVENMTRAHFPLDVQWNDLDYMDSRRDFTFNKDGFRDFPAM SEQ ID 2 363 GLGFHLCRWGYSSTAITRQVVENMTRAHFPLDVQWNDLDYMDSRRDFTFNKDGFRDFPAM ************************************************************ Ins. SEQ 3 428 VQELHQGGRRYMMIVDPAISSSGPAGSYRPYDEGLRRGVFITNETGQPLIGKVWPGSTAF SEQ ID 2 423 VQELHQGGRRYMMIVDPAISSSGPAGSYRPYDEGLRRGVFITNETGQPLIGKVWPGSTAF ************************************************************ Ins. SEQ 3 488 PDFTNPTALAWWEDMVAEFHDQVPFDGMWIDMNEPSNFIRGSEDGCPNNELENPPYVPGV SEQ ID 2 483 PDFTNPTALAWWEDMVAEFHDQVPFDGMWIDMNEPSNFIRGSEDGCPNNELENPPYVPGV ************************************************************ Ins. SEQ 3 548 VGGTLQAATICASSHQFLSTHYNLHNLYGLTEAIA SHRALVKARGTRPFVISRSTFAGHG SEQ ID 2 543 VGGTLQAATICASSHQFLSTHYNLHNLYGLTEAIA SHRALVKARGTRPFVISRSTFAGHG ************************************************************ Ins. SEQ 3 608 RYAGHWTGDVWSSWEQLASSVPEILQFNLLGVPLVGADVCGFLGNTSEELCVRWTQLGAF SEQ ID 2 603 RYAGHWTGDVWSSWEQLASSVPEILQFNLLGVPLVGADVCGFLGNTSEELCVRWTQLGAF ************************************************************ Ins. SEQ 3 668 YPFMRNHNSLLSLPQEPYSFSEPAQQAMRKALTLRYALLPHLYTLFHQAHVAGETVARPL SEQ ID 2 663 YPFMRNHNSLLSLPQEPYSFSEPAQQAMRKALTLRYALLPHLYTLFHQAHVAGETVARPL ************************************************************ Ins. SEQ 3 728 FLEFPKDSSTWTVDHQLLWGEALLITPVLQAGKAEVTGYFPLGTWYDLQTVPIEALGSLP SEQ ID 2 723 FLEFPKDSSTWTVDHQLLWGEALLITPVLQAGKAEVTGYFPLGTWYDLQTVPIEALGSLP ************************************************************ Ins. SEQ 3 788 PPPAAPREPAIHSEGQWVTLPAPLDTINVHLRAGYIIPLQGPGLTTTESRQQPMALAVAL SEQ ID 2 783 PPPAAPREPAIHSEGQWVTLPAPLDTINVHLRAGYIIPLQGPGLTTTESRQQPMALAVAL ************************************************************ Ins. SEQ 3 848 TKGGEARGELFWDDGESLEVLERGAYTQVIFLARNNTIVNELVRVTSEGAGLQLQKVTVL SEQ ID 2 843 TKGGEARGELFWDDGESLEVLERGAYTQVIFLARNNTIVNELVRVTSEGAGLQLQKVTVL ************************************************************ Ins. SEQ 3 908 GVATAPQQVLSNGVPVSNFTYSPDTKVLDICVSLLMGEQFLVSWC SEQ ID 2 903 GVATAPQQVLSNGVPVSNFTYSPDTKVLDICVSLLMGEQFLVSWC ********************************************* LeBowitz teaches using these fusion proteins in enzyme replacement therapy to treat Pompe disease by administration to a subject ([0018]; [0047]; [0057]). Furthermore, EMA teaches using recombinant AAV viruses to infect human host cells in vitro to evaluate and confirm functionality of Gene Therapy Investigational Medicinal Products (GTIMPs) to characterize and quantify potency before moving on to investigating in vivo applications in human subjects (pg. 40, lines 1497-1511). It would have been prima facie obvious to one of ordinary skill in the art before the effective time of filing to use the GAA fusion protein taught by LeBowitz in an AAV viral delivery transgenic system taught by Mingozzi for testing potency preclinically in host cells as taught by EMA. One of ordinary skill in the art would be motivated to because LeBowitz teaches such fusion proteins have potential uses in enzyme replacement therapies for GAA-deficiencies but that further research is warranted on targeted lysosomal delivery and improved pharmacological formulations before in vivo gene therapy uses. Regarding claim 35, the fusion proteins taught by LeBowitz have GAA sequences over 95% identical to 204-890, 204-952, 123-890, 70-952, and 70-890 of instant SEQ ID NO: 3 as shown above. Regarding claim 40, Mingozzi teaches basing the GAA encoding construct on a wildtype human GAA coding sequence (SEQ ID NO: 8, Examples) that is over 95% identical to instant SEQ ID NO: 5, as shown below. 99.7% identity in 2859 residues overlap; Score: 18573.0; Gap frequency: 0.0% SEQ ID 5 1 ATGGGAGTGAGGCACCCGCCCTGCTCCCACCGGCTCCTGGCCGTCTGCGCCCTCGTGTCC SEQ ID 8 1 ATGGGAGTGAGGCACCCGCCCTGCTCCCACCGGCTCCTGGCCGTCTGCGCCCTCGTGTCC ************************************************************ SEQ ID 5 61 TTGGCAACCGCTGCACTCCTGGGGCACATCCTACTCCATGATTTCCTGCTGGTTCCCCGA SEQ ID 8 61 TTGGCAACCGCAGCGCTCCTGGGGCACATCCTACTCCATGATTTCCTGCTGGTTCCCCGA *********** ** ********************************************* SEQ ID 5 121 GAGCTGAGTGGCTCCTCCCCAGTCCTGGAGGAGACTCACCCAGCTCACCAGCAGGGAGCC SEQ ID 8 121 GAGCTGAGTGGCTCCTCCCCAGTCCTGGAGGAGACTCACCCAGCTCACCAGCAGGGAGCC ************************************************************ SEQ ID 5 181 AGTAGACCAGGGCCCCGGGATGCCCAGGCACACCCCGGCCGTCCCAGAGCAGTGCCCACA SEQ ID 8 181 AGCAGACCAGGGCCCCGGGATGCCCAGGCACACCCCGGGCGGCCGCGAGCAGTGCCCACA ** *********************************** ** ** ************** SEQ ID 5 241 CAGTGCGACGTCCCCCCCAACAGCCGCTTCGATTGCGCCCCTGACAAGGCCATCACCCAG SEQ ID 8 241 CAGTGCGACGTCCCCCCCAACAGCCGCTTCGATTGCGCCCCTGACAAGGCCATCACCCAG ************************************************************ SEQ ID 5 301 GAACAGTGCGAGGCCCGCGGCTGTTGCTACATCCCTGCAAAGCAGGGGCTGCAGGGAGCC SEQ ID 8 301 GAACAGTGCGAGGCCCGCGGCTGTTGCTACATCCCTGCAAAGCAGGGGCTGCAGGGAGCC ************************************************************ SEQ ID 5 361 CAGATGGGGCAGCCCTGGTGCTTCTTCCCACCCAGCTACCCCAGCTACAAGCTGGAGAAC SEQ ID 8 361 CAGATGGGGCAGCCCTGGTGCTTCTTCCCACCCAGCTACCCCAGCTACAAGCTGGAGAAC ************************************************************ SEQ ID 5 421 CTGAGCTCCTCTGAAATGGGCTACACGGCCACCCTGACCCGTACCACCCCCACCTTCTTC SEQ ID 8 421 CTGAGCTCCTCTGAAATGGGCTACACGGCCACCCTGACCCGTACCACCCCCACCTTCTTC ************************************************************ SEQ ID 5 481 CCCAAGGACATCCTGACCCTGCGGCTGGACGTGATGATGGAGACTGAGAACCGCCTCCAC SEQ ID 8 481 CCCAAGGACATCCTGACCCTGCGGCTGGACGTGATGATGGAGACTGAGAACCGCCTCCAC ************************************************************ SEQ ID 5 541 TTCACGATCAAAGATCCAGCTAACAGGCGCTACGAGGTGCCCTTGGAGACCCCGCATGTC SEQ ID 8 541 TTCACGATCAAAGATCCAGCTAACAGGCGCTACGAGGTGCCCTTGGAGACCCCGCATGTC ************************************************************ SEQ ID 5 601 CACAGCCGGGCACCGTCCCCACTCTACAGCGTGGAGTTCTCCGAGGAGCCCTTCGGGGTG SEQ ID 8 601 CACAGCCGGGCACCGTCCCCACTCTACAGCGTGGAGTTCTCCGAGGAGCCCTTCGGGGTG ************************************************************ SEQ ID 5 661 ATCGTGCGCCGGCAGCTGGACGGCCGCGTGCTGCTGAACACGACGGTGGCGCCCCTGTTC SEQ ID 8 661 ATCGTGCGCCGGCAGCTGGACGGCCGCGTGCTGCTGAACACGACGGTGGCGCCCCTGTTC ************************************************************ SEQ ID 5 721 TTTGCGGACCAGTTCCTTCAGCTGTCCACCTCGCTGCCCTCGCAGTATATCACAGGCCTC SEQ ID 8 721 TTTGCGGACCAGTTCCTTCAGCTGTCCACCTCGCTGCCCTCGCAGTATATCACAGGCCTC ************************************************************ SEQ ID 5 781 GCCGAGCACCTCAGTCCCCTGATGCTCAGCACCAGCTGGACCAGGATCACCCTGTGGAAC SEQ ID 8 781 GCCGAGCACCTCAGTCCCCTGATGCTCAGCACCAGCTGGACCAGGATCACCCTGTGGAAC ************************************************************ SEQ ID 5 841 CGGGACCTTGCGCCCACGCCCGGTGCGAACCTCTACGGGTCTCACCCTTTCTACCTGGCG SEQ ID 8 841 CGGGACCTTGCGCCCACGCCCGGTGCGAACCTCTACGGGTCTCACCCTTTCTACCTGGCG ************************************************************ SEQ ID 5 901 CTGGAGGACGGCGGGTCGGCACACGGGGTGTTCCTGCTAAACAGCAATGCCATGGATGTG SEQ ID 8 901 CTGGAGGACGGCGGGTCGGCACACGGGGTGTTCCTGCTAAACAGCAATGCCATGGATGTG ************************************************************ SEQ ID 5 961 GTCCTGCAGCCGAGCCCTGCCCTTAGCTGGAGGTCGACAGGTGGGATCCTGGATGTCTAC SEQ ID 8 961 GTCCTGCAGCCGAGCCCTGCCCTTAGCTGGAGGTCGACAGGTGGGATCCTGGATGTCTAC ************************************************************ SEQ ID 5 1021 ATCTTCCTGGGCCCAGAGCCCAAGAGCGTGGTGCAGCAGTACCTGGACGTTGTGGGATAC SEQ ID 8 1021 ATCTTCCTGGGCCCAGAGCCCAAGAGCGTGGTGCAGCAGTACCTGGACGTTGTGGGATAC ************************************************************ SEQ ID 5 1081 CCGTTCATGCCGCCATACTGGGGCCTGGGCTTCCACCTGTGCCGCTGGGGCTACTCCTCC SEQ ID 8 1081 CCGTTCATGCCGCCATACTGGGGCCTGGGCTTCCACCTGTGCCGCTGGGGCTACTCCTCC ************************************************************ SEQ ID 5 1141 ACCGCTATCACCCGCCAGGTGGTGGAGAACATGACCAGGGCCCACTTCCCCCTGGACGTC SEQ ID 8 1141 ACCGCTATCACCCGCCAGGTGGTGGAGAACATGACCAGGGCCCACTTCCCCCTGGACGTC ************************************************************ SEQ ID 5 1201 CAGTGGAACGACCTGGACTACATGGACTCCCGGAGGGACTTCACGTTCAACAAGGATGGC SEQ ID 8 1201 CAGTGGAACGACCTGGACTACATGGACTCCCGGAGGGACTTCACGTTCAACAAGGATGGC ************************************************************ SEQ ID 5 1261 TTCCGGGACTTCCCGGCCATGGTGCAGGAGCTGCACCAGGGCGGCCGGCGCTACATGATG SEQ ID 8 1261 TTCCGGGACTTCCCGGCCATGGTGCAGGAGCTGCACCAGGGCGGCCGGCGCTACATGATG ************************************************************ SEQ ID 5 1321 ATCGTGGATCCTGCCATCAGCAGCTCGGGCCCTGCCGGGAGCTACAGGCCCTACGACGAG SEQ ID 8 1321 ATCGTGGATCCTGCCATCAGCAGCTCGGGCCCTGCCGGGAGCTACAGGCCCTACGACGAG ************************************************************ SEQ ID 5 1381 GGTCTGCGGAGGGGGGTTTTCATCACCAACGAGACCGGCCAGCCGCTGATTGGGAAGGTA SEQ ID 8 1381 GGTCTGCGGAGGGGGGTTTTCATCACCAACGAGACCGGCCAGCCGCTGATTGGGAAGGTA ************************************************************ SEQ ID 5 1441 TGGCCCGGGTCCACTGCCTTCCCCGACTTCACCAACCCCACAGCCCTGGCCTGGTGGGAG SEQ ID 8 1441 TGGCCCGGGTCCACTGCCTTCCCCGACTTCACCAACCCCACAGCCCTGGCCTGGTGGGAG ************************************************************ SEQ ID 5 1501 GACATGGTGGCTGAGTTCCATGACCAGGTGCCCTTCGACGGCATGTGGATTGACATGAAC SEQ ID 8 1501 GACATGGTGGCTGAGTTCCATGACCAGGTGCCCTTCGACGGCATGTGGATTGACATGAAC ************************************************************ SEQ ID 5 1561 GAGCCTTCCAACTTCATCAGGGGCTCTGAGGACGGCTGCCCCAACAATGAGCTGGAGAAC SEQ ID 8 1561 GAGCCTTCCAACTTCATCAGGGGCTCTGAGGACGGCTGCCCCAACAATGAGCTGGAGAAC ************************************************************ SEQ ID 5 1621 CCACCCTACGTGCCTGGGGTGGTTGGGGGGACCCTCCAGGCGGCCACCATCTGTGCCTCC SEQ ID 8 1621 CCACCCTACGTGCCTGGGGTGGTTGGGGGGACCCTCCAGGCGGCCACCATCTGTGCCTCC ************************************************************ SEQ ID 5 1681 AGCCACCAGTTTCTCTCCACACACTACAACCTGCACAACCTCTACGGCCTGACCGAAGCC SEQ ID 8 1681 AGCCACCAGTTTCTCTCCACACACTACAACCTGCACAACCTCTACGGCCTGACCGAAGCC ************************************************************ SEQ ID 5 1741 ATCGCCTCCCACAGGGCGCTGGTGAAGGCTCGGGGGACACGCCCATTTGTGATCTCCCGC SEQ ID 8 1741 ATCGCCTCCCACAGGGCGCTGGTGAAGGCTCGGGGGACACGCCCATTTGTGATCTCCCGC ************************************************************ SEQ ID 5 1801 TCGACCTTTGCTGGCCACGGCCGATACGCCGGCCACTGGACGGGGGACGTGTGGAGCTCC SEQ ID 8 1801 TCGACCTTTGCTGGCCACGGCCGATACGCCGGCCACTGGACGGGGGACGTGTGGAGCTCC ************************************************************ SEQ ID 5 1861 TGGGAGCAGCTCGCCTCCTCCGTGCCAGAAATCCTGCAGTTTAACCTGCTGGGGGTGCCT SEQ ID 8 1861 TGGGAGCAGCTCGCCTCCTCCGTGCCAGAAATCCTGCAGTTTAACCTGCTGGGGGTGCCT ************************************************************ SEQ ID 5 1921 CTGGTCGGGGCCGACGTCTGCGGCTTCCTGGGCAACACCTCAGAGGAGCTGTGTGTGCGC SEQ ID 8 1921 CTGGTCGGGGCCGACGTCTGCGGCTTCCTGGGCAACACCTCAGAGGAGCTGTGTGTGCGC ************************************************************ SEQ ID 5 1981 TGGACCCAGCTGGGGGCCTTCTACCCCTTCATGCGGAACCACAACAGCCTGCTCAGTCTG SEQ ID 8 1981 TGGACCCAGCTGGGGGCCTTCTACCCCTTCATGCGGAACCACAACAGCCTGCTCAGTCTG ************************************************************ SEQ ID 5 2041 CCCCAGGAGCCGTACAGCTTCAGCGAGCCGGCCCAGCAGGCCATGAGGAAGGCCCTCACC SEQ ID 8 2041 CCCCAGGAGCCGTACAGCTTCAGCGAGCCGGCCCAGCAGGCCATGAGGAAGGCCCTCACC ************************************************************ SEQ ID 5 2101 CTGCGCTACGCACTCCTCCCCCACCTCTACACACTGTTCCACCAGGCCCACGTCGCGGGG SEQ ID 8 2101 CTGCGCTACGCACTCCTCCCCCACCTCTACACACTGTTCCACCAGGCCCACGTCGCGGGG ************************************************************ SEQ ID 5 2161 GAGACCGTGGCCCGGCCCCTCTTCCTGGAGTTCCCCAAGGACTCTAGCACCTGGACTGTG SEQ ID 8 2161 GAGACCGTGGCCCGGCCCCTCTTCCTGGAGTTCCCCAAGGACTCTAGCACCTGGACTGTG ************************************************************ SEQ ID 5 2221 GACCACCAGCTCCTGTGGGGGGAGGCCCTGCTCATCACCCCAGTGCTCCAGGCCGGGAAG SEQ ID 8 2221 GACCACCAGCTCCTGTGGGGGGAGGCCCTGCTCATCACCCCAGTGCTCCAGGCCGGGAAG ************************************************************ SEQ ID 5 2281 GCCGAAGTGACTGGCTACTTCCCCTTGGGCACATGGTACGACCTGCAGACGGTGCCAATA SEQ ID 8 2281 GCCGAAGTGACTGGCTACTTCCCCTTGGGCACATGGTACGACCTGCAGACGGTGCCAGTA ********************************************************* ** SEQ ID 5 2341 GAGGCCCTTGGCAGCCTCCCACCCCCACCTGCAGCTCCCCGTGAGCCAGCCATCCACAGC SEQ ID 8 2341 GAGGCCCTTGGCAGCCTCCCACCCCCACCTGCAGCTCCCCGTGAGCCAGCCATCCACAGC ************************************************************ SEQ ID 5 2401 GAGGGGCAGTGGGTGACGCTGCCGGCCCCCCTGGACACCATCAACGTCCACCTCCGGGCT SEQ ID 8 2401 GAGGGGCAGTGGGTGACGCTGCCGGCCCCCCTGGACACCATCAACGTCCACCTCCGGGCT ************************************************************ SEQ ID 5 2461 GGGTACATCATCCCCCTGCAGGGCCCTGGCCTCACAACCACAGAGTCCCGCCAGCAGCCC SEQ ID 8 2461 GGGTACATCATCCCCCTGCAGGGCCCTGGCCTCACAACCACAGAGTCCCGCCAGCAGCCC ************************************************************ SEQ ID 5 2521 ATGGCCCTGGCTGTGGCCCTGACCAAGGGTGGGGAGGCCCGAGGGGAGCTTTTCTGGGAC SEQ ID 8 2521 ATGGCCCTGGCTGTGGCCCTGACCAAGGGTGGGGAGGCCCGAGGGGAGCTGTTCTGGGAC ************************************************** ********* SEQ ID 5 2581 GATGGAGAGAGCCTGGAAGTGCTGGAGCGAGGGGCCTACACACAGGTCATCTTCCTGGCC SEQ ID 8 2581 GATGGAGAGAGCCTGGAAGTGCTGGAGCGAGGGGCCTACACACAGGTCATCTTCCTGGCC ************************************************************ SEQ ID 5 2641 AGGAATAACACGATCGTGAATGAGCTGGTACGTGTGACCAGTGAGGGAGCTGGCCTGCAG SEQ ID 8 2641 AGGAATAACACGATCGTGAATGAGCTGGTACGTGTGACCAGTGAGGGAGCTGGCCTGCAG ************************************************************ SEQ ID 5 2701 CTGCAGAAGGTGACTGTCCTGGGCGTGGCCACGGCGCCCCAGCAGGTCCTCTCCAACGGT SEQ ID 8 2701 CTGCAGAAGGTGACTGTCCTGGGCGTGGCCACGGCGCCCCAGCAGGTCCTCTCCAACGGT ************************************************************ SEQ ID 5 2761 GTCCCTGTCTCCAACTTCACCTACAGCCCCGACACCAAGGTCCTGGACATCTGTGTCTCG SEQ ID 8 2761 GTCCCTGTCTCCAACTTCACCTACAGCCCCGACACCAAGGTCCTGGACATCTGTGTCTCG ************************************************************ SEQ ID 5 2821 CTGTTGATGGGAGAGCAGTTTCTCGTCAGCTGGTGTTAG SEQ ID 8 2821 CTGTTGATGGGAGAGCAGTTTCTCGTCAGCTGGTGTTAG *************************************** Regarding claim 42, the fusion protein SEQ ID NO: 2 taught by LeBowitz comprises a sequence over 95% identical to instant SEQ ID NO: 6, as shown below. 97.9% identity in 961 residues overlap; Score: 4980.0; Gap frequency: 1.6% SEQ ID 6 22 LCGGELVDTLQFVCGDRGFLFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPARSE SEQ ID 2 2 LCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE ******************* ************************************* ** SEQ ID 6 82 GGGGSGGGGSRPGPRDAQAHPGRPRAVPTQCDVPPNSRFDCAPDKAITQEQCEARGCCYI SEQ ID 2 62 G---------------APAHPGRPRAVPTQCDVPPNSRFDCAPDKAITQEQCEARGCCYI * * ****************************************** SEQ ID 6 142 PAKQGLQGAQMGQPWCFFPPSYPSYKLENLSSSEMGYTATLTRTTPTFFPKDILTLRLDV SEQ ID 2 107 PAKQGLQGAQMGQPWCFFPPSYPSYKLENLSSSEMGYTATLTRTTPTFFPKDILTLRLDV ************************************************************ SEQ ID 6 202 MMETENRLHFTIKDPANRRYEVPLETPHVHSRAPSPLYSVEFSEEPFGVIVRRQLDGRVL SEQ ID 2 167 MMETENRLHFTIKDPANRRYEVPLETPRVHSRAPSPLYSVEFSEEPFGVIVHRQLDGRVL *************************** *********************** ******** SEQ ID 6 262 LNTTVAPLFFADQFLQLSTSLPSQYITGLAEHLSPLMLSTSWTRITLWNRDLAPTPGANL SEQ ID 2 227 LNTTVAPLFFADQFLQLSTSLPSQYITGLAEHLSPLMLSTSWTRITLWNRDLAPTPGANL ************************************************************ SEQ ID 6 322 YGSHPFYLALEDGGSAHGVFLLNSNAMDVVLQPSPALSWRSTGGILDVYIFLGPEPKSVV SEQ ID 2 287 YGSHPFYLALEDGGSAHGVFLLNSNAMDVVLQPSPALSWRSTGGILDVYIFLGPEPKSVV ************************************************************ SEQ ID 6 382 QQYLDVVGYPFMPPYWGLGFHLCRWGYSSTAITRQVVENMTRAHFPLDVQWNDLDYMDSR SEQ ID 2 347 QQYLDVVGYPFMPPYWGLGFHLCRWGYSSTAITRQVVENMTRAHFPLDVQWNDLDYMDSR ************************************************************ SEQ ID 6 442 RDFTFNKDGFRDFPAMVQELHQGGRRYMMIVDPAISSSGPAGSYRPYDEGLRRGVFITNE SEQ ID 2 407 RDFTFNKDGFRDFPAMVQELHQGGRRYMMIVDPAISSSGPAGSYRPYDEGLRRGVFITNE ************************************************************ SEQ ID 6 502 TGQPLIGKVWPGSTAFPDFTNPTALAWWEDMVAEFHDQVPFDGMWIDMNEPSNFIRGSED SEQ ID 2 467 TGQPLIGKVWPGSTAFPDFTNPTALAWWEDMVAEFHDQVPFDGMWIDMNEPSNFIRGSED ************************************************************ SEQ ID 6 562 GCPNNELENPPYVPGVVGGTLQAATICASSHQFLSTHYNLHNLYGLTEAIA SHRALVKAR SEQ ID 2 527 GCPNNELENPPYVPGVVGGTLQAATICASSHQFLSTHYNLHNLYGLTEAIA SHRALVKAR ************************************************************ SEQ ID 6 622 GTRPFVISRSTFAGHGRYAGHWTGDVWSSWEQLASSVPEILQFNLLGVPLVGADVCGFLG SEQ ID 2 587 GTRPFVISRSTFAGHGRYAGHWTGDVWSSWEQLASSVPEILQFNLLGVPLVGADVCGFLG ************************************************************ SEQ ID 6 682 NTSEELCVRWTQLGAFYPFMRNHNSLLSLPQEPYSFSEPAQQAMRKALTLRYALLPHLYT SEQ ID 2 647 NTSEELCVRWTQLGAFYPFMRNHNSLLSLPQEPYSFSEPAQQAMRKALTLRYALLPHLYT ************************************************************ SEQ ID 6 742 LFHQAHVAGETVARPLFLEFPKDSSTWTVDHQLLWGEALLITPVLQAGKAEVTGYFPLGT SEQ ID 2 707 LFHQAHVAGETVARPLFLEFPKDSSTWTVDHQLLWGEALLITPVLQAGKAEVTGYFPLGT ************************************************************ SEQ ID 6 802 WYDLQTVPIEALGSLPPPPAAPREPAIHSEGQWVTLPAPLDTINVHLRAGYIIPLQGPGL SEQ ID 2 767 WYDLQTVPIEALGSLPPPPAAPREPAIHSEGQWVTLPAPLDTINVHLRAGYIIPLQGPGL ************************************************************ SEQ ID 6 862 TTTESRQQPMALAVALTKGGEARGELFWDDGESLEVLERGAYTQVIFLARNNTIVNELVR SEQ ID 2 827 TTTESRQQPMALAVALTKGGEARGELFWDDGESLEVLERGAYTQVIFLARNNTIVNELVR ************************************************************ SEQ ID 6 922 VTSEGAGLQLQKVTVLGVATAPQQVLSNGVPVSNFTYSPDTKVLDICVSLLMGEQFLVSW SEQ ID 2 887 VTSEGAGLQLQKVTVLGVATAPQQVLSNGVPVSNFTYSPDTKVLDICVSLLMGEQFLVSW ************************************************************ SEQ ID 6 982 C SEQ ID 2 947 C * Regarding claim 55, LeBowitz teaches wherein the fusion protein has a linker peptide between the vIGF2 component (GILT tag) and the GAA component ([0071], [0054]; Example 1, [0065]-[0067]). Regarding claim 71, Mingozzi teaches therapeutic compositions comprising a pharmaceutical acceptable carrier and excipient(s), such as the suspending agent that is a starch, serum albumin or glycerol (pg. 41). Regarding claim 84, although LeBowitz does not expressly teach wherein the vIGF2 component expressly comprises instant SEQ ID NO: 44, LeBowitz teaches using any functional vIGF2 component (GILT tag) having an amino acid sequence at least 70% (e.g., at least 75%, 80%, 85%, 90%, 95%, 98%, or 99%) identical to mature human IGF-II (SEQ ID NO: 1) and as shown below instant SEQ ID NO: 44 is 95.2% identical to SEQ ID NO: 1. 95.2% identity in 63 residues overlap; Score: 321.0; Gap frequency: 0.0% SEQ ID 44 1 SRTLCGGELVDTLQFVCGDRGFLFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPA SEQ ID 1 5 SETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPA * ******************** ************************************* SEQ ID 44 61 RSE SEQ ID 1 65 KSE ** Therefore, the claimed invention as a whole would have been prima facie obvious to a person of ordinary skill before the earliest effective filing date absent evidence to the contrary. Claims 34-35, 40, 42, 44, 55, 71, and 84 are rejected under 35 U.S.C. 103 as being unpatentable over Mingozzi in view of LeBowitz and EMA as applied above, and further in view of Lieber (US20170037431A1; IDS ref.). Regarding claim 44, the combination of Mingozzi, LeBowitz, and EMA does not teach wherein the nucleic acid vector comprises at least two tandem repeats of DRG-specific miR-183 target sequences operably linked 3’ to the sequence encoding the fusion protein. However Lieber teaches a miRNA-based gene regulation system to suppress a potential cytotoxicity of high level of transgene expression from a viral vector (para. 155) by using multiple tandem repeats (at least 4) of miR-183 targeting site that binds to a miR-183 sequence ([0010], [0053], [0061], [0138] and [0167]), e.g., SEQ ID NO: 7 (5'- AGUGAAUUCUACCAGUGCCAUA -3') of Lieber which is a reverse complement targeting miR-183 at SEQ ID NO: 14 (5'-UAUGGCACUGGUAGAAUUCACU-3'). It would have been obvious to a person skilled in the art to use multiple tandem repeats of miR-183 targeting site as taught by Lieber et al. for the purpose of silencing cytotoxicity during recombinant AAV virus production. Therefore, the claimed invention as a whole would have been prima facie obvious to a person of ordinary skill before the earliest effective filing date absent evidence to the contrary. Claims 34-35, 40, 42, 55, 64, 71, and 84-85 are rejected under 35 U.S.C. 103 as being unpatentable over Mingozzi in view of LeBowitz and EMA as applied above, and further in view of Wilson (WO2018160582A1; IDS ref.). The invention of claims 34-35, 40, 42, 55, 71, and 84 would have been prima facie obvious to a person of ordinary skill before the earliest effective filing date as set forth fully above. Regarding claim 64, the combination of Mingozzi, LeBowitz, and EMA does not expressly teach wherein the AAV capsid is a clade F capsid. However Mingozzi teaches wherein the AAV capsid is an AAV9 capsid, such as for target muscle cells (pg. 36, lines 25-26) and AAV9 is a clade F capsid as evidenced by Wilson (pg. 76, lines 12-13). Regarding claim 85, the combination of Mingozzi, LeBowitz, and EMA does not teach wherein the AAV capsid is an AAVhu68 capsid. However Wilson teaches AVV gene therapy vectors based on the clade F AAVhu68 capsid have significantly higher yields than AAV9 while providing tropism to motor cortex like AAV9 but with improved transduction efficiency over AAV9, e.g. to the cerebellum and motor cortex (pg. 10, lines 32-33; Examples 2-4; FIG. 3-6; pg. 29, lines 6-11), and Wilson teaches uses in treating Pompe disease by expressing recombinant GAA (pg. 38, line 28). It would have been prima facie obvious to one of ordinary skill in the art before the effective time of filing to specifically choose the AAVhu68 capsid taught by Wilson for use in the AAV viral delivery GAA-transgenic approach taught by Mingozzi wherein the ultimate goal is to treat Pompe disease. One of ordinary skill in the art would be motivated to because Wilson teaches AAVhu68 has higher yields while providing efficient transduction. Therefore, the claimed invention as a whole would have been prima facie obvious to a person of ordinary skill before the earliest effective filing date absent evidence to the contrary. Claims 47, 57, 84, 86-88, 90, and 92 are rejected under 35 U.S.C. 103 as being unpatentable over Amicus (WO2019213180A1, priority to 2019-04-03; IDS ref.) in view of LeBowitz (US20120148556A1). Regarding claim 47, Amicus teaches a gene therapy vector comprising a recombinant AAV vector comprising an AAV capsid and a vector genome carrying a nucleic acid construct having regulatory sequences operably linked to a sequence encoding a therapeutic protein (positioned 30-110 bp upstream of a start site) ([00111]-[00115]) wherein the protein is a fusion protein comprising a signal peptide ([0004]-[0005]), vIGF2 component (a peptide that selectively binds to the CI-MPR), and human alpha-glucosidase (GAA) (or enzymatically active fragment thereof) component ([0007]) comprising an active site at 516-521 relative to instant SEQ ID NO: 3 (Example 4, SEQ ID NO: 23; FIG. 12) as shown below, and wherein the vIGF2 peptide is at least 90% identical to instant SEQ ID NO: 32, as shown below, with at least one substitution at any one of positions 6, 26, 27, 43, 48-50, 55 and 65 ([0009], SEQ ID NO: 1), such as having E6R, Y27L, and K65R as in Example 4 (SEQ ID NO: 31). 98.5% identity in 908 residues overlap; Score: 4799.0; Gap frequency: 0.0% SEQ ID 3 45 SSPVLEETHPAHQQGASRPGPRDAQAHPGRPRAVPTQCDVPPNSRFDCAPDKAITQEQCE SEQ ID 23 75 ATPARSEGGGGSGGGGSRPGPRDAQAHPGRPRAVPTQCDVPPNSRFDCAPDKAITQEQCE * * * ******************************************** SEQ ID 3 105 ARGCCYIPAKQGLQGAQMGQPWCFFPPSYPSYKLENLSSSEMGYTATLTRTTPTFFPKDI SEQ ID 23 135 ARGCCYIPAKQGLQGAQMGQPWCFFPPSYPSYKLENLSSSEMGYTATLTRTTPTFFPKDI ************************************************************ SEQ ID 3 165 LTLRLDVMMETENRLHFTIKDPANRRYEVPLETPHVHSRAPSPLYSVEFSEEPFGVIVRR SEQ ID 23 195 LTLRLDVMMETENRLHFTIKDPANRRYEVPLETPHVHSRAPSPLYSVEFSEEPFGVIVRR ************************************************************ SEQ ID 3 225 QLDGRVLLNTTVAPLFFADQFLQLSTSLPSQYITGLAEHLSPLMLSTSWTRITLWNRDLA SEQ ID 23 255 QLDGRVLLNTTVAPLFFADQFLQLSTSLPSQYITGLAEHLSPLMLSTSWTRITLWNRDLA ************************************************************ SEQ ID 3 285 PTPGANLYGSHPFYLALEDGGSAHGVFLLNSNAMDVVLQPSPALSWRSTGGILDVYIFLG SEQ ID 23 315 PTPGANLYGSHPFYLALEDGGSAHGVFLLNSNAMDVVLQPSPALSWRSTGGILDVYIFLG ************************************************************ SEQ ID 3 345 PEPKSVVQQYLDVVGYPFMPPYWGLGFHLCRWGYSSTAITRQVVENMTRAHFPLDVQWND SEQ ID 23 375 PEPKSVVQQYLDVVGYPFMPPYWGLGFHLCRWGYSSTAITRQVVENMTRAHFPLDVQWND ************************************************************ SEQ ID 3 405 LDYMDSRRDFTFNKDGFRDFPAMVQELHQGGRRYMMIVDPAISSSGPAGSYRPYDEGLRR SEQ ID 23 435 LDYMDSRRDFTFNKDGFRDFPAMVQELHQGGRRYMMIVDPAISSSGPAGSYRPYDEGLRR ************************************************************ SEQ ID 3 465 GVFITNETGQPLIGKVWPGSTAFPDFTNPTALAWWEDMVAEFHDQVPFDGMWIDMNEPSN SEQ ID 23 495 GVFITNETGQPLIGKVWPGSTAFPDFTNPTALAWWEDMVAEFHDQVPFDGMWIDMNEPSN ************************************************************ SEQ ID 3 525 FIRGSEDGCPNNELENPPYVPGVVGGTLQAATICASSHQFLSTHYNLHNLYGLTEAIA SH SEQ ID 23 555 FIRGSEDGCPNNELENPPYVPGVVGGTLQAATICASSHQFLSTHYNLHNLYGLTEAIA SH ************************************************************ SEQ ID 3 585 RALVKARGTRPFVISRSTFAGHGRYAGHWTGDVWSSWEQLASSVPEILQFNLLGVPLVGA SEQ ID 23 615 RALVKARGTRPFVISRSTFAGHGRYAGHWTGDVWSSWEQLASSVPEILQFNLLGVPLVGA ************************************************************ SEQ ID 3 645 DVCGFLGNTSEELCVRWTQLGAFYPFMRNHNSLLSLPQEPYSFSEPAQQAMRKALTLRYA SEQ ID 23 675 DVCGFLGNTSEELCVRWTQLGAFYPFMRNHNSLLSLPQEPYSFSEPAQQAMRKALTLRYA ************************************************************ SEQ ID 3 705 LLPHLYTLFHQAHVAGETVARPLFLEFPKDSSTWTVDHQLLWGEALLITPVLQAGKAEVT SEQ ID 23 735 LLPHLYTLFHQAHVAGETVARPLFLEFPKDSSTWTVDHQLLWGEALLITPVLQAGKAEVT ************************************************************ SEQ ID 3 765 GYFPLGTWYDLQTVPIEALGSLPPPPAAPREPAIHSEGQWVTLPAPLDTINVHLRAGYII SEQ ID 23 795 GYFPLGTWYDLQTVPVEALGSLPPPPAAPREPAIHSEGQWVTLPAPLDTINVHLRAGYII *************** ******************************************** SEQ ID 3 825 PLQGPGLTTTESRQQPMALAVALTKGGEARGELFWDDGESLEVLERGAYTQVIFLARNNT SEQ ID 23 855 PLQGPGLTTTESRQQPMALAVALTKGGEARGELFWDDGESLEVLERGAYTQVIFLARNNT ************************************************************ SEQ ID 3 885 IVNELVRVTSEGAGLQLQKVTVLGVATAPQQVLSNGVPVSNFTYSPDTKVLDICVSLLMG SEQ ID 23 915 IVNELVRVTSEGAGLQLQKVTVLGVATAPQQVLSNGVPVSNFTYSPDTKVLDICVSLLMG ************************************************************ SEQ ID 3 945 EQFLVSWC SEQ ID 23 975 EQFLVSWC ******** 100.0% identity in 67 residues overlap; Score: 360.0; Gap frequency: 0.0% SEQ ID 32 1 AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYC SEQ ID 1 1 AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYC ************************************************************ SEQ ID 32 61 ATPAKSE SEQ ID 1 61 ATPAKSE ******* Amicus does not teach wherein the GAA component comprises an isoleucine at position 780. However LeBowitz teaches hGAA fusion proteins ([0014]) for use in enzyme replacement therapy to treat Pompe disease comprising a polypeptide at least 75% identical to a human IGF2 sequence (vIGF2 peptide) (SEQ ID NO: 1) for lysosomal targeting via binding CI-MPR wherein the human GAA polypeptide component (SEQ ID NO: 2) comprises an isoleucine at position 780 based on the numbering of the positions in instant SEQ ID NO: 3, as shown above ([0014]-[0016], [0018]; [0045]-[0047]; [0057]; [0064]-[0066]; [0071]; [0002]). It would have been prima facie obvious to one of ordinary skill in the art before the effective time of filing to use the GAA fusion protein taught by LeBowitz in an AAV viral delivery transgenic system taught by Amicus for activity testing in CHO host cells as taught by Amicus (Example 5, FIG. 15). One of ordinary skill in the art would be motivated to because LeBowitz teaches such fusion proteins have potential uses in enzyme replacement therapies for GAA-deficiencies. Regarding claim 57, Amicus taches wherein the signal peptide is a BiP or Gaussia signal peptide ([0004]-[0005]). Regarding claim 84, Amicus teaches wherein the vIGF2 component consists of instant SEQ ID NO: 44 (Example 4, SEQ ID NO: 31). 100.0% identity in 63 residues overlap; Score: 334.0; Gap frequency: 0.0% SEQ ID 44 1 SRTLCGGELVDTLQFVCGDRGFLFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPA SEQ ID 31 1 SRTLCGGELVDTLQFVCGDRGFLFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPA ************************************************************ SEQ ID 44 61 RSE SEQ ID 33 61 RSE *** Regarding claim 86, Amicus teaches a gene therapy vector comprising a recombinant AAV vector comprising an AAV capsid and a vector genome carrying a nucleic acid construct having regulatory sequences operably linked to a sequence encoding a therapeutic protein (positioned 30-110 bp upstream of a start site) ([00111]-[00115]) wherein the protein is a fusion protein comprising a BiP signal peptide comprising instant SEQ ID NO: 49 ([0004]-[0005], [0013]; SEQ ID NO: 13) as shown below, a vIGF2 component comprising instant SEQ ID NO: 44 as shown above, and a human alpha-glucosidase (GAA) (or enzymatically active fragment thereof) component ([0007]) comprising an active site at 516-521 relative to instant SEQ ID NO: 3 (Example 4, SEQ ID NOs: 23 and 31; FIG. 12) as shown above. 100.0% identity in 18 residues overlap; Score: 76.0; Gap frequency: 0.0% SEQ ID 44 1 MKLSLVAAMLLLLSAARA SEQ ID 13 1 MKLSLVAAMLLLLSAARA ****************** Regarding claims 87-88, Amicus teaches wherein the AAV has the clade F AAVhu68 capsid ([0007]). Regarding claim 90, Amicus teaches wherein the fusion protein comprises a sequence at least identical to instant SEQ ID NO: 6 (SEQ ID NO: 32) but for I780 and LeBowitz teaches wherein the chimeric fusion protein comprises a sequence (SEQ ID NO: 2) at least 95% identical to instant SEQ ID NO: 6, as shown below. 97.9% identity in 961 residues overlap; Score: 4980.0; Gap frequency: 1.6% SEQ ID 6 22 LCGGELVDTLQFVCGDRGFLFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPARSE SEQ ID 2 2 LCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE ******************* ************************************* ** SEQ ID 6 82 GGGGSGGGGSRPGPRDAQAHPGRPRAVPTQCDVPPNSRFDCAPDKAITQEQCEARGCCYI SEQ ID 2 62 G---------------APAHPGRPRAVPTQCDVPPNSRFDCAPDKAITQEQCEARGCCYI * * ****************************************** SEQ ID 6 142 PAKQGLQGAQMGQPWCFFPPSYPSYKLENLSSSEMGYTATLTRTTPTFFPKDILTLRLDV SEQ ID 2 107 PAKQGLQGAQMGQPWCFFPPSYPSYKLENLSSSEMGYTATLTRTTPTFFPKDILTLRLDV ************************************************************ SEQ ID 6 202 MMETENRLHFTIKDPANRRYEVPLETPHVHSRAPSPLYSVEFSEEPFGVIVRRQLDGRVL SEQ ID 2 167 MMETENRLHFTIKDPANRRYEVPLETPRVHSRAPSPLYSVEFSEEPFGVIVHRQLDGRVL *************************** *********************** ******** SEQ ID 6 262 LNTTVAPLFFADQFLQLSTSLPSQYITGLAEHLSPLMLSTSWTRITLWNRDLAPTPGANL SEQ ID 2 227 LNTTVAPLFFADQFLQLSTSLPSQYITGLAEHLSPLMLSTSWTRITLWNRDLAPTPGANL ************************************************************ SEQ ID 6 322 YGSHPFYLALEDGGSAHGVFLLNSNAMDVVLQPSPALSWRSTGGILDVYIFLGPEPKSVV SEQ ID 2 287 YGSHPFYLALEDGGSAHGVFLLNSNAMDVVLQPSPALSWRSTGGILDVYIFLGPEPKSVV ****************
Read full office action

Prosecution Timeline

Oct 25, 2021
Application Filed
Feb 03, 2025
Non-Final Rejection — §103, §112, §DP
Aug 12, 2025
Response Filed
Oct 30, 2025
Non-Final Rejection — §103, §112, §DP (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12577529
METHODS FOR PRODUCING NEURAL CELLS
2y 5m to grant Granted Mar 17, 2026
Patent 12558458
Targeted in Situ Therapeutic Delivery of Secreted Factors from Stem Cells for Treatment of Damaged Tissue
2y 5m to grant Granted Feb 24, 2026
Patent 12545870
THREE-DIMENSIONAL MUSCLE TISSUE AND PRODUCTION METHOD THEREFOR
2y 5m to grant Granted Feb 10, 2026
Patent 12534707
METHOD FOR GENERATING CARDIAC TISSUE MIMETICS
2y 5m to grant Granted Jan 27, 2026
Patent 12521418
MESENCHYMAL STROMAL CELL EXOSOMES AND USES THEREOF
2y 5m to grant Granted Jan 13, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

AI Strategy Recommendation

Get an AI-powered prosecution strategy using examiner precedents, rejection analysis, and claim mapping.
Powered by AI — typically takes 5-10 seconds

Prosecution Projections

2-3
Expected OA Rounds
62%
Grant Probability
90%
With Interview (+27.6%)
3y 10m
Median Time to Grant
Moderate
PTA Risk
Based on 90 resolved cases by this examiner. Grant probability derived from career allow rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month