Prosecution Insights
Last updated: April 19, 2026
Application No. 17/610,844

COMPOSITION FOR PREVENTING OR TREATING NEUROTROPHIC KERATITIS WHICH CONTAINS PACAP PEPTIDE OR STABILIZED PACAP PEPTIDE

Non-Final OA §103§DP
Filed
Nov 12, 2021
Examiner
STEELE, AMBER D
Art Unit
1658
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
Senju Pharmaceutical Co. Ltd.
OA Round
3 (Non-Final)
59%
Grant Probability
Moderate
3-4
OA Rounds
3y 2m
To Grant
68%
With Interview

Examiner Intelligence

Grants 59% of resolved cases
59%
Career Allow Rate
471 granted / 797 resolved
-0.9% vs TC avg
Moderate +9% lift
Without
With
+8.9%
Interview Lift
resolved cases with interview
Typical timeline
3y 2m
Avg Prosecution
56 currently pending
Career history
853
Total Applications
across all art units

Statute-Specific Performance

§101
6.7%
-33.3% vs TC avg
§103
26.2%
-13.8% vs TC avg
§102
21.3%
-18.7% vs TC avg
§112
23.1%
-16.9% vs TC avg
Black line = Tech Center average estimate • Based on career data from 797 resolved cases

Office Action

§103 §DP
DETAILED ACTION Notice of Pre-AIA or AIA Status The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . Continued Examination Under 37 CFR 1.114 A request for continued examination under 37 CFR 1.114, including the fee set forth in 37 CFR 1.17(e), was filed in this application after final rejection. Since this application is eligible for continued examination under 37 CFR 1.114, and the fee set forth in 37 CFR 1.17(e) has been timely paid, the finality of the previous Office action has been withdrawn pursuant to 37 CFR 1.114. Applicant's submission filed on November 13, 2025 has been entered. Status of the Claims Claims 1-18 were originally filed November 12, 2021. The amendment received May 25, 2022 amended claims 1-14 and 17. The amendment received February 28, 2025 amended claims 1, 2, 10-12, and 17 and canceled claims 3-9, 13, and 14. The amendment received November 13, 2025 amended claims 1 and 17 and canceled claim 2. Claims 1, 10-12, and 15-18 are currently pending. Claims 1, 10-12, and 17 are currently under consideration. Election/Restrictions Applicants elected, without traverse, Group I (claims 1-14 and 17) in the reply filed on August 23, 2024. Because applicant did not distinctly and specifically point out the supposed errors in the restriction requirement, the election has been treated as an election without traverse (MPEP § 818.01(a)). Claims 15, 16, and 18 are withdrawn from further consideration pursuant to 37 CFR 1.142(b) as being drawn to nonelected products and methods, there being no allowable generic or linking claim. Applicants elected, without traverse, SEQ ID NO: 11, N-terminal acetylation, neurotrophic keratitis, and human as the species in the reply filed on August 23, 2024. Because applicant did not distinctly and specifically point out the supposed errors in the restriction requirement, the election has been treated as an election without traverse (MPEP § 818.01(a)). Claims 13 and 14 are withdrawn from further consideration pursuant to 37 CFR 1.142(b) as being drawn to nonelected species, there being no allowable generic or linking claim. Election was made without traverse in the reply filed on August 23, 2024. Priority The present application is a 371 (National Stage) of PCT/JP2020/019347 filed May 14, 2020 which claims foreign priority to Japan 2019-091700 filed May 14, 2019. Applicant cannot rely upon the certified copy of the foreign priority application to overcome any rejection of record because a translation of said application has not been made of record in accordance with 37 CFR 1.55. When an English language translation of a non-English language foreign application is required, the translation must be that of the certified copy (of the foreign application as filed) submitted together with a statement that the translation of the certified copy is accurate. See MPEP §§ 215 and 216. Specification The lengthy specification has not been checked to the extent necessary to determine the presence of all possible minor errors. Applicant’s cooperation is requested in correcting any errors of which applicant may become aware in the specification. Sequence Interpretation The Office interprets claims comprising SEQ ID NOs: in the following manner: “comprising a sequence of SEQ ID NO: 1” requires only a 2mer of SEQ ID NO: 1, “comprising the sequence of SEQ ID NO: 1” requires the full-length sequence with 100% identity to SEQ ID NO: 1 with any N-/C-terminal additions or any 5’/3’ additions, “consisting of SEQ ID NO: 1” requires the full-length sequence with 100% identity to SEQ ID NO: 1 and the same length as SEQ ID NO: 1, and “selected from the group consisting of SEQ ID NOs: 1, 2, and 3” requires the full-length sequence with 100% identity to SEQ ID NOs: 1, 2, or 3 and the same length as SEQ ID NOs: 1, 2, or 3. Present SEQ ID NO: 1 (PACAP38) is HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK. SEQ ID NO: 3 wherein X1, X2, and X3 are S/Ser/serine; X4 is K/Lys/lysine; X5 is Q/Gln/glutamine; X6 is M/Met/methionine; X7 is V/Val/valine; X8 and X9 are K/Lys/lysine; and X10 is L/Leu/leucine. Present SEQ ID NO: 2 (PACAP27) is HSDGIFTDSYSRYRKQMAVKKYLAAVL. SEQ ID NO: 3 wherein X1, X2, and X3 are S/Ser/serine; X4 is K/Lys/lysine; X5 is Q/Gln/glutamine; X6 is M/Met/methionine; X7 is V/Val/valine; X8 and X9 are K/Lys/lysine; and X10 is L/Leu/leucine. Please note: due to the closed consisting of language in claims 1 and 17, only PACAP27 now reads on present SEQ ID NO: 3. Withdrawn Objections The objection to claim 1 regarding an extra space between “administering” and “a” (see line 2) is withdrawn in view of the amendment received November 13, 2025. The objection to claim 1 regarding embedded periods within the claim (see lines 9-13) is withdrawn in view of the amendment received November 13, 2025. The objection to claim 1 regarding the second wherein clause should read as follows: “wherein the partially modified sequence comprises SEQ ID NO: 3 as above with 1-3 amino acid deletion(s) from the C-terminus or the addition of an amino acid sequence selected from the group consisting of:” is withdrawn in view of the amendment received November 13, 2025. The objection to claim 1 regarding the semicolon after G should be removed is withdrawn in view of the amendment received November 13, 2025. The objection to claim 17 regarding embedded periods within the claim (see lines 8-12) is withdrawn in view of the amendment received November 13, 2025. The objection to claim 17 regarding the second wherein clause should read as follows: “wherein the partially modified sequence comprises SEQ ID NO: 3 as above with 1-3 amino acid deletion(s) from the C-terminus or the addition of an amino acid sequence selected from the group consisting of:” is withdrawn in view of the amendment received November 13, 2025. The objection to claim 17 regarding the semicolon after G should be removed is withdrawn in view of the amendment received November 13, 2025. Withdrawn Rejections The rejection of claims 1, 2, 10-12, and 17 under 35 U.S.C. 112(b) or 35 U.S.C. 112 (pre-AIA ), second paragraph, as being indefinite for failing to particularly point out and distinctly claim the subject matter which the inventor or a joint inventor (or for applications subject to pre-AIA 35 U.S.C. 112, the applicant), regards as the invention is withdrawn in view of the amendment received November 13, 2025. The rejection of claim 2 under 35 U.S.C. 112(d) or pre-AIA 35 U.S.C. 112, 4th paragraph, as being of improper dependent form for failing to further limit the subject matter of the claim upon which it depends, or for failing to include all the limitations of the claim upon which it depends is withdrawn in view of the amendment received November 13, 2025 which cancelled the claim. Maintained and/or Modified* Rejections *wherein the modification is due to amendment Claim Rejections - 35 USC § 103 The following is a quotation of 35 U.S.C. 103 which forms the basis for all obviousness rejections set forth in this Office action: A patent for a claimed invention may not be obtained, notwithstanding that the claimed invention is not identically disclosed as set forth in section 102, if the differences between the claimed invention and the prior art are such that the claimed invention as a whole would have been obvious before the effective filing date of the claimed invention to a person having ordinary skill in the art to which the claimed invention pertains. Patentability shall not be negated by the manner in which the invention was made. Claims 1, 10-12, and 17 are rejected under 35 U.S.C. 103 as being unpatentable over Takayama et al. U.S. Patent Application Publication 2011/0212899 published September 1, 2011 and Popova et al., 2015, Synthesis and biological properties of amino acids and peptides containing a tetrazolyl moiety, Russian Chemical Reviews, 84(9): 891-916. For present claims 1, 10-12, and 17, Takayama et al. teach methods of treating keratitis, keratopathy, and/or corneal neutritogenesis via administering PACAP38 (i.e. present SEQ ID NO: 1), PACAP27 (i.e. present SEQ ID NOs: 2 and 3), or a derivative thereof which may also have deletions (i.e. modified sequence) and/or N-terminal acetylation (please refer to the entire specification particularly the abstract; paragraphs 4, 6, 8-23, 35, 57, 66, 71). For present claims 1, 10-12, and 17, Popova et al. teach replacing aspartic acid with tetrazole to enhance peptide stability (please refer to the entire reference particularly the abstract; Introduction; pages 904, 908, 910, 912, and 913). The claims would have been obvious because a particular known technique (i.e. replacing aspartic acid with tetrazole to enhance peptide stability) was recognized as part of the ordinary capabilities of one skilled in the art. See KSR International Co. v. Teleflex Inc., 82 USPQ2d 1385 (U.S. 2007). Arguments and Response Applicants’ arguments directed to the rejection under 35 USC 103 as being unpatentable over Takayama et al. and Popova et al. for claims 1, 10-12, and 17 were considered but are not persuasive for the following reasons. Applicants contend that Takayama et al. do not teach PACAP27 wherein the D/Asp/aspartic acid at positions 3 and/or 8 is(are) substituted with tetrazole which retain activity while having enhanced stability. Applicants contend that Popava et al. do not teach PACAP27 wherein the D/Asp/aspartic acid at positions 3 and/or 8 is(are) substituted with tetrazole. Applicants’ arguments are not convincing since the teachings of Takayama et al. and Popova et al. render the methods of the instant claims prima facie obvious. In response to applicant's arguments against the references individually, one cannot show nonobviousness by attacking references individually where the rejections are based on combinations of references. See In re Keller, 642 F.2d 413, 208 USPQ 871 (CCPA 1981); In re Merck & Co., 800 F.2d 1091, 231 USPQ 375 (Fed. Cir. 1986). Takayama et al. teach PACAP27 (present SEQ ID NOs: 2 and 3) wherein the only D/Asp/aspartic acids are at residues 3 and 8 (see above – Sequence Interpretation section). Popova et al. teach of tetrazole substitutions providing stability and high activity (please refer to the entire reference particularly the abstract; Introduction, sections IV.1, V; page 910, left column). Popova et al. teach replacing aspartic acid with tetrazole to enhance peptide stability (please refer to the entire reference particularly the abstract; Introduction; pages 904, 908, 910, 912, and 913). Claims 1, 10-12, and 17 are rejected under 35 U.S.C. 103 as being unpatentable over Ousler III et al. U.S. Patent Application Publication 2006/0270592 published November 30, 2006; Takayama et al. U.S. Patent Application Publication 2011/0212899 published September 1, 2011; and Popova et al., 2015, Synthesis and biological properties of amino acids and peptides containing a tetrazolyl moiety, Russian Chemical Reviews, 84(9): 891-916. For present claims 1, 10-12, and 17, Ousler III et al. teach methods of treating neurotrophic keratitis via administering PACAP38 (present SEQ ID NO: 3) or PACAP27 (present SEQ ID NOs: 2 and 3) (please refer to the entire specification particularly 4, 6, 19, 25, 36, 37). For present claims 1, 10-12, and 17, Takayama et al. teach methods of treating keratitis, keratopathy, and/or corneal neutritogenesis via administering PACAP38 (present SEQ ID NO: 1), PACAP27 (present SEQ ID NOs: 2 and 4), or a derivative thereof which may also have deletions (i.e. modified sequence) and/or N-terminal acetylation (please refer to the entire specification particularly the abstract; paragraphs 4, 6, 8-23, 35, 57, 66, 71). For present claims 1, 10-12, and 17, Popova et al. teach replacing aspartic acid with tetrazole to enhance peptide stability (please refer to the entire reference particularly the abstract; Introduction; pages 904, 908, 910, 912, and 913). The claims would have been obvious because a particular known technique (i.e. N-terminal acetylation to increase stability; replacing aspartic acid with tetrazole to enhance peptide stability) was recognized as part of the ordinary capabilities of one skilled in the art. See KSR International Co. v. Teleflex Inc., 82 USPQ2d 1385 (U.S. 2007). Arguments and Response Applicants’ arguments directed to the rejection under 35 USC 103 as being unpatentable over Ousler III et al., Takayama et al., and Popova et al. for claims 1, 10-12, and 17 were considered but are not persuasive for the following reasons. Applicants contend that Takayama et al. do not teach PACAP27 wherein the D/Asp/aspartic acid at positions 3 and/or 8 is(are) substituted with tetrazole which retain activity while having enhanced stability. Applicants contend that Popava et al. do not teach PACAP27 wherein the D/Asp/aspartic acid at positions 3 and/or 8 is(are) substituted with tetrazole. Applicants’ arguments are not convincing since the teachings of Ousler III et al., Takayama et al., and Popova et al. render the methods of the instant claims prima facie obvious. In response to applicant's arguments against the references individually, one cannot show nonobviousness by attacking references individually where the rejections are based on combinations of references. See In re Keller, 642 F.2d 413, 208 USPQ 871 (CCPA 1981); In re Merck & Co., 800 F.2d 1091, 231 USPQ 375 (Fed. Cir. 1986). Takayama et al. teach PACAP27 (present SEQ ID NOs: 2 and 3) wherein the only D/Asp/aspartic acids are at residues 3 and 8 (see above – Sequence Interpretation section). Popova et al. teach of tetrazole substitutions providing stability and high activity (please refer to the entire reference particularly the abstract; Introduction, sections IV.1, V; page 910, left column). Popova et al. teach replacing aspartic acid with tetrazole to enhance peptide stability (please refer to the entire reference particularly the abstract; Introduction; pages 904, 908, 910, 912, and 913). Double Patenting The nonstatutory double patenting rejection is based on a judicially created doctrine grounded in public policy (a policy reflected in the statute) so as to prevent the unjustified or improper timewise extension of the “right to exclude” granted by a patent and to prevent possible harassment by multiple assignees. A nonstatutory double patenting rejection is appropriate where the conflicting claims are not identical, but at least one examined application claim is not patentably distinct from the reference claim(s) because the examined application claim is either anticipated by, or would have been obvious over, the reference claim(s). See, e.g., In re Berg, 140 F.3d 1428, 46 USPQ2d 1226 (Fed. Cir. 1998); In re Goodman, 11 F.3d 1046, 29 USPQ2d 2010 (Fed. Cir. 1993); In re Longi, 759 F.2d 887, 225 USPQ 645 (Fed. Cir. 1985); In re Van Ornum, 686 F.2d 937, 214 USPQ 761 (CCPA 1982); In re Vogel, 422 F.2d 438, 164 USPQ 619 (CCPA 1970); In re Thorington, 418 F.2d 528, 163 USPQ 644 (CCPA 1969). A timely filed terminal disclaimer in compliance with 37 CFR 1.321(c) or 1.321(d) may be used to overcome an actual or provisional rejection based on nonstatutory double patenting provided the reference application or patent either is shown to be commonly owned with the examined application, or claims an invention made as a result of activities undertaken within the scope of a joint research agreement. See MPEP § 717.02 for applications subject to examination under the first inventor to file provisions of the AIA as explained in MPEP § 2159. See MPEP § 2146 et seq. for applications not subject to examination under the first inventor to file provisions of the AIA . A terminal disclaimer must be signed in compliance with 37 CFR 1.321(b). The filing of a terminal disclaimer by itself is not a complete reply to a nonstatutory double patenting (NSDP) rejection. A complete reply requires that the terminal disclaimer be accompanied by a reply requesting reconsideration of the prior Office action. Even where the NSDP rejection is provisional the reply must be complete. See MPEP § 804, subsection I.B.1. For a reply to a non-final Office action, see 37 CFR 1.111(a). For a reply to final Office action, see 37 CFR 1.113(c). A request for reconsideration while not provided for in 37 CFR 1.113(c) may be filed after final for consideration. See MPEP §§ 706.07(e) and 714.13. The USPTO Internet website contains terminal disclaimer forms which may be used. Please visit www.uspto.gov/patent/patents-forms. The actual filing date of the application in which the form is filed determines what form (e.g., PTO/SB/25, PTO/SB/26, PTO/AIA /25, or PTO/AIA /26) should be used. A web-based eTerminal Disclaimer may be filled out completely online using web-screens. An eTerminal Disclaimer that meets all requirements is auto-processed and approved immediately upon submission. For more information about eTerminal Disclaimers, refer to www.uspto.gov/patents/apply/applying-online/eterminal-disclaimer. Claims 1, 10-12, and 17 are rejected on the ground of nonstatutory double patenting as being unpatentable over claims 1-6 of U.S. Patent 12,304,932 (application 16/763,732) in view of Takayama et al. U.S. Patent Application Publication 2011/0212899 published September 1, 2011. U.S. Patent 12,304,932 claims SEQ ID NO: 3 wherein the aspartic acids at residues 3 and/or 8 are substituted with tetrazole, amino acids can be deleted or added, and N-terminal acetylation. Takayama et al. teach methods of treating keratitis, keratopathy, and/or corneal neutritogenesis via administering PACAP38 (present SEQ ID NO: 1), PACAP27 (present SEQ ID NOs: 2 and 3), or a derivative thereof which may also have deletions (i.e. modified sequence) and/or N-terminal acetylation (please refer to the entire specification particularly the abstract; paragraphs 4, 6, 8-23, 35, 57, 66, 71). The claims would have been obvious because a particular known technique (i.e. treating keratitis or keratopathy and/or corneal neutritogenesis via utilizing PACAP27) was recognized as part of the ordinary capabilities of one skilled in the art. See KSR International Co. v. Teleflex Inc., 82 USPQ2d 1385 (U.S. 2007). This is a provisional nonstatutory double patenting rejection. Arguments and Response Applicants’ arguments directed to the rejection on the ground of nonstatutory obviousness-type double patenting as being unpatentable over U.S. Patent 12,304,932 and Takayama et al. for claims 1, 10-12, and 17 were considered but are not persuasive for the following reasons. Applicants contend that since U.S. Patent 12,304,932 does not claim methods of treatment, the patent cannot be utilized in a Double Patenting rejection. Applicants also contend that Takayama et al. so not teach present SEQ ID NO: 3. Applicants’ arguments are not convincing since the claimed invention of U.S. Patent 12,304,932 and Takayama et al. renders obvious the method of the instant claims. U.S. Patent 12,304,932 claims present SEQ ID NO: 3 wherein the aspartic acids at residues 3 and/or 8 are substituted with tetrazole, amino acids can be deleted or added, and N-terminal acetylation. Takayama et al. teach methods of treating keratitis, keratopathy, and/or corneal neutritogenesis via administering PACAP38 (present SEQ ID NO: 1), PACAP27 (present SEQ ID NOs: 2 and 3), or a derivative thereof which may also have deletions (i.e. modified sequence) and/or N-terminal acetylation (please refer to the entire specification particularly the abstract; paragraphs 4, 6, 8-23, 35, 57, 66, 71). In response to applicant's arguments against the references individually, one cannot show nonobviousness by attacking references individually where the rejections are based on combinations of references. See In re Keller, 642 F.2d 413, 208 USPQ 871 (CCPA 1981); In re Merck & Co., 800 F.2d 1091, 231 USPQ 375 (Fed. Cir. 1986). In addition, while a request may be made that objections or requirements as to form not necessary to further consideration of the claims be held in abeyance until allowable subject matter is indicated, the present is a rejection and will not be held in abeyance (see MPEP § 714.02). Conclusion The prior art made of record and not relied upon is considered pertinent to applicant's disclosure. U.S. Patent 5,198,542 (SEQ ID NOs: 7 and 15 have 100% identity and the same length as present SEQ ID NOs: 1 and 2 wherein SEQ ID NO: 1 is a fusion of SEQ ID NO: 3-SEQ ID NO: 37). JP 2001151799 (SEQ ID NOs: 3 and 4 have 100% identity and the same length as present SEQ ID NOs: 1 and 2 wherein SEQ ID NO: 1 is a fusion of SEQ ID NO: 3-SEQ ID NO: 37). U.S. Patent Application Publication 20020155533 wherein SEQ ID NO: 47 has 100% identity and the same length as present SEQ ID NO: 2. WO 2010/036936 wherein SEQ ID NO: 56 has 100% identity and the same length as present SEQ ID NO: 3. U.S. Patent Application Publication 20040132648 wherein SEQ ID NO: 17 has 100% identity and the same length as present SEQ ID NO: 3. Future Communications Any inquiry concerning this communication or earlier communications from the examiner should be directed to AMBER D STEELE whose telephone number is (571)272-5538. The examiner can normally be reached M-F 8-5. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Melissa Fisher can be reached on 571-270-7430. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /AMBER D STEELE/Primary Examiner, Art Unit 1658
Read full office action

Prosecution Timeline

Nov 12, 2021
Application Filed
Sep 27, 2024
Non-Final Rejection — §103, §DP
Feb 28, 2025
Response Filed
May 08, 2025
Final Rejection — §103, §DP
Oct 28, 2025
Response after Non-Final Action
Nov 13, 2025
Request for Continued Examination
Nov 14, 2025
Response after Non-Final Action
Mar 16, 2026
Non-Final Rejection — §103, §DP (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12600749
COMPSTATIN ANALOGUES AND THEIR MEDICAL USES
2y 5m to grant Granted Apr 14, 2026
Patent 12589148
IMMUNITY-INDUCING AGENT COMPRISING ANTIGEN PEPTIDE-ADJUVANT NUCLEOTIDE CONJUGATE AND PHARMACEUTICAL COMPOSITION COMPRISING SAME
2y 5m to grant Granted Mar 31, 2026
Patent 12583891
PEPTIDES AND METHODS FOR THE TREATMENT OF DIABETES
2y 5m to grant Granted Mar 24, 2026
Patent 12570696
TUMOR-SPECIFIC POLYPEPTIDE SEQUENCE AND USE THEREOF
2y 5m to grant Granted Mar 10, 2026
Patent 12569508
ANTIMICROBIAL COMPOSITIONS AND METHODS OF USE
2y 5m to grant Granted Mar 10, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

AI Strategy Recommendation

Get an AI-powered prosecution strategy using examiner precedents, rejection analysis, and claim mapping.
Powered by AI — typically takes 5-10 seconds

Prosecution Projections

3-4
Expected OA Rounds
59%
Grant Probability
68%
With Interview (+8.9%)
3y 2m
Median Time to Grant
High
PTA Risk
Based on 797 resolved cases by this examiner. Grant probability derived from career allow rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month