Prosecution Insights
Last updated: April 19, 2026
Application No. 17/627,088

PRODUCTION OF FUCOSYLLACTOSE IN HOST CELLS

Non-Final OA §103§112
Filed
Jan 13, 2022
Examiner
HOLLAND, PAUL J
Art Unit
1656
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
Inbiose N V
OA Round
3 (Non-Final)
58%
Grant Probability
Moderate
3-4
OA Rounds
3y 1m
To Grant
99%
With Interview

Examiner Intelligence

Grants 58% of resolved cases
58%
Career Allow Rate
439 granted / 764 resolved
-2.5% vs TC avg
Strong +65% interview lift
Without
With
+65.3%
Interview Lift
resolved cases with interview
Typical timeline
3y 1m
Avg Prosecution
55 currently pending
Career history
819
Total Applications
across all art units

Statute-Specific Performance

§101
8.0%
-32.0% vs TC avg
§103
31.6%
-8.4% vs TC avg
§102
18.6%
-21.4% vs TC avg
§112
29.5%
-10.5% vs TC avg
Black line = Tech Center average estimate • Based on career data from 764 resolved cases

Office Action

§103 §112
DETAILED CORRESPONDENCE Application Status 1. The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . 2. A request for continued examination under 37 CFR 1.114, including the fee set forth in 37 CFR 1.17(e), was filed in this application after final rejection. Since this application is eligible for continued examination under 37 CFR 1.114, and the fee set forth in 37 CFR 1.17(e) has been timely paid, the finality of the previous Office action has been withdrawn pursuant to 37 CFR 1.114. Applicant's submission filed on 02/26/2026 has been entered. 3. Applicant’s amendment to the claims filed on 02/26/2026 in response to the Final Rejection mailed on 12/04/2025 is acknowledged. This listing of claims replaces all prior listings of claims in the application. 4. Claims 10, 16, 22, 28, 34, and 53 are cancelled. 5. New claims 74-76 are added. 6. Claims 37-48, 51, 59-65, and 67-76 are pending. 7. Claims 37-48, 65, and 67-72 stand withdrawn pursuant to 37 CFR 1.142(b). 8. Applicant’s remarks filed on 02/26/2026 in response to the Final Rejection mailed on 12/4/2025 have been fully considered and are deemed persuasive to overcome at least one of the rejections and/or objections as previously applied. The text of those sections of Title 35 U.S. Code not included in the instant action can be found in the prior Office Action. Information Disclosure Statement 9. The IDSs filed on 02/26/2026 and 03/11/2026 have been considered by the examiner and copies of the Form PTO/SB/08 is attached to the office action. Claim Rejections - 35 USC § 112(b) 10. The rejection of claims 51, 53, and 59-64 under 35 U.S.C. 112(b) or 35 U.S.C. 112 (pre-AIA ), second paragraph, is withdrawn in view of applicants’ amendment to the claims. Claim Rejections - 35 USC § 103 11. The rejection of claim 53 under 35 U.S.C. 103 as being unpatentable over Hollands et al. (WO 2019/209241 A1, priority to 04/23/2018; cited on IDS filed on 12/21/2023) in view of Yardeni et al. (Research in Microbiology, 2018; cited on PTO-892 mailed on 12/04/2025), and Philippe et al. (WO 2019/099649 A1; priority to 11/20/2017; cited on PTO-892 mailed on 12/04/2025) as evidenced by Genbank MDFA_ECOLI (Genbank, 2018; cited on PTO-892 mailed on 12/04/2025) is withdrawn in view of applicants’ amendment to the claims to cancel claim 53. 12. The rejection of claims 51, 59-64, and 73 under 35 U.S.C. 103 as being unpatentable over Hollands et al. (WO 2019/209241 A1, priority to 04/23/2018; cited on IDS filed on 12/21/2023) in view of Yardeni et al. (Research in Microbiology, 2018; cited on PTO-892 mailed on 12/04/2025), and Philippe et al. (WO 2019/099649 A1; priority to 11/20/2017; cited on PTO-892 mailed on 12/04/2025) as evidenced by Genbank MDFA_ECOLI (Genbank, 2018; cited on PTO-892 mailed on 12/04/2025) is maintained for the reasons of record and the reasons set forth below. The rejection has been modified in order to address applicants’ amendment to the claims and to address applicant’s remarks and to incorporate new claims 74-76. 13. Claims 51, 59-64, and 73-76 are rejected under 35 U.S.C. 103 as being unpatentable over Hollands et al. (WO 2019/209241 A1, priority to 04/23/2018; cited on IDS filed on 12/21/2023) in view of Yardeni et al. (Research in Microbiology, 2018; cited on PTO-892 mailed on 12/04/2025), and Philippe et al. (WO 2019/099649 A1; priority to 11/20/2017; cited on PTO-892 mailed on 12/04/2025) as evidenced by Genbank MDFA_ECOLI (Genbank, 2018; cited on PTO-892 mailed on 12/04/2025). 14. With respect to claim 51, Hollands et al. teach a host cell genetically modified for production of fucosyllactose, wherein the host cell comprises one nucleic acid sequence coding for a fucosyltransferase that transfers GDP-fucose to a lactose acceptor to synthesize fucosyllactose and the cell further comprises expression of a heterologous membrane protein to enhance fucosyllactose transport wherein the membrane protein is a Sugar porter or a SWEET transporter (porter protein not belonging to the SET family) [see Abstract; Figure 1; p. 2-3]. With respect to claim 53, Hollands et al. teach a host cell genetically modified for production of fucosyllactose, wherein the host cell comprises one nucleic acid sequence coding for a fucosyltransferase that transfers GDP-fucose to a lactose acceptor to synthesize fucosyllactose and the cell further comprises expression of a heterologous membrane protein to enhance fucosyllactose transport wherein the membrane protein is a Sugar porter or a SWEET transporter [see Abstract; Figure 1; p. 2-3]. With respect to claim 59, Hollands et al. teach the host cell wherein the membrane protein is a transporter protein involved in transport of compounds across the outer membrane of the cell wall [see Abstract; p. 2-3]. With respect to claim 60, Hollands et al. teach the host cell wherein the cell is cultured under suitable conditions (interpreted as stably) [see p. 3]. With respect to claim 61, Hollands et al. teach the host cell wherein the cell is selected from a microbial cell [see p. 3]. With respect to claim 62, Hollands et al. teach wherein the cell is an Escherichia coli cell [see p. 18]. With respect to claim 63, Hollands et al. teach host cell wherein the host cell comprise modification to improve the efficiency of production of fucosyllactose including improvements to carbon flux such as knocking out pathways that compete for key intermediates of the present fucosyllactose pathway [see p. 25, lines 10-16]. With respect to claim 64, Hollands et al. teach the host cell wherein the fucosyllactose is 2’-fucosyllactose [see Abstract]. With respect to claim 73, Hollands et al. teach a host cell genetically modified for production of fucosyllactose, wherein the host cell comprises one nucleic acid sequence coding for a fucosyltransferase that transfers GDP-fucose to a lactose acceptor to synthesize fucosyllactose and the cell further comprises expression of a heterologous membrane protein to enhance fucosyllactose transport wherein the membrane protein is a Sugar porter or a SWEET transporter (porter protein not belonging to the SET family) [see Abstract; Figure 1; p. 2-3]. Hollands et al. teach host cell wherein the host cell comprise modification to improve the efficiency of production of fucosyllactose including improvements to carbon flux such as knocking out pathways that compete for key intermediates of the present fucosyllactose pathway [see p. 25, lines 10-16]. With respect to claims 74-75, Hollands et al. teach a host cell further modified to express one or more genes encoding enzyme of the de novo synthesis of GDP-fucose [see Example 8]. With respect to claim 76, Hollands et al. teach the host cell further comprises introduction and/or overexpression of a lactose permease [see Example 8]. However, Hollands et al. does not explicitly teach the host cell of claims 51 and 73, wherein the membrane protein is selected from the group consisting of the specific membrane proteins recited in claims 51 and 73. Yardeni et al. teach that E. coli MdfA is a member of a large group of secondary multidrug transporters that has the ability to interact with chemically unrelated drugs to drive efflux of compounds that are not only structurally, but also electrically, different [see Abstract; p. 455]. Evidentiary reference Genbank is cited to demonstrate that E. coli MdfA comprises an amino acid sequence that is 100% identical to the amino acid sequence of SEQ ID NO: 2 [see alignment attached as APPENDIX A]. Phillipe et al. teach genetically modified host cells, including E. coli, designed for producing sweetener compounds, steviol glycosides, and efflux of said compounds out of the host cells be expressing a transporter such as MdfA [see Abstract; p. 2, p. 6, lines 3-17]. Phillipe et al. also teach that suitable transporters include E. coli transporters sharing at least 50% identity to bcr, emrD, emrE, mdfA, mdtD, mhpT, setA, ydhC, yhhS, yjhB, and ynfM [see claim 34]. Before the effective filing date of the claimed invention, it would have been obvious for one of ordinary skill in the art to combine the teachings of Hollands et al., Yardeni et al. and Phillipe et al. according to the teachings of Yardeni et al. and Phillipe et al. to use the bcr, emrD, emrE, mdfA, mdtD, mhpT, setA, ydhC, yhhS, yjhB, and ynfM transporters Yardeni et al. and Phillipe et al. in the host cells of Hollands et al. because Hollands et al. teach genetically modified host cells expressing an efflux porter membrane protein such as a sugar transporter or setA for the efflux of fucosyllactose. Yardeni et al. teach that E. coli MdfA is a multidrug transporter with broad specificity for a variety of structurally different compounds and Phillipe et al. teach that bcr, emrD, emrE, mdfA, mdtD, mhpT, setA, ydhC, yhhS, yjhB, and ynfM are obvious variants of transporters that can be heterologously expressed for the efflux of sweetener compounds such as steviol glycosides. One of ordinary skill in the art would have had a reasonable expectation of success and a reasonable level of predictability to combine the teachings of Hollands et al., Yardeni et al., and Phillipe et al. because Yardeni et al. acknowledges that MdfA has a broad specificity for the efflux of compounds and Phillipe et al. acknowledges that bcr, emrD, emrE, mdfA, mdtD, mhpT, setA, ydhC, yhhS, yjhB, and ynfM can be heterologously expressed in host cells for the efflux of sweeteners. Therefore, the above invention would have been prima facie obvious to one of ordinary skill in the art before the effective filing date of the claimed invention. RESPONSE TO REMARKS: Applicants’ remarks filed on 02/26/2026 have been fully considered by the examiner; however, they are found to be not persuasive for the reasons set forth above and the reasons set forth below. Regarding applicants’ remarks that there is no reasonable expectation of success that an MdfA would successfully export fucosyllactose, MPEP 2143 states “[t]he Supreme Court in KSR Int'l Co. v. Teleflex Inc., 550 U.S. 398, 415-421, 82 USPQ2d 1385, 1395-97 (2007) identified a number of rationales to support a conclusion of obviousness which are consistent with the proper "functional approach" to the determination of obviousness as laid down in Graham. The key to supporting any rejection under 35 U.S.C. 103 is the clear articulation of the reason(s) why the claimed invention would have been obvious. The Supreme Court in KSR noted that the analysis supporting a rejection under 35 U.S.C. 103 should be made explicit. In Ball Aerosol v. Ltd. Brands, 555 F.3d 984, 89 USPQ2d 1870 (Fed. Cir. 2009), the Federal Circuit offered additional instruction as to the need for an explicit analysis. The Federal Circuit explained that the Supreme Court’s requirement for an explicit analysis does not require record evidence of an explicit teaching of a motivation to combine in the prior art.” In the instant case, Hollands et al. identifies sugar transporters such as setA as suitable for the export of fucosyllactose. Yardeni et al. teach the broad substrate specificity of MdfA and Phillipe et al. teach several suitable transporters considered to be obvious variants for the export of sweetener compounds such as steviol glycosides that include bcr, emrD, emrE, mdfA, mdtD, mhpT, setA, ydhC, yhhS, yjhB, and ynfM. Given that fucosyllactose and steviol glycosides are both sweetener compounds and given that setA has already been established as a suitable transporter for fucosyllactose as taught by Hollands et al. and Phillipe et al. considers bcr, emrD, emrE, mdfA, mdtD, mhpT, setA, ydhC, yhhS, yjhB, and ynfM as obvious variants, one of ordinary skill in the art would have a reasonable expectation of success and reasonable level of predictability that these transporters could also be used for the export of fucosyllactose. Regarding applicants’ remarks regarding the scope of the Markush grouping not being addressed, this argument is found to be not persuasive in view of the modified rejection set forth above. Furthermore, the claim only requires one of the transporters as it is “selected from” said grouping and any art teaching a single transporter in said group would read on said claim. Conclusion 15. Status of the claims: Claims 37-48, 51, 59-65, and 67-76 are pending. Claims 37-48, 65, and 67-72 stand withdrawn pursuant to 37 CFR 1.142(b). Claims 51, 59-64, and 73-76 are rejected. No claims are in condition for an allowance. Any inquiry concerning this communication or earlier communications from the examiner should be directed to PAUL J HOLLAND whose telephone number is (571)270-3537. The examiner can normally be reached Monday to Friday from 8AM to 5PM. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Manjunath Rao can be reached at 571-272-0939. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /PAUL J HOLLAND/Primary Examiner, Art Unit 1656 APPENDIX A Genbank with SEQ ID NO: 2 ALIGNMENT: Query Match 100.0%; Score 2068; Length 420; Best Local Similarity 100.0%; Matches 410; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 MQNKLASGARLGRQALLFPLCLVLYEFSTYIGNDMIQPGMLAVVEQYQAGIDWVPTSMTA 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 11 MQNKLASGARLGRQALLFPLCLVLYEFSTYIGNDMIQPGMLAVVEQYQAGIDWVPTSMTA 70 Qy 61 YLAGGMFLQWLLGPLSDRIGRRPVMLAGVVWFIVTCLAILLAQNIEQFTLLRFLQGISLC 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 71 YLAGGMFLQWLLGPLSDRIGRRPVMLAGVVWFIVTCLAILLAQNIEQFTLLRFLQGISLC 130 Qy 121 FIGAVGYAAIQESFEEAVCIKITALMANVALIAPLLGPLVGAAWIHVLPWEGMFVLFAAL 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 131 FIGAVGYAAIQESFEEAVCIKITALMANVALIAPLLGPLVGAAWIHVLPWEGMFVLFAAL 190 Qy 181 AAISFFGLQRAMPETATRIGEKLSLKELGRDYKLVLKNGRFVAGALALGFVSLPLLAWIA 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 191 AAISFFGLQRAMPETATRIGEKLSLKELGRDYKLVLKNGRFVAGALALGFVSLPLLAWIA 250 Qy 241 QSPIIIITGEQLSSYEYGLLQVPIFGALIAGNLLLARLTSRRTVRSLIIMGGWPIMIGLL 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 251 QSPIIIITGEQLSSYEYGLLQVPIFGALIAGNLLLARLTSRRTVRSLIIMGGWPIMIGLL 310 Qy 301 VAAAATVISSHAYLWMTAGLSIYAFGIGLANAGLVRLTLFASDMSKGTVSAAMGMLQMLI 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 311 VAAAATVISSHAYLWMTAGLSIYAFGIGLANAGLVRLTLFASDMSKGTVSAAMGMLQMLI 370 Qy 361 FTVGIEISKHAWLNGGNGLFNLFNLVNGILWLSLMVIFLKDKQMGNSHEG 410 |||||||||||||||||||||||||||||||||||||||||||||||||| Db 371 FTVGIEISKHAWLNGGNGLFNLFNLVNGILWLSLMVIFLKDKQMGNSHEG 420
Read full office action

Prosecution Timeline

Jan 13, 2022
Application Filed
May 29, 2025
Non-Final Rejection — §103, §112
Sep 02, 2025
Response Filed
Dec 01, 2025
Final Rejection — §103, §112
Feb 26, 2026
Request for Continued Examination
Mar 09, 2026
Response after Non-Final Action
Mar 19, 2026
Non-Final Rejection — §103, §112 (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12595501
EXPRESSION OF PRODUCTS FROM NUCLEIC ACID CONCATEMERS
2y 5m to grant Granted Apr 07, 2026
Patent 12595496
Enzymatic Biosynthesis Of Lactones
2y 5m to grant Granted Apr 07, 2026
Patent 12565519
RECOMBINANT STRAINS AND MEDIUM FORMULATION FOR ENHANCING SECRETION TITER USING A TYPE III SECRETION SYSTEM
2y 5m to grant Granted Mar 03, 2026
Patent 12565668
USE OF BIOMAGNETISM FOR BIOGAS PRODUCTION
2y 5m to grant Granted Mar 03, 2026
Patent 12565665
COMPOSITIONS AND METHODS FOR CONTROLLED MRNA TRANSLATION AND STABILITY
2y 5m to grant Granted Mar 03, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

AI Strategy Recommendation

Get an AI-powered prosecution strategy using examiner precedents, rejection analysis, and claim mapping.
Powered by AI — typically takes 5-10 seconds

Prosecution Projections

3-4
Expected OA Rounds
58%
Grant Probability
99%
With Interview (+65.3%)
3y 1m
Median Time to Grant
High
PTA Risk
Based on 764 resolved cases by this examiner. Grant probability derived from career allow rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month