Prosecution Insights
Last updated: April 19, 2026
Application No. 17/640,293

THERAPEUTIC FUSION PROTEINS

Final Rejection §112§DP
Filed
Mar 03, 2022
Examiner
DEBERRY, REGINA M
Art Unit
1647
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
Novartis AG
OA Round
2 (Final)
50%
Grant Probability
Moderate
3-4
OA Rounds
3y 8m
To Grant
81%
With Interview

Examiner Intelligence

Grants 50% of resolved cases
50%
Career Allow Rate
292 granted / 587 resolved
-10.3% vs TC avg
Strong +31% interview lift
Without
With
+31.3%
Interview Lift
resolved cases with interview
Typical timeline
3y 8m
Avg Prosecution
42 currently pending
Career history
629
Total Applications
across all art units

Statute-Specific Performance

§101
2.2%
-37.8% vs TC avg
§103
27.4%
-12.6% vs TC avg
§102
21.2%
-18.8% vs TC avg
§112
34.3%
-5.7% vs TC avg
Black line = Tech Center average estimate • Based on career data from 587 resolved cases

Office Action

§112 §DP
DETAILED ACTION Notice of Pre-AIA or AIA Status The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . Status of Application, Amendments and/or Claims The amendment and Applicant’s arguments, filed 11 November 2025, have been entered in full. Claims 2-21 are canceled. Claim 1 is amended. New claims 22-26 are added. Claims 1, 22-26 are under examination. Information Disclosure Statement The information disclosure statement(s) (IDS) (filed 10/29/2025 and 1/27/2026) were received and comply with the provisions of 37 CFR §§1.97, 1.98 and MPEP § 609. They have been placed in the application file and the information referred to therein has been considered as to the merits. Withdrawn Objections And/Or Rejections The objection to the drawings, as set forth at page 3 the previous Office Action (12 August 2025), is withdrawn in view of the amendment (29 October 2025). The objection to claims 6, 7, 9-14, 16, 17 and 18 under 37 CFR 1.75(c), as set forth at page 3 the previous Office Action (12 August 2025), is withdrawn in view of the amendment (29 October 2025). The rejection to claims 2 and 3 under 35 U.S.C. 112(b) or 35 U.S.C. 112 (pre-AIA ), second paragraph, as set forth at page 4 the previous Office Action (12 August 2025), is withdrawn in view of the amendment (29 October 2025). The rejection to claims 1-5 and 8 under 35 U.S.C. 102(a1) and 35 U.S.C. 102(a2) as being anticipated by Hay (US 2016/0060358; published 03 March 2016) as evidenced by Wang et al. (US 2014/0121163; published 01 May 2014), as set forth at pages 12-15 the previous Office Action (12 August 2025), is withdrawn in view of the amendment (29 October 2025). The rejection to claim 15 under 35 U.S.C. 102(a1) and 35 U.S.C. 102(a2) as being anticipated by Hajishengallis et al. (US 2017/0136089; published 18 May 2017), as set forth at page 15 the previous Office Action (12 August 2025), is withdrawn in view of the amendment (29 October 2025). Claim Rejections-35 USC § 112 a) or 35 U.S.C. 112 (pre-AIA ), First paragraph, Written description The following is a quotation of the first paragraph of 35 U.S.C. 112(a): (a) IN GENERAL.—The specification shall contain a written description of the invention, and of the manner and process of making and using it, in such full, clear, concise, and exact terms as to enable any person skilled in the art to which it pertains, or with which it is most nearly connected, to make and use the same, and shall set forth the best mode contemplated by the inventor or joint inventor of carrying out the invention. The following is a quotation of the first paragraph of pre-AIA 35 U.S.C. 112: The specification shall contain a written description of the invention, and of the manner and process of making and using it, in such full, clear, concise, and exact terms as to enable any person skilled in the art to which it pertains, or with which it is most nearly connected, to make and use the same, and shall set forth the best mode contemplated by the inventor of carrying out his invention. Claims 1, (and new claims 22-25) remain rejected under 35 U.S.C. 112(a) or 35 U.S.C. 112 (pre-AIA ), first paragraph, as failing to comply with the written description requirement. The basis for this rejection is set forth at pages 5-12 of the previous Office Action (12 August 2025). APPLICANT’S ARGUMENTS Applicant argues that the rejection is moot in view of the present claims, which are for example, claim 1, narrowly directed to a therapeutic fusion having at least 90% identity to SEQ ID NO: 73. Applicant’s arguments have been fully considered but are not found persuasive for the following reasons: 1. The instant specification teaches the utility of the claimed therapeutic fusion protein as a therapeutic for the treatment of acute or chronic inflammatory disorders and immune system or coagulation driven or microvascular disorders. The specification teaches that the claimed therapeutic fusion has the biological function of binding integrin, solubilizing and mediating/enhancing efferocytosis. The claimed therapeutic fusion protein comprises the amino acid sequence of SEQ ID NO:73, which has 783 amino acid residues. The instant claims are drawn to a therapeutic fusion protein having at least 90% identity to SEQ ID NO: 73. The artisan would understand this to mean 10% of the entire length of the sequence can change. This ultimately means 78.3 amino acid residues changes, which would encompass amino acid residue additions, deletions and/or substitutions. The instant specification fails to teach where these changes can be made and the type of changes. 2. Additionally, said therapeutic fusion protein having at least 90% identity to SEQ ID NO: 73 comprises variant domains; MFG-E8 EGF-like domain, HSA domain and C1 discoidin sub-domain that are at least 95% identical to SEQ ID NO: 2, SEQ ID Nos: 5 or 6 and SEQ ID NO: 3, respectively (see new claims 22-25). The Examiner has provided a sequence alignment between SEQ ID NO:73 and the domains comprising SEQ ID NO: 2, SEQ ID Nos: 5 or 6 and SEQ ID NO: 3. See below, Sequence Search Result A. The instant specification fails to teach how to make a therapeutic fusion protein having at least 90% identity to SEQ ID NO: 73; where the variant domains are at least 95% identical to SEQ ID NO: 2, SEQ ID Nos: 5 or 6 and/or SEQ ID NO: 3, which also has the proper biological function. For example, HSA domain SEQ ID NO: 5 has 583 amino acids. The claims recite that the HSA domain has an amino acid sequence that is at least 95% identical to SEQ ID NO: 5, which means about 29 amino acid changes. The sequence alignment between the therapeutic fusion protein (SEQ ID NO:73) and the HSA domain (SEQ ID NO: 5) shows 100% identity starting at amino acid residue 47 of SEQ ID NO: 73 and amino acid residue 1 of SEQ ID NO: 5 and ending at amino acid residue 622 of SEQ ID NO: 73 and amino acid residue 577 of SEQ ID NO:5. The instant specification fails to teach if the total 78.3 amino acid residues changes in SEQ ID NO: 73 include the 29 amino acid changes within the HSA domain (SEQ ID NO:5). The specification fails to teach where 29 changes can be made in the HSA domain (SEQ ID NO: 5). The same logic applies for the other domains. The specification fails to provide Written Description regarding the type of amino acid residue changes (e.g. additions, substitutions, deletions) and where these changes can be made within the MFG-E8 EGF-like, HSA, C1 discoidin sub-domains and across the SEQ ID NO: 73 sequence. The scientific reasoning and evidence as a whole indicates that the rejection should be maintained. NEW CLAIM REJECTIONS/OBJECTIONS Claim Objections Claims 22, 23 and 25 are objected to because of the following informalities: Claim 22 should recite, “…comprising a C1 discoidin sub-domain having at least 95% identity to the amino acid sequence set forth in SEQ ID NO: 3”. Claim 23 should recite, “..comprising a human serum albumin (HSA) domain having at least 95% identity to the amino acid sequence set forth in SEQ ID NO: 5 or SEQ ID NO: 6..” Claim 25 should recite, “..comprising an MFG-E8 EGF-like domain having at least 95% identity to the amino acid sequence set forth in SEQ ID NO: 2; an HSA domain having at least 95% identity to the amino acid sequence set forth in SEQ ID NO: 5; and a C1 discoidin sub-domain having at least 95% identity to the amino acid sequence set forth in SEQ ID NO: 3”. Appropriate correction is required. Claim Rejections-35 USC § 112 (b) or 35 U.S.C. 112 (pre-AIA ), second paragraph The following is a quotation of 35 U.S.C. 112(b): (b) CONCLUSION.—The specification shall conclude with one or more claims particularly pointing out and distinctly claiming the subject matter which the inventor or a joint inventor regards as the invention. The following is a quotation of 35 U.S.C. 112 (pre-AIA ), second paragraph: The specification shall conclude with one or more claims particularly pointing out and distinctly claiming the subject matter which the applicant regards as his invention. Claims 1, 22-25 are rejected under 35 U.S.C. 112(b) or 35 U.S.C. 112 (pre-AIA ), second paragraph, as being indefinite for failing to particularly point out and distinctly claim the subject matter which the inventor or a joint inventor (or for applications subject to pre-AIA 35 U.S.C. 112, the applicant), regards as the invention. Claims 1, 22-25 are indefinite because of the recitation, “..an amino acid sequence..”. It is not clear if the claims read on peptide fragments (such as comprising only one or two amino acid residues) or comprising the recited SEQ ID NO: sequence. Amending the claims to recite, "..the amino acid sequence..", would be remedial. Claim Rejections-35 U.S.C. 112(a) or 35 U.S.C. 112 (pre-AIA ), First paragraph, Written description, New Matter The following is a quotation of the first paragraph of 35 U.S.C. 112(a): (a) IN GENERAL.—The specification shall contain a written description of the invention, and of the manner and process of making and using it, in such full, clear, concise, and exact terms as to enable any person skilled in the art to which it pertains, or with which it is most nearly connected, to make and use the same, and shall set forth the best mode contemplated by the inventor or joint inventor of carrying out the invention. The following is a quotation of the first paragraph of pre-AIA 35 U.S.C. 112: The specification shall contain a written description of the invention, and of the manner and process of making and using it, in such full, clear, concise, and exact terms as to enable any person skilled in the art to which it pertains, or with which it is most nearly connected, to make and use the same, and shall set forth the best mode contemplated by the inventor of carrying out his invention. Claims 22-25 are rejected under 35 U.S.C. 112(a) or 35 U.S.C. 112 (pre-AIA ), first paragraph, as failing to comply with the written description requirement. The claim(s) contains subject matter which was not described in the specification in such a way as to reasonably convey to one skilled in the relevant art that the inventor or a joint inventor, or for applications subject to pre-AIA 35 U.S.C. 112, the inventor(s), at the time the application was filed, had possession of the claimed invention. This is a New Matter Rejection. The specification as originally filed does not provide support for the invention as now claimed: “A therapeutic fusion protein comprising a C1 discoidin sub-domain at least 95% identical to an amino acid sequence set forth in SEQ ID NO: 3, wherein said therapeutic fusion protein comprises an amino acid sequence having at least 90% identity to SEQ ID NO. 73”. “A therapeutic fusion protein comprising a human serum albumin (HSA) domain having an amino acid sequence at least 95% identical to an amino acid sequence set forth in SEQ ID NO: 5 or 6, wherein said therapeutic fusion protein comprises an amino acid sequence having at least 90% identity to SEQ ID NO. 73”. “A therapeutic fusion protein comprising an EGF-like domain of milk fat globule epidermal growth factor 8 protein (MFG-E8) having at least 95% identity to an amino acid sequence set forth in SEQ ID NO: 2, wherein said therapeutic fusion protein comprises an amino acid sequence having at least 90% identity to SEQ ID NO. 73” “A therapeutic fusion protein comprising an MFG-E8 EGF-like domain having an amino acid sequence at least 95% identical to SEQ ID NO: 2; an HSA domain having an amino acid sequence at least 95% identical to SEQ ID NO: 5; and C1 discoidin sub-domain at least 95% identical to an amino acid sequence set forth in SEQ ID NO: 3, wherein said therapeutic fusion protein an amino acid sequence having at least 90% identity to SEQ ID NO. 73”. Applicant's amendment, filed 11 November 2025, asserts that no new matter has been added and directs support to page 106, embodiment 38 (for amended claim 1), last paragraph on page 6 (for new claims 22 and 25), last paragraph on page 7 (for new claims 23 and 25), last full paragraph on page 7 (for new claims 24 and 25) and page 106 (for new claim 26). The wording or connotation of the instant claim(s) is not readily apparent from said sections. That is to say, the Examiner finds Written Support for: A therapeutic fusion protein comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 73. A therapeutic fusion protein comprising the amino acid sequence as set forth in SEQ ID NO: 73. A therapeutic fusion protein comprising a C1 discoidin sub-domain at least 95% identical to an amino acid sequence set forth in SEQ ID NO: 3, wherein said therapeutic fusion protein comprises the amino acid sequence as set forth in SEQ ID NO: 73. A therapeutic fusion protein comprising a human serum albumin (HSA) domain having an amino acid sequence at least 95% identical to an amino acid sequence set forth in SEQ ID NO: 5 or 6, wherein said therapeutic fusion protein comprises the amino acid sequence as set forth in SEQ ID NO: 73. A therapeutic fusion protein comprising an EGF-like domain of milk fat globule epidermal growth factor 8 protein (MFG-E8) having at least 95% identity to an amino acid sequence set forth in SEQ ID NO: 2, wherein said therapeutic fusion protein comprises the amino acid sequence as set forth in SEQ ID NO: 73 A therapeutic fusion protein comprising an MFG-E8 EGF-like domain having an amino acid sequence at least 95% identical to SEQ ID NO: 2; an HSA domain having an amino acid sequence at least 95% identical to SEQ ID NO: 5; and C1 discoidin sub-domain at least 95% identical to an amino acid sequence set forth in SEQ ID NO: 3, wherein said therapeutic fusion protein comprises the amino acid sequence as set forth in SEQ ID NO: 73. The Examiner cannot find Written Support for: A therapeutic fusion protein comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 73, wherein: the MFG-E8 EGF-like domain is at least 95% identical the amino acid sequence set forth in SEQ ID NO: 2, the HSA domain is at least 95% identical to the amino acid sequence set forth in SEQ ID NO:5, the HSA domain is at least 95% identical to the amino acid sequence set forth in SEQ ID NO:6 and/or the C1 discoidin sub-domain is at least 95% identical to the amino acid sequence set forth in SEQ ID NO: 3. The specification as filed does not provide a written description or set forth the metes and bounds of this "limitations". The Examiner cannot find a teaching that describes how to make variant domains (i.e. MFG-E8 EGF-like domain, HSA domain, C1 discoidin sub-domain) in an amino acid sequence that is 90% identical to instant SEQ ID NO: 73. The instant claims now recite limitations which were not disclosed in the specification as filed, and now change the scope of the instant disclosure as-filed. Applicant is required to cancel the new matter in the response to this Office action. Alternatively, Applicant is invited to provide specific written support for the “limitations” indicated above or rely upon the limitations set forth in the specification as filed. Double Patenting The nonstatutory double patenting rejection is based on a judicially created doctrine grounded in public policy (a policy reflected in the statute) so as to prevent the unjustified or improper timewise extension of the “right to exclude” granted by a patent and to prevent possible harassment by multiple assignees. A nonstatutory double patenting rejection is appropriate where the conflicting claims are not identical, but at least one examined application claim is not patentably distinct from the reference claim(s) because the examined application claim is either anticipated by, or would have been obvious over, the reference claim(s). See, e.g., In re Berg, 140 F.3d 1428, 46 USPQ2d 1226 (Fed. Cir. 1998); In re Goodman, 11 F.3d 1046, 29 USPQ2d 2010 (Fed. Cir. 1993); In re Longi, 759 F.2d 887, 225 USPQ 645 (Fed. Cir. 1985); In re Van Ornum, 686 F.2d 937, 214 USPQ 761 (CCPA 1982); In re Vogel, 422 F.2d 438, 164 USPQ 619 (CCPA 1970); In re Thorington, 418 F.2d 528, 163 USPQ 644 (CCPA 1969). A timely filed terminal disclaimer in compliance with 37 CFR 1.321(c) or 1.321(d) may be used to overcome an actual or provisional rejection based on nonstatutory double patenting provided the reference application or patent either is shown to be commonly owned with the examined application, or claims an invention made as a result of activities undertaken within the scope of a joint research agreement. See MPEP § 717.02 for applications subject to examination under the first inventor to file provisions of the AIA as explained in MPEP § 2159. See MPEP § 2146 et seq. for applications not subject to examination under the first inventor to file provisions of the AIA . A terminal disclaimer must be signed in compliance with 37 CFR 1.321(b). The filing of a terminal disclaimer by itself is not a complete reply to a nonstatutory double patenting (NSDP) rejection. A complete reply requires that the terminal disclaimer be accompanied by a reply requesting reconsideration of the prior Office action. Even where the NSDP rejection is provisional the reply must be complete. See MPEP § 804, subsection I.B.1. For a reply to a non-final Office action, see 37 CFR 1.111(a). For a reply to final Office action, see 37 CFR 1.113(c). A request for reconsideration while not provided for in 37 CFR 1.113(c) may be filed after final for consideration. See MPEP §§ 706.07(e) and 714.13. The USPTO Internet website contains terminal disclaimer forms which may be used. Please visit www.uspto.gov/patent/patents-forms. The actual filing date of the application in which the form is filed determines what form (e.g., PTO/SB/25, PTO/SB/26, PTO/AIA /25, or PTO/AIA /26) should be used. A web-based eTerminal Disclaimer may be filled out completely online using web-screens. An eTerminal Disclaimer that meets all requirements is auto-processed and approved immediately upon submission. For more information about eTerminal Disclaimers, refer to www.uspto.gov/patents/apply/applying-online/eterminal-disclaimer. Claims 1, 22-26 are provisionally rejected on the ground of nonstatutory double patenting as being unpatentable over claims 1, 12, 13 and 18 of copending Application No. 17/640,291 (reference application). The instant claims are drawn to a therapeutic fusion protein comprising an amino acid sequence having at least 90% identity to SEQ D NO:73. The claims are further drawn to wherein the therapeutic fusion comprises a C1 discoidin sub-domain having at least 95% identical to an amino acid sequence set forth in SEQ ID NO:3, wherein the therapeutic fusion protein comprises a human serum albumin (HSA) domain having an amino acid sequence at least 95% identical to an amino acid sequence set forth in SEQ ID NO: 5 or 6 or wherein the therapeutic fusion protein comprises an EGF-like domain of milk fat globule epidermal growth factor 8 protein (MFG-E8) having at least 95% identity to an amino acid sequence set forth in SEQ ID NO: 2. The claims are further drawn to wherein the therapeutic fusion protein comprises an MFG-E8 EGF-like domain having an amino acid sequence at least 95% identical to SEQ ID NO: 2; an HSA domain having an amino acid sequence at least 95% identical to SEQ ID NO: 5; and C1 a discoidin sub-domain having at least 95% identical to an amino acid sequence set forth in SEQ ID NO: 3. The claims are further drawn to a therapeutic fusion protein comprising the amino acid sequence set forth in SEQ ID NO. 73. The claims of copending Application No. 17/640,291 teach a therapeutic fusion protein wherein the fusion protein has an amino acid sequence of SEQ ID NO: 42, or at least 90% sequence identity thereto. A therapeutic fusion protein wherein the fusion protein has an amino acid sequence of SEQ ID NO: 44, or at least 90% sequence identity thereto; or SEQ NO: 46, or at least 90% sequence identity thereto. A therapeutic fusion protein wherein the fusion protein has an amino acid sequence of SEQ ID NO: 80, or at least 90% sequence identity thereto. The claims of copending Application No. 17/640,291 further teach a pharmaceutical composition comprising said therapeutic fusion protein. Although the claims at issue are not identical, they are not patentably distinct from each other. The claims of copending Application No. 17/640,291 teach a therapeutic fusion protein (SEQ ID NO:48) that is 100% identical to instant SEQ ID NO:73. See below, Sequence Search Result B, result number 2 (applies to claims 1 and 26). The claims of copending Application No. 17/640,291 teach a therapeutic fusion protein (SEQ ID NO:46) that is 99.7% identical to instant SEQ ID NO:73. See below, Sequence Search Result B, result number 5 (applies to claim 1). The claims of copending Application No. 17/640,291 teach a therapeutic fusion protein (SEQ ID NO:42) that is 99.3% identical to instant SEQ ID NO:73. See below, Sequence Search Result B, result number 11 (applies to claim 1). The claims of copending Application No. 17/640,291 teach a therapeutic fusion protein (SEQ ID NO:44) that is 99.3% identical to instant SEQ ID NO:73. See below, Sequence Search Result B, result number 13 (applies to claim 1). The claims of copending Application No. 17/640,291 teach a therapeutic fusion protein (SEQ ID NO:80) that is 96.3% identical to instant SEQ ID NO:73. See below, Sequence Search Result B, result number 13 (applies to claim 1). The species of therapeutic fusion proteins taught in the claims of copending Application No. 17/640,291 anticipates the genus fusion protein (i.e. therapeutic protein having at least 90% identity to SEQ ID NO:73), recited in the instant claims. Because, claims 22-25 depend from claim 1, the Examiner assumes the therapeutic protein comprising at least 90% identity to SEQ ID NO:73, as recited in claim 1, will have the amino acid sequences of the domains as recited in claims 22-25. This is a provisional nonstatutory double patenting rejection because the patentably indistinct claims have not in fact been patented. Conclusion No claims are allowed. Applicant's amendment necessitated the new ground(s) of rejection presented in this Office action. Accordingly, THIS ACTION IS MADE FINAL. See MPEP § 706.07(a). Applicant is reminded of the extension of time policy as set forth in 37 CFR 1.136(a). A shortened statutory period for reply to this final action is set to expire THREE MONTHS from the mailing date of this action. In the event a first reply is filed within TWO MONTHS of the mailing date of this final action and the advisory action is not mailed until after the end of the THREE-MONTH shortened statutory period, then the shortened statutory period will expire on the date the advisory action is mailed, and any nonprovisional extension fee (37 CFR 1.17(a)) pursuant to 37 CFR 1.136(a) will be calculated from the mailing date of the advisory action. In no event, however, will the statutory period for reply expire later than SIX MONTHS from the mailing date of this final action. Any inquiry concerning this communication or earlier communications from the examiner should be directed to REGINA M DEBERRY whose telephone number is (571)272-0882. The examiner can normally be reached M-F 9:00-6:30 pm (alt Fri). Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Joanne Hama can be reached at 571-272-2911. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /R.M.D/Examiner,ArtUnit1647 1/26/2026 /BRIDGET E BUNNER/Primary Examiner, Art Unit 1647 SEQUENCE SEARCH RESULT A This page gives you Search Results detail for the Application 17640293 and Search Result 20260123-17640293-73align.rapn Title: US-17-640-293-73 Perfect score: 4196 Sequence: 1 LDICSKNPCHNGGLCEEISQ..........TSCHTACTLRFELLGCELNG 783 :* SUMMARIES % Result Query No. Score Match Length DB ID Description ---------------------------------------------------------------------------- 1 3063 73.0 583 1 US-17-640-293-5 Sequence 5, US 2 1019.5 24.3 206 1 US-17-640-293-6 Sequence 6, US 3 862 20.5 318 1 US-17-640-293-3 Sequence 3, US 4 268 6.4 46 1 US-17-640-293-2 Sequence 2, US ALIGNMENTS RESULT 1 US-17-640-293-5 ; Sequence 5, US/17640293 ; GENERAL INFORMATION ; APPLICANT: NOVARTIS AG ; TITLE OF INVENTION: THERAPEUTIC FUSION PROTEINS ; FILE REFERENCE: PAT058332 ; CURRENT APPLICATION NUMBER: US/17/640,293 ; CURRENT FILING DATE: 2022-03-03 ; PRIOR APPLICATION NUMBER: EP 19196045.9 ; PRIOR FILING DATE: 2019-09-06 ; NUMBER OF SEQ ID NOS: 148 ; SEQ ID NO 5 ; LENGTH: 583 ; TYPE: PRT ; ORGANISM: Artificial Sequence ; FEATURE: ; NAME/KEY: source ; OTHER INFORMATION: /note="Description of Artificial Sequence: Synthetic ; polypeptide" US-17-640-293-5 Query Match 73.0%; Score 3063; DB 1; Length 583; Best Local Similarity 100.0%; Matches 577; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 47 DAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQSPFEDHVKLVNEVTEFAKTCVADESAE 106 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 DAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQSPFEDHVKLVNEVTEFAKTCVADESAE 60 Qy 107 NCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNECFLQHKDDNPNLPRLVRPEV 166 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 NCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNECFLQHKDDNPNLPRLVRPEV 120 Qy 167 DVMCTAFHDNEETFLKKYLYEIARRHPYFYAPELLFFAKRYKAAFTECCQAADKAACLLP 226 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 DVMCTAFHDNEETFLKKYLYEIARRHPYFYAPELLFFAKRYKAAFTECCQAADKAACLLP 180 Qy 227 KLDELRDEGKASSAKQRLKCASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTK 286 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 KLDELRDEGKASSAKQRLKCASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTK 240 Qy 287 VHTECCHGDLLECADDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPA 346 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 VHTECCHGDLLECADDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPA 300 Qy 347 DLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLAKTYETTLEKC 406 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 DLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLAKTYETTLEKC 360 Qy 407 CAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFEQLGEYKFQNALLVRYTKKVPQVST 466 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 CAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFEQLGEYKFQNALLVRYTKKVPQVST 420 Qy 467 PTLVEVSRNLGKVGSKCCKHPEAKRMPCAEDYLSVVLNQLCVLHEKTPVSDRVTKCCTES 526 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 421 PTLVEVSRNLGKVGSKCCKHPEAKRMPCAEDYLSVVLNQLCVLHEKTPVSDRVTKCCTES 480 Qy 527 LVNRRPCFSALEVDETYVPKEFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPKAT 586 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 481 LVNRRPCFSALEVDETYVPKEFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPKAT 540 Qy 587 KEQLKAVMDDFAAFVEKCCKADDKETCFAEEGKKLVA 623 ||||||||||||||||||||||||||||||||||||| Db 541 KEQLKAVMDDFAAFVEKCCKADDKETCFAEEGKKLVA 577 RESULT 2 US-17-640-293-6 ; Sequence 6, US/17640293 ; GENERAL INFORMATION ; APPLICANT: NOVARTIS AG ; TITLE OF INVENTION: THERAPEUTIC FUSION PROTEINS ; FILE REFERENCE: PAT058332 ; CURRENT APPLICATION NUMBER: US/17/640,293 ; CURRENT FILING DATE: 2022-03-03 ; PRIOR APPLICATION NUMBER: EP 19196045.9 ; PRIOR FILING DATE: 2019-09-06 ; NUMBER OF SEQ ID NOS: 148 ; SEQ ID NO 6 ; LENGTH: 206 ; TYPE: PRT ; ORGANISM: Artificial Sequence ; FEATURE: ; NAME/KEY: source ; OTHER INFORMATION: /note="Description of Artificial Sequence: Synthetic ; polypeptide" US-17-640-293-6 Query Match 24.3%; Score 1019.5; DB 1; Length 206; Best Local Similarity 95.6%; Matches 197; Conservative 2; Mismatches 6; Indels 1; Gaps 1; Qy 426 LVEEPQNLIKQNCELFEQLGEYKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCK 485 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 LVEEPQNLIKQNCELFEQLGEYKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCK 60 Qy 486 HPEAKRMPCAEDYLSVVLNQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSALEVDETYVP 545 |||||||||||| ||| ||||||||||||||||||||||||||| ||||||||||||||| Db 61 HPEAKRMPCAEDCLSVFLNQLCVLHEKTPVSDRVTKCCTESLVNGRPCFSALEVDETYVP 120 Qy 546 KEFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDDFAAFVEKCC 605 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 KEFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDDFAAFVEKCC 180 Qy 606 KADDKETCFAEEGKKLVACVE-PLGM 630 |||||||||||||||||| : ||: Db 181 KADDKETCFAEEGKKLVAASQAALGL 206 RESULT 3 US-17-640-293-3 ; Sequence 3, US/17640293 ; GENERAL INFORMATION ; APPLICANT: NOVARTIS AG ; TITLE OF INVENTION: THERAPEUTIC FUSION PROTEINS ; FILE REFERENCE: PAT058332 ; CURRENT APPLICATION NUMBER: US/17/640,293 ; CURRENT FILING DATE: 2022-03-03 ; PRIOR APPLICATION NUMBER: EP 19196045.9 ; PRIOR FILING DATE: 2019-09-06 ; NUMBER OF SEQ ID NOS: 148 ; SEQ ID NO 3 ; LENGTH: 318 ; TYPE: PRT ; ORGANISM: Homo sapiens US-17-640-293-3 Query Match 20.5%; Score 862; DB 1; Length 318; Best Local Similarity 99.4%; Matches 159; Conservative 1; Mismatches 0; Indels 0; Gaps 0; Qy 624 CVEPLGMENGNIANSQIAASSVRVTFLGLQHWVPELARLNRAGMVNAWTPSSNDDNPWIQ 683 ||||||:||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 CVEPLGLENGNIANSQIAASSVRVTFLGLQHWVPELARLNRAGMVNAWTPSSNDDNPWIQ 60 Qy 684 VNLLRRMWVTGVVTQGASRLASHEYLKAFKVAYSLNGHEFDFIHDVNKKHKEFVGNWNKN 743 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 VNLLRRMWVTGVVTQGASRLASHEYLKAFKVAYSLNGHEFDFIHDVNKKHKEFVGNWNKN 120 Qy 744 AVHVNLFETPVEAQYVRLYPTSCHTACTLRFELLGCELNG 783 |||||||||||||||||||||||||||||||||||||||| Db 121 AVHVNLFETPVEAQYVRLYPTSCHTACTLRFELLGCELNG 160 RESULT 4 US-17-640-293-2 ; Sequence 2, US/17640293 ; GENERAL INFORMATION ; APPLICANT: NOVARTIS AG ; TITLE OF INVENTION: THERAPEUTIC FUSION PROTEINS ; FILE REFERENCE: PAT058332 ; CURRENT APPLICATION NUMBER: US/17/640,293 ; CURRENT FILING DATE: 2022-03-03 ; PRIOR APPLICATION NUMBER: EP 19196045.9 ; PRIOR FILING DATE: 2019-09-06 ; NUMBER OF SEQ ID NOS: 148 ; SEQ ID NO 2 ; LENGTH: 46 ; TYPE: PRT ; ORGANISM: Homo sapiens US-17-640-293-2 Query Match 6.4%; Score 268; DB 1; Length 46; Best Local Similarity 100.0%; Matches 46; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 LDICSKNPCHNGGLCEEISQEVRGDVFPSYTCTCLKGYAGNHCETK 46 |||||||||||||||||||||||||||||||||||||||||||||| Db 1 LDICSKNPCHNGGLCEEISQEVRGDVFPSYTCTCLKGYAGNHCETK 46 SEQUENCE SEARCH RESULT B This page gives you Search Results detail for the Application 17640293 and Search Result 20251203_125425_us-17-640-293-73.minpct.rapm Title: US-17-640-293-73 Perfect score: 4196 Sequence: 1 LDICSKNPCHNGGLCEEISQ..........TSCHTACTLRFELLGCELNG 783 Scoring table: BLOSUM62 Gapop 10.0 , Gapext 0.5 Searched: 24371443 unique seqs, 2857659427 residues Total number of hits satisfying chosen parameters: 24 Minimum DB seq length: 0 Maximum DB seq length: 2000000000 Post-processing: Minimum Match 88% Maximum Match 100% Listing first 1000 summaries Database : Pending_Patents_AA_Main:* SUMMARIES % Result Query Filing No. Score Match Length ID Date Dups Description ------------------------------------------------------------------------------ 2 4196 100.0 941 US-17-640-291-48 2022-03-03 2 THERAPEUTIC FUSION PROTEINS 5 4183 99.7 947 US-17-640-291-46 2022-03-03 2 THERAPEUTIC FUSION PROTEINS 11 4165 99.3 963 US-17-640-291-42 2022-03-03 2 THERAPEUTIC FUSION PROTEINS 13 4165 99.3 971 US-17-640-291-44 2022-03-03 2 THERAPEUTIC FUSION PROTEINS 19 4041.5 96.3 1029 US-17-640-291-80 2022-03-03 2 THERAPEUTIC FUSION PROTEINS RESULT 2 RESULT 2 US-17-640-291-48 Sequence 48, US/17640291 GENERAL INFORMATION APPLICANT: NOVARTIS AG TITLE OF INVENTION: THERAPEUTIC FUSION PROTEINS FILE REFERENCE: PAT058332 CURRENT APPLICATION NUMBER: US/17/640,291 CURRENT FILING DATE: 2022-03-03 PRIOR APPLICATION NUMBER: EP 19196045.9 PRIOR FILING DATE: 2019-09-06 NUMBER OF SEQ ID NOS: 148 SEQ ID NO 48 LENGTH: 941 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: NAME/KEY: source OTHER INFORMATION: /note="Description of Artificial Sequence: Synthetic polypeptide" Query Match 100.0%; Score 4196; Length 941; Best Local Similarity 100.0%; Matches 783; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 LDICSKNPCHNGGLCEEISQEVRGDVFPSYTCTCLKGYAGNHCETKDAHKSEVAHRFKDL 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 LDICSKNPCHNGGLCEEISQEVRGDVFPSYTCTCLKGYAGNHCETKDAHKSEVAHRFKDL 60 Qy 61 GEENFKALVLIAFAQYLQQSPFEDHVKLVNEVTEFAKTCVADESAENCDKSLHTLFGDKL 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 GEENFKALVLIAFAQYLQQSPFEDHVKLVNEVTEFAKTCVADESAENCDKSLHTLFGDKL 120 Qy 121 CTVATLRETYGEMADCCAKQEPERNECFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETF 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 CTVATLRETYGEMADCCAKQEPERNECFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETF 180 Qy 181 LKKYLYEIARRHPYFYAPELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSA 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 LKKYLYEIARRHPYFYAPELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSA 240 Qy 241 KQRLKCASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDLLECA 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 KQRLKCASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDLLECA 300 Qy 301 DDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPADLPSLAADFVESKD 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 DDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPADLPSLAADFVESKD 360 Qy 361 VCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLAKTYETTLEKCCAAADPHECYAKVF 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 VCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLAKTYETTLEKCCAAADPHECYAKVF 420 Qy 421 DEFKPLVEEPQNLIKQNCELFEQLGEYKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVG 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 421 DEFKPLVEEPQNLIKQNCELFEQLGEYKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVG 480 Qy 481 SKCCKHPEAKRMPCAEDYLSVVLNQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSALEVD 540 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 481 SKCCKHPEAKRMPCAEDYLSVVLNQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSALEVD 540 Qy 541 ETYVPKEFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDDFAAF 600 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 541 ETYVPKEFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDDFAAF 600 Qy 601 VEKCCKADDKETCFAEEGKKLVACVEPLGMENGNIANSQIAASSVRVTFLGLQHWVPELA 660 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 601 VEKCCKADDKETCFAEEGKKLVACVEPLGMENGNIANSQIAASSVRVTFLGLQHWVPELA 660 Qy 661 RLNRAGMVNAWTPSSNDDNPWIQVNLLRRMWVTGVVTQGASRLASHEYLKAFKVAYSLNG 720 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 661 RLNRAGMVNAWTPSSNDDNPWIQVNLLRRMWVTGVVTQGASRLASHEYLKAFKVAYSLNG 720 Qy 721 HEFDFIHDVNKKHKEFVGNWNKNAVHVNLFETPVEAQYVRLYPTSCHTACTLRFELLGCE 780 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 721 HEFDFIHDVNKKHKEFVGNWNKNAVHVNLFETPVEAQYVRLYPTSCHTACTLRFELLGCE 780 Qy 781 LNG 783 ||| Db 781 LNG 783 RESULT 5 US-17-640-291-46 Sequence 46, US/17640291 GENERAL INFORMATION APPLICANT: NOVARTIS AG TITLE OF INVENTION: THERAPEUTIC FUSION PROTEINS FILE REFERENCE: PAT058332 CURRENT APPLICATION NUMBER: US/17/640,291 CURRENT FILING DATE: 2022-03-03 PRIOR APPLICATION NUMBER: EP 19196045.9 PRIOR FILING DATE: 2019-09-06 NUMBER OF SEQ ID NOS: 148 SEQ ID NO 46 LENGTH: 947 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: NAME/KEY: source OTHER INFORMATION: /note="Description of Artificial Sequence: Synthetic polypeptide" Query Match 99.7%; Score 4183; Length 947; Best Local Similarity 99.2%; Matches 783; Conservative 0; Mismatches 0; Indels 6; Gaps 1; Qy 1 LDICSKNPCHNGGLCEEISQEVRGDVFPSYTCTCLKGYAGNHCETKDAHKSEVAHRFKDL 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 LDICSKNPCHNGGLCEEISQEVRGDVFPSYTCTCLKGYAGNHCETKDAHKSEVAHRFKDL 60 Qy 61 GEENFKALVLIAFAQYLQQSPFEDHVKLVNEVTEFAKTCVADESAENCDKSLHTLFGDKL 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 GEENFKALVLIAFAQYLQQSPFEDHVKLVNEVTEFAKTCVADESAENCDKSLHTLFGDKL 120 Qy 121 CTVATLRETYGEMADCCAKQEPERNECFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETF 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 CTVATLRETYGEMADCCAKQEPERNECFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETF 180 Qy 181 LKKYLYEIARRHPYFYAPELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSA 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 LKKYLYEIARRHPYFYAPELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSA 240 Qy 241 KQRLKCASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDLLECA 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 KQRLKCASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDLLECA 300 Qy 301 DDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPADLPSLAADFVESKD 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 DDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPADLPSLAADFVESKD 360 Qy 361 VCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLAKTYETTLEKCCAAADPHECYAKVF 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 VCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLAKTYETTLEKCCAAADPHECYAKVF 420 Qy 421 DEFKPLVEEPQNLIKQNCELFEQLGEYKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVG 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 421 DEFKPLVEEPQNLIKQNCELFEQLGEYKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVG 480 Qy 481 SKCCKHPEAKRMPCAEDYLSVVLNQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSALEVD 540 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 481 SKCCKHPEAKRMPCAEDYLSVVLNQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSALEVD 540 Qy 541 ETYVPKEFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDDFAAF 600 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 541 ETYVPKEFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDDFAAF 600 Qy 601 VEKCCKADDKETCFAEEGKKLVA------CVEPLGMENGNIANSQIAASSVRVTFLGLQH 654 ||||||||||||||||||||||| ||||||||||||||||||||||||||||||| Db 601 VEKCCKADDKETCFAEEGKKLVAASQAALCVEPLGMENGNIANSQIAASSVRVTFLGLQH 660 Qy 655 WVPELARLNRAGMVNAWTPSSNDDNPWIQVNLLRRMWVTGVVTQGASRLASHEYLKAFKV 714 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 661 WVPELARLNRAGMVNAWTPSSNDDNPWIQVNLLRRMWVTGVVTQGASRLASHEYLKAFKV 720 Qy 715 AYSLNGHEFDFIHDVNKKHKEFVGNWNKNAVHVNLFETPVEAQYVRLYPTSCHTACTLRF 774 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 721 AYSLNGHEFDFIHDVNKKHKEFVGNWNKNAVHVNLFETPVEAQYVRLYPTSCHTACTLRF 780 Qy 775 ELLGCELNG 783 ||||||||| Db 781 ELLGCELNG 789 RESULT 11 US-17-640-291-42 Sequence 42, US/17640291 GENERAL INFORMATION APPLICANT: NOVARTIS AG TITLE OF INVENTION: THERAPEUTIC FUSION PROTEINS FILE REFERENCE: PAT058332 CURRENT APPLICATION NUMBER: US/17/640,291 CURRENT FILING DATE: 2022-03-03 PRIOR APPLICATION NUMBER: EP 19196045.9 PRIOR FILING DATE: 2019-09-06 NUMBER OF SEQ ID NOS: 148 SEQ ID NO 42 LENGTH: 963 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: NAME/KEY: source OTHER INFORMATION: /note="Description of Artificial Sequence: Synthetic polypeptide" Query Match 99.3%; Score 4165; Length 963; Best Local Similarity 97.3%; Matches 783; Conservative 0; Mismatches 0; Indels 22; Gaps 2; Qy 1 LDICSKNPCHNGGLCEEISQEVRGDVFPSYTCTCLKGYAGNHCETK--DAHKSEVAHRFK 58 |||||||||||||||||||||||||||||||||||||||||||||| |||||||||||| Db 1 LDICSKNPCHNGGLCEEISQEVRGDVFPSYTCTCLKGYAGNHCETKGSDAHKSEVAHRFK 60 Qy 59 DLGEENFKALVLIAFAQYLQQSPFEDHVKLVNEVTEFAKTCVADESAENCDKSLHTLFGD 118 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 DLGEENFKALVLIAFAQYLQQSPFEDHVKLVNEVTEFAKTCVADESAENCDKSLHTLFGD 120 Qy 119 KLCTVATLRETYGEMADCCAKQEPERNECFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEE 178 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 KLCTVATLRETYGEMADCCAKQEPERNECFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEE 180 Qy 179 TFLKKYLYEIARRHPYFYAPELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKAS 238 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 TFLKKYLYEIARRHPYFYAPELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKAS 240 Qy 239 SAKQRLKCASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDLLE 298 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 SAKQRLKCASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDLLE 300 Qy 299 CADDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPADLPSLAADFVES 358 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 CADDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPADLPSLAADFVES 360 Qy 359 KDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLAKTYETTLEKCCAAADPHECYAK 418 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 KDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLAKTYETTLEKCCAAADPHECYAK 420 Qy 419 VFDEFKPLVEEPQNLIKQNCELFEQLGEYKFQNALLVRYTKKVPQVSTPTLVEVSRNLGK 478 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 421 VFDEFKPLVEEPQNLIKQNCELFEQLGEYKFQNALLVRYTKKVPQVSTPTLVEVSRNLGK 480 Qy 479 VGSKCCKHPEAKRMPCAEDYLSVVLNQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSALE 538 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 481 VGSKCCKHPEAKRMPCAEDYLSVVLNQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSALE 540 Qy 539 VDETYVPKEFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDDFA 598 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 541 VDETYVPKEFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDDFA 600 Qy 599 AFVEKCCKADDKETCFAEEGKKLVA--------------------CVEPLGMENGNIANS 638 ||||||||||||||||||||||||| ||||||||||||||| Db 601 AFVEKCCKADDKETCFAEEGKKLVAASQAALGLGGSGGSGGSGGSCVEPLGMENGNIANS 660 Qy 639 QIAASSVRVTFLGLQHWVPELARLNRAGMVNAWTPSSNDDNPWIQVNLLRRMWVTGVVTQ 698 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 661 QIAASSVRVTFLGLQHWVPELARLNRAGMVNAWTPSSNDDNPWIQVNLLRRMWVTGVVTQ 720 Qy 699 GASRLASHEYLKAFKVAYSLNGHEFDFIHDVNKKHKEFVGNWNKNAVHVNLFETPVEAQY 758 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 721 GASRLASHEYLKAFKVAYSLNGHEFDFIHDVNKKHKEFVGNWNKNAVHVNLFETPVEAQY 780 Qy 759 VRLYPTSCHTACTLRFELLGCELNG 783 ||||||||||||||||||||||||| Db 781 VRLYPTSCHTACTLRFELLGCELNG 805 RESULT 13 US-17-640-291-44 Sequence 44, US/17640291 GENERAL INFORMATION APPLICANT: NOVARTIS AG TITLE OF INVENTION: THERAPEUTIC FUSION PROTEINS FILE REFERENCE: PAT058332 CURRENT APPLICATION NUMBER: US/17/640,291 CURRENT FILING DATE: 2022-03-03 PRIOR APPLICATION NUMBER: EP 19196045.9 PRIOR FILING DATE: 2019-09-06 NUMBER OF SEQ ID NOS: 148 SEQ ID NO 44 LENGTH: 971 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: NAME/KEY: source OTHER INFORMATION: /note="Description of Artificial Sequence: Synthetic polypeptide" Query Match 99.3%; Score 4165; Length 971; Best Local Similarity 97.3%; Matches 783; Conservative 0; Mismatches 0; Indels 22; Gaps 2; Qy 1 LDICSKNPCHNGGLCEEISQEVRGDVFPSYTCTCLKGYAGNHCETK--DAHKSEVAHRFK 58 |||||||||||||||||||||||||||||||||||||||||||||| |||||||||||| Db 1 LDICSKNPCHNGGLCEEISQEVRGDVFPSYTCTCLKGYAGNHCETKGSDAHKSEVAHRFK 60 Qy 59 DLGEENFKALVLIAFAQYLQQSPFEDHVKLVNEVTEFAKTCVADESAENCDKSLHTLFGD 118 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 DLGEENFKALVLIAFAQYLQQSPFEDHVKLVNEVTEFAKTCVADESAENCDKSLHTLFGD 120 Qy 119 KLCTVATLRETYGEMADCCAKQEPERNECFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEE 178 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 KLCTVATLRETYGEMADCCAKQEPERNECFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEE 180 Qy 179 TFLKKYLYEIARRHPYFYAPELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKAS 238 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 TFLKKYLYEIARRHPYFYAPELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKAS 240 Qy 239 SAKQRLKCASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDLLE 298 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 SAKQRLKCASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDLLE 300 Qy 299 CADDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPADLPSLAADFVES 358 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 CADDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPADLPSLAADFVES 360 Qy 359 KDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLAKTYETTLEKCCAAADPHECYAK 418 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 KDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLAKTYETTLEKCCAAADPHECYAK 420 Qy 419 VFDEFKPLVEEPQNLIKQNCELFEQLGEYKFQNALLVRYTKKVPQVSTPTLVEVSRNLGK 478 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 421 VFDEFKPLVEEPQNLIKQNCELFEQLGEYKFQNALLVRYTKKVPQVSTPTLVEVSRNLGK 480 Qy 479 VGSKCCKHPEAKRMPCAEDYLSVVLNQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSALE 538 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 481 VGSKCCKHPEAKRMPCAEDYLSVVLNQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSALE 540 Qy 539 VDETYVPKEFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDDFA 598 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 541 VDETYVPKEFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDDFA 600 Qy 599 AFVEKCCKADDKETCFAEEGKKLVA--------------------CVEPLGMENGNIANS 638 ||||||||||||||||||||||||| ||||||||||||||| Db 601 AFVEKCCKADDKETCFAEEGKKLVAASQAALGLGGSGGSGGSGGSCVEPLGMENGNIANS 660 Qy 639 QIAASSVRVTFLGLQHWVPELARLNRAGMVNAWTPSSNDDNPWIQVNLLRRMWVTGVVTQ 698 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 661 QIAASSVRVTFLGLQHWVPELARLNRAGMVNAWTPSSNDDNPWIQVNLLRRMWVTGVVTQ 720 Qy 699 GASRLASHEYLKAFKVAYSLNGHEFDFIHDVNKKHKEFVGNWNKNAVHVNLFETPVEAQY 758 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 721 GASRLASHEYLKAFKVAYSLNGHEFDFIHDVNKKHKEFVGNWNKNAVHVNLFETPVEAQY 780 Qy 759 VRLYPTSCHTACTLRFELLGCELNG 783 ||||||||||||||||||||||||| Db 781 VRLYPTSCHTACTLRFELLGCELNG 805 RESULT 19 US-17-640-291-80 Sequence 80, US/17640291 GENERAL INFORMATION APPLICANT: NOVARTIS AG TITLE OF INVENTION: THERAPEUTIC FUSION PROTEINS FILE REFERENCE: PAT058332 CURRENT APPLICATION NUMBER: US/17/640,291 CURRENT FILING DATE: 2022-03-03 PRIOR APPLICATION NUMBER: EP 19196045.9 PRIOR FILING DATE: 2019-09-06 NUMBER OF SEQ ID NOS: 148 SEQ ID NO 80 LENGTH: 1029 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: NAME/KEY: source OTHER INFORMATION: /note="Description of Artificial Sequence: Synthetic polypeptide" Query Match 96.3%; Score 4041.5; Length 1029; Best Local Similarity 93.0%; Matches 761; Conservative 5; Mismatches 13; Indels 39; Gaps 2; Qy 4 CSKNPCHNGGLCEEISQEVRGDVFPSYTCTCLKGYAGNH--------------------- 42 |: ||||||| | |||: ||| | | | | :|: | | Db 55 CTPNPCHNGGTC-EISEAYRGDTFIGYVCKCPRGFNGIHCQHNINECEVEPCKNGGICTD 113 Qy 43 -----------------CETKDAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQSPFEDH 85 |: |||||||||||||||||||||||||||||||||||||||| Db 114 LVANYSCECPGEFMGRNCQYKDAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQSPFEDH 173 Qy 86 VKLVNEVTEFAKTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERN 145 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 174 VKLVNEVTEFAKTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERN 233 Qy 146 ECFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFYAPELLFFAK 205 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 234 ECFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFYAPELLFFAK 293 Qy 206 RYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQRLKCASLQKFGERAFKAWAVARL 265 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 294 RYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQRLKCASLQKFGERAFKAWAVARL 353 Qy 266 SQRFPKAEFAEVSKLVTDLTKVHTECCHGDLLECADDRADLAKYICENQDSISSKLKECC 325 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 354 SQRFPKAEFAEVSKLVTDLTKVHTECCHGDLLECADDRADLAKYICENQDSISSKLKECC 413 Qy 326 EKPLLEKSHCIAEVENDEMPADLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHP 385 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 414 EKPLLEKSHCIAEVENDEMPADLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHP 473 Qy 386 DYSVVLLLRLAKTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFEQLG 445 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 474 DYSVVLLLRLAKTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFEQLG 533 Qy 446 EYKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRMPCAEDYLSVVLNQ 505 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 534 EYKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRMPCAEDYLSVVLNQ 593 Qy 506 LCVLHEKTPVSDRVTKCCTESLVNRRPCFSALEVDETYVPKEFNAETFTFHADICTLSEK 565 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 594 LCVLHEKTPVSDRVTKCCTESLVNRRPCFSALEVDETYVPKEFNAETFTFHADICTLSEK 653 Qy 566 ERQIKKQTALVELVKHKPKATKEQLKAVMDDFAAFVEKCCKADDKETCFAEEGKKLVACV 625 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 654 ERQIKKQTALVELVKHKPKATKEQLKAVMDDFAAFVEKCCKADDKETCFAEEGKKLVACV 713 Qy 626 EPLGMENGNIANSQIAASSVRVTFLGLQHWVPELARLNRAGMVNAWTPSSNDDNPWIQVN 685 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 714 EPLGMENGNIANSQIAASSVRVTFLGLQHWVPELARLNRAGMVNAWTPSSNDDNPWIQVN 773 Qy 686 LLRRMWVTGVVTQGASRLASHEYLKAFKVAYSLNGHEFDFIHDVNKKHKEFVGNWNKNAV 745 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 774 LLRRMWVTGVVTQGASRLASHEYLKAFKVAYSLNGHEFDFIHDVNKKHKEFVGNWNKNAV 833 Qy 746 HVNLFETPVEAQYVRLYPTSCHTACTLRFELLGCELNG 783 |||||||||||||||||||||||||||||||||||||| Db 834 HVNLFETPVEAQYVRLYPTSCHTACTLRFELLGCELNG 871
Read full office action

Prosecution Timeline

Mar 03, 2022
Application Filed
Aug 07, 2025
Non-Final Rejection — §112, §DP
Nov 11, 2025
Response Filed
Feb 04, 2026
Final Rejection — §112, §DP (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12600772
THERAPEUTIC AGENT FOR ASTHMA CONTAINING IL-6 INHIBITOR
2y 5m to grant Granted Apr 14, 2026
Patent 12600790
Variant Antibody That Binds Cd38
2y 5m to grant Granted Apr 14, 2026
Patent 12565524
METHODS FOR THE PRODUCTION OF CYTOPROTECTIVE ASIALO-ERYTHROPOIETIN IN PLANTS AND ITS PURIFICATION FROM PLANT TISSUES
2y 5m to grant Granted Mar 03, 2026
Patent 12509522
POLYPEPTIDES COMPRISING IMMUNOGLOBULIN SINGLE VARIABLE DOMAINS TARGETING IL-13 AND OX40L
2y 5m to grant Granted Dec 30, 2025
Patent 12502439
ACTIVATABLE ANTIBODIES THAT BIND EPIDERMAL GROWTH FACTOR RECEPTOR AND METHODS OF USE THEREOF
2y 5m to grant Granted Dec 23, 2025
Study what changed to get past this examiner. Based on 5 most recent grants.

AI Strategy Recommendation

Get an AI-powered prosecution strategy using examiner precedents, rejection analysis, and claim mapping.
Powered by AI — typically takes 5-10 seconds

Prosecution Projections

3-4
Expected OA Rounds
50%
Grant Probability
81%
With Interview (+31.3%)
3y 8m
Median Time to Grant
Moderate
PTA Risk
Based on 587 resolved cases by this examiner. Grant probability derived from career allow rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month