Prosecution Insights
Last updated: April 19, 2026
Application No. 17/642,974

Detergent Composition

Final Rejection §103§112
Filed
Mar 15, 2022
Examiner
ROBINSON, HOPE A
Art Unit
1652
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
Novozymes A/S
OA Round
2 (Final)
68%
Grant Probability
Favorable
3-4
OA Rounds
3y 5m
To Grant
99%
With Interview

Examiner Intelligence

Grants 68% — above average
68%
Career Allow Rate
700 granted / 1032 resolved
+7.8% vs TC avg
Strong +43% interview lift
Without
With
+43.0%
Interview Lift
resolved cases with interview
Typical timeline
3y 5m
Avg Prosecution
70 currently pending
Career history
1102
Total Applications
across all art units

Statute-Specific Performance

§101
5.2%
-34.8% vs TC avg
§103
20.1%
-19.9% vs TC avg
§102
17.7%
-22.3% vs TC avg
§112
47.0%
+7.0% vs TC avg
Black line = Tech Center average estimate • Based on career data from 1032 resolved cases

Office Action

§103 §112
DETAILED ACTION Notice of Pre-AIA or AIA Status 1. The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . 2. The Preliminary Amendments filed on March 15, 2022 and September 25, 2025, has been received and entered. 3. Applicant’s election with traverse of Group I on September 25, 2025, is acknowledged. Claim Disposition 4. Claims 1-15 have been cancelled. Claims 16-27 have been added and are pending. Claims 16-25 are under examination. Claims 26-27 are withdrawn from consideration as directed to a non-elected invention. Information Disclosure Statement 5. The Information Disclosure Statement filed on March 15, 2022, has been received and entered. The references cited on the PTO-1449 Form have been considered by the examiner and a copy is attached to the instant Office action. Abstract 6. The abstract is objected to for the following informalities: “The present invention relates to detergent compositions comprising alpha amylase mixtures. The compositions of the invention are suitable as [[e.g.]] cleaning or detergent compositions, [[such as]] for example, laundry detergent compositions and dish [[wash]] washing compositions, including automatic dish [[wash]] washing compositions”. Correction is required. Specification Objection 6. The specification is objected to for the following informalities: The specification is objected to because the priority information is missing from page 1. The specification is objected to because trademarks are disclosed and they are not capitalized. The use of the trademark such as TWEEN and SPAN, have been noted in this application (see page 37, for example). It should be capitalized wherever it appears and be accompanied by the generic terminology. Although the use of trademarks is permissible in patent applications, the proprietary nature of the marks should be respected and every effort made to prevent their use in any manner, which might adversely affect their validity as trademarks”. Appropriate correction is required. Claim objection 7. Claims 16-25 are objected to for the following informalities: For clarity and precision of claim language it is suggested that claim 16 is amended to recite “…comprising an amylase, [[and]] wherein said amylase is a mixture of at least two amylases, and wherein the amylase is…. a variant of a parent amylase, said variant amylase [[or parent amylase]] has at least [[60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%,]] at least 90% or at least 95%”…….. and [[optionally]] at least one mutation…184 [[(using]] of SEQ ID NO:3 [[for numbering)]]…”..The dependent claims hereto are also included. For clarity according it is suggested that claims 17-25 are amended to delete “according to” and instead recite “of” (i.e. “The composition of claim 16”). Appropriate correction is required. Claim Rejections - 35 USC § 112 The following is a quotation of the first paragraph of 35 U.S.C. 112(a): (a) IN GENERAL.—The specification shall contain a written description of the invention, and of the manner and process of making and using it, in such full, clear, concise, and exact terms as to enable any person skilled in the art to which it pertains, or with which it is most nearly connected, to make and use the same, and shall set forth the best mode contemplated by the inventor or joint inventor of carrying out the invention. The following is a quotation of the first paragraph of pre-AIA 35 U.S.C. 112: The specification shall contain a written description of the invention, and of the manner and process of making and using it, in such full, clear, concise, and exact terms as to enable any person skilled in the art to which it pertains, or with which it is most nearly connected, to make and use the same, and shall set forth the best mode contemplated by the inventor of carrying out his invention. 8. Claims 16-25 are rejected under 35 U.S.C. 112(a) or 35 U.S.C. 112 (pre-AlA), first paragraph, as failing to comply with the written description requirement. The claim(s) contains subject matter which was not described in the specification in such a way as to reasonably convey to one skilled in the relevant art that the inventor or a joint inventor, or for applications subject to pre-AIA 35 U.S.C. 112, the inventor(s), at the time the application was filed, had possession of the claimed invention. The claimed invention is directed to “a detergent composition comprising an amylase comprising a mixture of two amylases the encompasses a large variable genus of structures (fragments, derivatives, analogs etc., with the recitation of “at least 60% for instance, optional mutations as additives and one or more additional active components. The claimed invention also encompasses additional active components such as surfactants, bleach catalysis, glass care agents, metal care agents etc.; that are not adequately described. The claimed invention is not commensurate in scope with the disclosure and no correlation is made between structure and function (as a large variable genus of products with modifications are encompassed and not adequately described). The specification fails to provide a representative number of species for the claimed genus to show that applicant was in possession of the claimed genus. A representative number of species means that the species, which are adequately described, are representative of the entire genus. The written description requirement for a claimed genus may be satisfied through sufficient description of a representative number of species by actual reduction to practice, disclosure of drawings, or by disclosure of relevant identifying characteristics, for example, structure or other physical and/or chemical properties, by functional characteristics coupled with a known or disclosed correlation between function and structure, or by a combination of such identifying characteristics, sufficient to show the applicant was in possession of the claimed genus. Vas-Cath Inc. v. Mahurkar, 935 F.2d 1555, 1563-64, 19 USPQ2d 1111, 1117 (Fed. Cir. 1991), states that "applicant must convey with reasonable clarity to those skilled in the art that, as of the filing date sought, he or she was in possession of the invention. The invention is, for purposes of the ‘written description’ inquiry, whatever is now claimed" (See page 1117). The specification does not "clearly allow persons of ordinary skill in the art to recognize that [he or she] invented what is claimed" (See Vas-Cath at page 1116). The skilled artisan cannot envision the detailed chemical structure of the encompassed genus, and therefore, conception is not achieved until reduction to practice has occurred, regardless of the complexity or simplicity of the method of isolation. Adequate written description requires more than a mere statement that it is part of the invention and reference to a potential method of isolating it. The compound itself is required. See Fiers v. Revel, 25 USPQ2d 1601 at 1606 (CAFC 1993). Therefore, for all these reasons the specification lacks adequate written description, and one of skill in the art cannot reasonably conclude that the applicant had possession of the claimed invention at the time the instant application was filed. The following is a quotation of 35 U.S.C. 112(b): (b) CONCLUSION.—The specification shall conclude with one or more claims particularly pointing out and distinctly claiming the subject matter which the inventor or a joint inventor regards as the invention. The following is a quotation of 35 U.S.C. 112 (pre-AIA ), second paragraph: The specification shall conclude with one or more claims particularly pointing out and distinctly claiming the subject matter which the applicant regards as his invention. 9. Claims 16-25 are rejected under 35 U.S.C. 112(b) or 35 U.S.C. 112 (pre-AIA ), second paragraph, as being indefinite for failing to particularly point out and distinctly claim the subject matter which the inventor or a joint inventor (or for applications subject to pre-AIA 35 U.S.C. 112, the applicant), regards as the invention. Claim 16 and the dependent claims hereto are indefinite for the recitation of “a variant of a parent amylase, said variant amylase or parent amylase has at least 60%....sequence identity to SEQ ID NO:3….”. This language can be construed as having variant of the parent and the parent amylase as being identical since they both have the same fragments pertaining to SEQ ID NOs: 3 and 4 and the additional mutation is either optional or present in both. The claim is ambiguous as well because it can be construed as a focus on the variant of the parent amylase that has the modifications and mutations or the parent amylase having mutations/modifications. See the above suggestions to clarify the language. Claim 19 is indefinite for the recitation of “enzymes as additional components and lists amylases because independent claim 16 for which it depends already encompasses several amylases, so not an additional component. A Markush claim may be rejected under the judicially approved “improper Markush grouping” when the claim contains on improper grouping of alternatively claimed species in which: (1) the species do not share a “single structural similarity,”or (2) the species do not share a common use. MPEP 803.02 explains that a Markush grouping is proper when the embodiments of the invention share both a common use and a substantial structural feature essential to that use. See Ex parte Hozumi, 3USPQ2d 1059 (B.P.A.I. 1984). 10. Claims 16, 18 and 19 are rejected on the judicially-created basis that it contains an improper Markush grouping of alternatives. See In re Harnisch, 631 F. 2 d 716, 721-22 (CCPA 1980) and Exparte Hozumi, 3 USPQ2d 1059, 1060(Bd. Pat. App. & Int. 1984). The improper Markush grouping includes species of the claimed invention that do not share both a substantial structural feature and a common use that flows from the substantial structural feature. The members of the improper Markush grouping do not share a substantial feature and/or a common use that flows from the substantial structural feature for the following reasons. The sequences of claim 16 are different structurally, the active components of claim 18 are different (structurally and functionally) and the enzymes of claim 19 have different structures and activities). Claim Rejections - 35 USC § 103 The following is a quotation of 35 U.S.C. 103 which forms the basis for all obviousness rejections set forth in this Office action: A patent for a claimed invention may not be obtained, notwithstanding that the claimed invention is not identically disclosed as set forth in section 102, if the differences between the claimed invention and the prior art are such that the claimed invention as a whole would have been obvious before the effective filing date of the claimed invention to a person having ordinary skill in the art to which the claimed invention pertains. Patentability shall not be negated by the manner in which the invention was made. 11. This application currently names joint inventors. In considering patentability of the claims the examiner presumes that the subject matter of the various claims was commonly owned as of the effective filing date of the claimed invention(s) absent any evidence to the contrary. Applicant is advised of the obligation under 37 CFR 1.56 to point out the inventor and effective filing dates of each claim that was not commonly owned as of the effective filing date of the later invention in order for the examiner to consider the applicability of 35 U.S.C. 102(b)(2)(C) for any potential 35 U.S.C. 102(a)(2) prior art against the later invention. 12. Claim(s) 16-25 is/are rejected under 35 U.S.C. 103 as being unpatentable over r (WO 2016/000972, of record in the application) in view of Andersen et al. (US Patent No. 10428321). The primary reference teaches two amylases combined in a detergent composition, the second one (according to SEQ ID NO:2 of the cited document) having 100% identity to SEQ ID NO:1 of the present application, and variants thereof at positions 9, 26, 30, 33, 82, 37, 106, 1, 18, 128, 133, 149, 150, 160, 178, 182, 186, 193, 195, 202, 203, 214, 231, 256, 257, 258, 269, 270, 272, 283, 295, 296, 298, 299, 303, 304, 305, 311, 314, 315, 318, 319, 320, 323, 339, 345, 361, 378, 383, 419, 421, 437, 441, 444, 445, 446, 447, 450, 458, 461, 471, 482, and 484 and/or deletion at positions 183 and 184 (see for example, claim 3). Therefore, a detergent composition comprising two amylases with an amylase having at least 60% sequence identity to SEQ ID NO:1 (the parent amylase) of the application, and having a substitution at the positions corresponding to 9 in SEQ ID NO: 1. The primary reference is silent on the structure of SEQ ID NOs: 3 and 4, however, these structures and fragments thereof are known in the art. Andersen et al. is one such reference see the below alignment. Andersen et al. teaches amylase in a detergent, mixtures with amylases and other enzymes, surfactants and liquid/powder automatic dishwashing detergent (see the below excerpts). At paragraph [(25)] it is disclosed: “Detergent composition: The term “detergent composition” as used herein, refers to a composition suitable for use within the field of detergents, such as for use in laundry and dish wash. A detergent composition may be in the form of a liquid or powder form, and may be suitable for both handwash or automated wash. Thus, the term “detergent composition” includes otherwise indicated by context, granular or powder-form all-purpose or heavy-duty washing agents, especially the so-called heavy-duty liquid (HDL) types; liquid fine-fabric detergents; hand dishwashing agents or light duty dishwashing agents, especially those of the high-foaming type; machine dishwashing agents, including the various tablet, granular, liquid and rinse-aid types for household and institutional use; liquid cleaning and disinfecting agents, including antibacterial hand-wash types, cleaning bars, soap bars, mouthwashes, denture cleaners, car or carpet shampoos, bathroom cleaners; hair shampoos and hair-rinses; shower gels, foam baths; metal cleaners; as well as cleaning auxiliaries such as bleach additives and “stain-stick” or pre-treat types. The terms “detergent composition” and “detergent formulation” are used in reference to mixtures which are intended for use in a wash medium for the cleaning of soiled objects. In some embodiments, the term is used in reference to laundering fabrics and/or garments (e.g., “laundry detergents”). In alternative embodiments, the term refers to other detergents, such as those used to clean dishes, cutlery, etc. (e.g., “dishwashing detergents”). It is not intended that the present invention be limited to any particular detergent formulation or composition. The term “detergent composition” is not intended to be limited to compositions that contain surfactants. It is intended that in addition to the variants herein described, the detergents compositions may comprise, e.g., surfactants, builders, chelators or chelating agents, bleach system or bleach components, polymers, fabric conditioners, foam boosters, suds suppressors, dyes, perfume, tannish inhibitors, optical brighteners, bactericides, fungicides, soil suspending agents, anti corrosion agents, enzyme inhibitors or stabilizers, enzyme activators, transferase(s), hydrolytic enzymes, oxido reductases, bluing agents and fluorescent dyes, antioxidants, and/or solubilizers”. It is also disclosed at paragraph [(41)] that, ‘It is known in the art that a host cell may produce a mixture of two of more different mature polypeptides (i.e., with a different C-terminal and/or N-terminal amino acid) expressed by the same polynucleotide”. Further at paragraph [(365)] additional amylases are disclosed and paragraph [(366)] provides a list: “suitable amylases which may be used together with the enzyme preparation of the invention may be an alpha-amylase, a pullulanase or a glucoamylase and may be of bacterial or fungal origin. Chemically modified or protein engineered variants are included. Amylases include, for example, alpha-amylases obtained from Bacillus, e.g., a special strain of Bacillus licheniformis, described in more detail in GB 1,296,839. (367) Suitable amylases include amylases having SEQ ID NO: 2 in WO 95/10603 or variants having 90% sequence identity to SEQ ID NO: 3 thereof. Preferred variants are described in WO 94/02597, WO 94/18314, WO 97/43424 and SEQ ID NO: 4 of WO 99/019467, such as variants with substitutions in one or more of the following positions: 15, 23, 105, 106, 124, 128, 133, 154, 156, 178, 179, 181, 188, 190, 197, 201, 202, 207, 208, 209, 211, 243, 264, 304, 305, 391, 408, and 444. (368) Different suitable amylases include amylases having SEQ ID NO: 6 in WO 02/010355 or variants thereof having 90% sequence identity to SEQ ID NO: 6. Preferred variants of SEQ ID NO: 6 are those having a deletion in positions 181 and 182 and a substitution in position 193. (369) Other amylases which are suitable are hybrid alpha-amylase comprising residues 1-33 of the alpha-amylase derived from B. amyloliquefaciens shown in SEQ ID NO: 6 of WO 2006/066594 and residues 36-483 of the B. licheniformis alpha-amylase shown in SEQ ID NO: 4 of WO 2006/066594 or variants having 90% sequence identity thereof. Preferred variants of this hybrid alpha-amylase are those having a substitution, a deletion or an insertion in one of more of the following positions: G48, T49, G107, H156, A181, N190, M197, I201, A209 and Q264. Most preferred variants of the hybrid alpha-amylase comprising residues 1-33 of the alpha-amylase derived from B. amyloliquefaciens shown in SEQ ID NO: 6 of WO 2006/066594 and residues 36-483 of SEQ ID NO: 4 are those having the substitutions: M197T; H156Y+A181T+N190F+A209V+Q264S; or G48A+T49I+G107A+H156Y+A181T+N190F+I201F+A209V+Q264S. (370) Further amylases which are suitable are amylases having SEQ ID NO: 6 in WO 99/019467 or variants thereof having 90% sequence identity to SEQ ID NO: 6. Preferred variants of SEQ ID NO: 6 are those having a substitution, a deletion or an insertion in one or more of the following positions: R181, G182, H183, G184, N195, I206, E212, E216 and K269. Particularly preferred amylases are those having deletion in positions R181 and G182, or positions H183 and G184. (371) Additional amylases which may be used are those having SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 2 or SEQ ID NO: 7 of WO 96/023873 or variants thereof having 90% sequence identity to SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3 or SEQ ID NO: 7. Preferred variants of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3 or SEQ ID NO: 7 are those having a substitution, a deletion or an insertion in one or more of the following positions: 140, 181, 182, 183, 184, 195, 206, 212, 243, 260, 269, 304 and 476, using SEQ ID NO: 2 of WO 96/023873 for numbering. More preferred variants are those having a deletion in two positions selected from 181, 182, 183 and 184, such as 181 and 182, 182 and 183, or positions 183 and 184. Most preferred amylase variants of SEQ ID NO: 1, SEQ ID NO: 2 or SEQ ID NO: 7 are those having a deletion…..”. Therefore, it would have been obvious for one of ordinary skill in the art before the effective filing date of the claimed invention to arrive at the claimed invention as a whole because the combined teaching of the references renders the claims as obvious. The references are considered to be analogous art, thus motivation to combine exists. Moreover, the Supreme Court pointed out in KSR, “a patent composed of several elements is not proved obvious merely by demonstrating that each of its elements was, independently, known in the prior art.” KSR, 127 S. Ct. at 1741. The Court thus reasoned that the analysis under 35 U.S.C. 103 "need not seek out precise teachings directed to the specific subject matter of the challenged claim, for a court can take account of the “inferences and creative steps that a person of ordinary skill in the art would employ.” Id. at 1741. The Court further advised that “[a] person of ordinary skill is…a person of ordinary creativity, not an automation.” Id. at 1742. Therefore, the claimed invention was obvious to make and use at the time the invention was made and was prima facie obvious. Alignment RESULT 3 (SEQ ID NO:3) US-15-317-881C-40 Sequence 40, US/15317881C Patent No. 10428321 GENERAL INFORMATION APPLICANT: Novozymes A/S TITLE OF INVENTION: Alpha amylase variants FILE REFERENCE: 12706-WO-PCT CURRENT APPLICATION NUMBER: US/15/317,881C CURRENT FILING DATE: 2016-12-09 NUMBER OF SEQ ID NOS: 41 SEQ ID NO 40 LENGTH: 485 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: synthetic construct Query Match 99.7%; Score 2710; Length 485; Best Local Similarity 99.8%; Matches 484; Conservative 0; Mismatches 1; Indels 0; Gaps 0; Qy 1 HHDGTNGTIMQYFEWNVPNDGQHWNRLHNNAQNLKNAGITAIWIPPAWKGTSQNDVGYGA 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 HHDGTNGTIMQYFEWNVPNDGQHWNRLHNNAQNLKNAGITAIWIPPAWKGTSQNDVGYGA 60 Qy 61 YDLYDLGEFNQKGTVRTKYGTKAELERAIRSLKANGIQVYGDVVMNHKGGADFTERVQAV 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 YDLYDLGEFNQKGTVRTKYGTKAELERAIRSLKANGIQVYGDVVMNHKGGADFTERVQAV 120 Qy 121 EVNPQNRNQEVSGTYQIEAWTGFNFPGRGNQHSSFKWRWYHFDGTDWDQSRQLANRIYKF 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 EVNPQNRNQEVSGTYQIEAWTGFNFPGRGNQHSSFKWRWYHFDGTDWDQSRQLANRIYKF 180 Qy 181 RGDGKAWDWEVDTENGNYDYLMYADVDMDHPEVINELNRWGVWYANTLNLDGFRLDAVKH 240 || ||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 RGTGKAWDWEVDTENGNYDYLMYADVDMDHPEVINELNRWGVWYANTLNLDGFRLDAVKH 240 Qy 241 IKFSFMRDWLGHVRGQTGKNLFAVAEYWKNDLGALENYLSKTNWTMSAFDVPLHYNLYQA 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 IKFSFMRDWLGHVRGQTGKNLFAVAEYWKNDLGALENYLSKTNWTMSAFDVPLHYNLYQA 300 Qy 301 SNSSGNYDMRNLLNGTLVQRHPSHAVTFVDNHDTQPGEALESFVQGWFKPLAYATILTRE 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 SNSSGNYDMRNLLNGTLVQRHPSHAVTFVDNHDTQPGEALESFVQGWFKPLAYATILTRE 360 Qy 361 QGYPQVFYGDYYGIPSDGVPSYRQQIDPLLKARQQYAYGRQHDYFDHWDVIGWTREGNAS 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 QGYPQVFYGDYYGIPSDGVPSYRQQIDPLLKARQQYAYGRQHDYFDHWDVIGWTREGNAS 420 Qy 421 HPNSGLATIMSDGPGGSKWMYVGRQKAGEVWHDMTGNRSGTVTINQDGWGHFFVNGGSVS 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 421 HPNSGLATIMSDGPGGSKWMYVGRQKAGEVWHDMTGNRSGTVTINQDGWGHFFVNGGSVS 480 Qy 481 VWVKR 485 ||||| Db 481 VWVKR 485 ESULT 3(SEQ ID NO:4) US-15-317-881C-40 Sequence 40, US/15317881C Patent No. 10428321 GENERAL INFORMATION APPLICANT: Novozymes A/S TITLE OF INVENTION: Alpha amylase variants FILE REFERENCE: 12706-WO-PCT CURRENT APPLICATION NUMBER: US/15/317,881C CURRENT FILING DATE: 2016-12-09 NUMBER OF SEQ ID NOS: 41 SEQ ID NO 40 LENGTH: 485 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: synthetic construct Query Match 99.7%; Score 2710; Length 485; Best Local Similarity 99.8%; Matches 484; Conservative 0; Mismatches 1; Indels 0; Gaps 0; Qy 1 HHDGTNGTIMQYFEWNVPNDGQHWNRLHNNAQNLKNAGITAIWIPPAWKGTSQNDVGYGA 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 HHDGTNGTIMQYFEWNVPNDGQHWNRLHNNAQNLKNAGITAIWIPPAWKGTSQNDVGYGA 60 Qy 61 YDLYDLGEFNQKGTVRTKYGTKAELERAIRSLKANGIQVYGDVVMNHKGGADFTERVQAV 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 YDLYDLGEFNQKGTVRTKYGTKAELERAIRSLKANGIQVYGDVVMNHKGGADFTERVQAV 120 Qy 121 EVNPQNRNQEVSGTYQIEAWTGFNFPGRGNQHSSFKWRWYHFDGTDWDQSRQLANRIYKF 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 EVNPQNRNQEVSGTYQIEAWTGFNFPGRGNQHSSFKWRWYHFDGTDWDQSRQLANRIYKF 180 Qy 181 RGDGKAWDWEVDTENGNYDYLMYADVDMDHPEVINELNRWGVWYANTLNLDGFRLDAVKH 240 || ||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 RGTGKAWDWEVDTENGNYDYLMYADVDMDHPEVINELNRWGVWYANTLNLDGFRLDAVKH 240 Qy 241 IKFSFMRDWLGHVRGQTGKNLFAVAEYWKNDLGALENYLSKTNWTMSAFDVPLHYNLYQA 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 IKFSFMRDWLGHVRGQTGKNLFAVAEYWKNDLGALENYLSKTNWTMSAFDVPLHYNLYQA 300 Qy 301 SNSSGNYDMRNLLNGTLVQRHPSHAVTFVDNHDTQPGEALESFVQGWFKPLAYATILTRE 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 SNSSGNYDMRNLLNGTLVQRHPSHAVTFVDNHDTQPGEALESFVQGWFKPLAYATILTRE 360 Qy 361 QGYPQVFYGDYYGIPSDGVPSYRQQIDPLLKARQQYAYGRQHDYFDHWDVIGWTREGNAS 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 QGYPQVFYGDYYGIPSDGVPSYRQQIDPLLKARQQYAYGRQHDYFDHWDVIGWTREGNAS 420 Qy 421 HPNSGLATIMSDGPGGSKWMYVGRQKAGEVWHDMTGNRSGTVTINQDGWGHFFVNGGSVS 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 421 HPNSGLATIMSDGPGGSKWMYVGRQKAGEVWHDMTGNRSGTVTINQDGWGHFFVNGGSVS 480 Qy 481 VWVKR 485 ||||| Db 481 VWVKR 485 Conclusion 13. No claims are presently allowable. Any inquiry concerning this communication or earlier communications from the examiner should be directed to HOPE A ROBINSON whose telephone number is (571) 272-0957. The examiner can normally be reached 9-5pm on Monday to Friday. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Robert Mondesi can be reached on (408) 918-7584. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /HOPE A ROBINSON/Primary Examiner, Art Unit 1652
Read full office action

Prosecution Timeline

Mar 15, 2022
Application Filed
Dec 21, 2025
Non-Final Rejection — §103, §112
Mar 23, 2026
Response Filed
Apr 10, 2026
Final Rejection — §103, §112 (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12595493
METHANATION METHOD IN A BIOREACTOR UNDER CONTINUOUS CELL-RETENTION CONDITIONS
2y 5m to grant Granted Apr 07, 2026
Patent 12584157
METHOD FOR PRODUCING GAMMA-GLUTAMYL-VALYL-GLYCINE AND/OR A SALT THEREOF
2y 5m to grant Granted Mar 24, 2026
Patent 12559374
PROCESS FOR PRODUCING GRAPHENE DOPED WITH NITROGEN AND SULFUR
2y 5m to grant Granted Feb 24, 2026
Patent 12553069
Isopropylmalate synthase polypeptide variant and a method for producing L-leucine using the same
2y 5m to grant Granted Feb 17, 2026
Patent 12553071
GENETICALLY ENGINEERED STRAINS WITH REDUCED BYPRODUCT FORMATION
2y 5m to grant Granted Feb 17, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

AI Strategy Recommendation

Get an AI-powered prosecution strategy using examiner precedents, rejection analysis, and claim mapping.
Powered by AI — typically takes 5-10 seconds

Prosecution Projections

3-4
Expected OA Rounds
68%
Grant Probability
99%
With Interview (+43.0%)
3y 5m
Median Time to Grant
Moderate
PTA Risk
Based on 1032 resolved cases by this examiner. Grant probability derived from career allow rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month