Prosecution Insights
Last updated: April 19, 2026
Application No. 17/775,981

COMPOSITIONS AND METHODS FOR IMMUNOTHERAPY

Final Rejection §DP
Filed
May 11, 2022
Examiner
XIAO, YAN
Art Unit
1642
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
Surface Oncology LLC
OA Round
2 (Final)
68%
Grant Probability
Favorable
3-4
OA Rounds
3y 0m
To Grant
99%
With Interview

Examiner Intelligence

Grants 68% — above average
68%
Career Allow Rate
508 granted / 749 resolved
+7.8% vs TC avg
Strong +52% interview lift
Without
With
+51.7%
Interview Lift
resolved cases with interview
Typical timeline
3y 0m
Avg Prosecution
29 currently pending
Career history
778
Total Applications
across all art units

Statute-Specific Performance

§101
4.4%
-35.6% vs TC avg
§103
29.5%
-10.5% vs TC avg
§102
19.4%
-20.6% vs TC avg
§112
23.4%
-16.6% vs TC avg
Black line = Tech Center average estimate • Based on career data from 749 resolved cases

Office Action

§DP
Notice of Pre-AIA or AIA Status The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . DETAILED ACTION 2. The amendment filed 10/27/2025 is acknowledged and has been entered. Claims 1, 4, 7 and 13 have been amended. Claims 2, 3, 5, 6 and 20 have been cancelled. 3. Claims 1, 4 and 7-19 are pending in the application. Claims 11-12 and 14-19 have been withdrawn from further consideration pursuant to 37 CFR 1.142(b) as being drawn to a nonelected invention, there being no allowable generic or linking claim. Election was made without traverse in the reply filed on 06/11/2025. 4. Claims 1, 4, 7-10 and 13 have been examined. Grounds of Objection and Rejection Withdrawn 5. Unless specifically reiterated below, Applicant’s amendment and/or arguments have obviated or rendered moot the grounds of objection and rejection set forth in the previous Office action mailed 06/25/2025. New Grounds of Rejection Double Patenting 6. The nonstatutory double patenting rejection is based on a judicially created doctrine grounded in public policy (a policy reflected in the statute) so as to prevent the unjustified or improper timewise extension of the “right to exclude” granted by a patent and to prevent possible harassment by multiple assignees. A nonstatutory double patenting rejection is appropriate where the claims at issue are not identical, but at least one examined application claim is not patentably distinct from the reference claim(s) because the examined application claim is either anticipated by, or would have been obvious over, the reference claim(s). See, e.g., In re Berg, 140 F.3d 1428, 46 USPQ2d 1226 (Fed. Cir. 1998); In re Goodman, 11 F.3d 1046, 29 USPQ2d 2010 (Fed. Cir. 1993); In re Longi, 759 F.2d 887, 225 USPQ 645 (Fed. Cir. 1985); In re Van Ornum, 686 F.2d 937, 214 USPQ 761 (CCPA 1982); In re Vogel, 422 F.2d 438, 164 USPQ 619 (CCPA 1970); and In re Thorington, 418 F.2d 528, 163 USPQ 644 (CCPA 1969). A timely filed terminal disclaimer in compliance with 37 CFR 1.321(c) or 1.321(d) may be used to overcome an actual or provisional rejection based on a nonstatutory double patenting ground provided the reference application or patent either is shown to be commonly owned with this application, or claims an invention made as a result of activities undertaken within the scope of a joint research agreement. A terminal disclaimer must be signed in compliance with 37 CFR 1.321(b). The USPTO internet Web site contains terminal disclaimer forms which may be used. Please visit http://www.uspto.gov/forms/. The filing date of the application will determine what form should be used. A web-based eTerminal Disclaimer may be filled out completely online using web-screens. An eTerminal Disclaimer that meets all requirements is auto-processed and approved immediately upon submission. For more information about eTerminal Disclaimers, refer to http://www.uspto.gov/patents/process/file/efs/guidance/eTD-info-I.jsp. 7. Claims 1, 4, 7-10 and 13 are rejected on the ground of nonstatutory obviousness-type double patenting as being unpatentable over claims 1-19 of U.S. Patent No. 12,162,941 in view of Jewetta (US 20150238530, published on 08/27/2015) (of record). Although the conflicting claims are not identical, they are not patentably distinct from each other because for the following reasons: Claims 1, 4, 7-10 and 13 are herein drawn to a method of i) treating cancer by activating NK cells; and/or ii) enhancing NK cell activation; comprising administering to a human a composition that binds CD16 and CD112R, wherein the composition comprises an anti-CD112R antibody comprising a heavy chain variable region (VH) having the amino acid sequence of SEQ ID NO: 712 and a light chain variable region (VL) having the amino acid sequence of SEQ ID NO: 718. Claims 1-19 of U.S. Patent No. 12,162,941 are drawn to a method of treating a cancer in a subject in need thereof, the method comprising administering to the subject a therapeutically effective amount of an antibody or antigen binding portion thereof that binds to CD112R and comprises: a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 712 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 718. U.S. Patent No. 12,162,941 teaches that the anti-CD112R antibodies could activate NK cells; see col. 6-lines 49-57. The SEQ ID NOs: 712 and 718 of U.S. Patent No. 12,162,941 are 100% identical with the instant claimed SEQ ID NOs: 712 and 718; see below sequence alignment 1. The claims of U.S. Patent No. 12,162,941 do not teach anti-CD16 antibody. However, this deficiency is remedied by Jewetta. Jewetta teaches a method for depleting cancer stem cells at a tumor site in an individual, the method comprising administering a composition of activated NK cells at a dose effective to deplete the cancer stem cells, wherein the NK cells are activated by anti-CD16 antibodies; see entire document, e.g., [0015], claims 1, 10 and 14. It would have been prima facie obvious to one of ordinary skill in the art before the effective filing date of the claimed invention to combine the teachings of the references so as to treat cancer using anti-CD16 antibody and anti-CD112R antibody for activating NK cells. One would have been motivated to do so because U.S. Patent No. 12,162,941 teaches a method of treating a cancer in a subject comprises administering to the subject an anti-CD112R antibody, wherein the anti-CD112R antibodies could activate NK cells; Jewetta teaches a method for depleting cancer stem cells at a tumor site in an individual, the method comprising administering a composition of activated NK cells at a dose effective to deplete the cancer stem cells, wherein the NK cells are activated by anti-CD16 antibodies. Thus, one of ordinary skill in the art would have a reasonable expectation of success that by combining the teachings of the references so as to treat cancer using anti-CD16 antibody and anti-CD112R antibody for activating NK cells, because NK cells can be activated by anti-CD112R antibody and anti-CD16 antibody as taught by U.S. Patent No. 12,162,941 and Jewetta. 8. Claims 1, 4, 7-10 and 13 are provisionally rejected on the ground of nonstatutory obviousness-type double patenting as being unpatentable over claims 1, 3, 18, 21-25 and 27-37 of copending Application No. 18/930273 in view of Jewetta (US 20150238530, published on 08/27/2015) (of record). Although the conflicting claims are not identical, they are not patentably distinct from each other for the following reasons: Claims 1, 4, 7-10 and 13 are herein drawn to a method of i) treating cancer by activating NK cells; and/or ii) enhancing NK cell activation; comprising administering to a human a composition that binds CD16 and CD112R, wherein the composition comprises an anti-CD112R antibody comprising a heavy chain variable region (VH) having the amino acid sequence of SEQ ID NO: 712 and a light chain variable region (VL) having the amino acid sequence of SEQ ID NO: 718. Claims 1, 3, 18, 21-25 and 27-37 of copending Application No. 18/930273 are drawn to a method of treating cancer in a subject comprising administering an anti-CD112R antibody to a subject having cancer, wherein the anti-CD112R antibody enhancing NK cell activation, wherein the anti-CD112R antibody comprises: a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 712 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 718. The SEQ ID NOs: 712 and 718 of copending Application No. 18/930273 are 100% identical with the instant claimed SEQ ID NOs: 712 and 718; see below sequence alignment 2. The claims of copending Application No. 18/930273 do not teach anti-CD16 antibody. However, this deficiency is remedied by Jewetta. Jewetta teaches a method for depleting cancer stem cells at a tumor site in an individual, the method comprising administering a composition of activated NK cells at a dose effective to deplete the cancer stem cells, wherein the NK cells are activated by anti-CD16 antibodies; see entire document, e.g., [0015], claims 1, 10 and 14. It would have been prima facie obvious to one of ordinary skill in the art before the effective filing date of the claimed invention to combine the teachings of the references so as to treat cancer using anti-CD16 antibody and anti-CD112R antibody for activating NK cells. One would have been motivated to do so because claims of copending Application No. 18/930273 teach a method of treating a cancer in a subject comprises administering to the subject an anti-CD112R antibody, wherein the anti-CD112R antibody enhancing NK cell activation; Jewetta teaches a method for depleting cancer stem cells at a tumor site in an individual, the method comprising administering a composition of activated NK cells at a dose effective to deplete the cancer stem cells, wherein the NK cells are activated by anti-CD16 antibodies. Thus, one of ordinary skill in the art would have a reasonable expectation of success that by combining the teachings of the references so as to treat cancer using anti-CD16 antibody and anti-CD112R antibody for activating NK cells, because NK cells can be activated by anti-CD112R antibody and anti-CD16 antibody as taught by copending Application No. 18/930273 and Jewetta. This is a provisional obviousness-type double patenting rejection because the conflicting claims have not in fact been patented. Conclusion 9. No claim is allowed. 10. Applicant's amendment necessitated the new ground(s) of objection/rejection presented in this Office action. Accordingly, THIS ACTION IS MADE FINAL. See MPEP § 706.07(a). Applicant is reminded of the extension of time policy as set forth in 37 CFR 1.136(a). A shortened statutory period for reply to this final action is set to expire THREE MONTHS from the mailing date of this action. In the event a first reply is filed within TWO MONTHS of the mailing date of this final action and the advisory action is not mailed until after the end of the THREE-MONTH shortened statutory period, then the shortened statutory period will expire on the date the advisory action is mailed, and any extension fee pursuant to 37 CFR 1.136(a) will be calculated from the mailing date of the advisory action. In no event, however, will the statutory period for reply expire later than SIX MONTHS from the date of this final action. 11. Any inquiry concerning this communication or earlier communications from the examiner should be directed to YAN XIAO whose telephone number is (571)270-3578. The examiner can normally be reached M-F 8-5 EST. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Samira Jean-Louis can be reached on 571-270-3503. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /YAN XIAO/Primary Examiner, Art Unit 1642 Sequence alignment 1 US-17-531-380-712 Filing date in PALM: 2021-11-19 Sequence 712, US/17531380 Publication No. US20220162317A1 GENERAL INFORMATION APPLICANT: SURFACE ONCOLOGY, INC. APPLICANT: ADIMAB LLC TITLE OF INVENTION: ANTI-CD112R COMPOSITIONS AND METHODS FILE REFERENCE: 01219-0001-00PCT CURRENT APPLICATION NUMBER: US/17/531,380 CURRENT FILING DATE: 2021-11-19 PRIOR APPLICATION NUMBER: US 17/261,463 PRIOR FILING DATE: 2021-01-19 PRIOR APPLICATION NUMBER: US 62/701,065 PRIOR FILING DATE: 2018-07-20 PRIOR APPLICATION NUMBER: US 62/844,958 PRIOR FILING DATE: 2019-05-08 NUMBER OF SEQ ID NOS: 4018 SEQ ID NO 712 LENGTH: 123 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: Synthetic: 35 - VH Protein Query Match 100.0%; Score 643; Length 123; Best Local Similarity 100.0%; Matches 123; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSAAISWVRQAPGQGLEWMGNIIPIVGIANY 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSAAISWVRQAPGQGLEWMGNIIPIVGIANY 60 Qy 61 AQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCARDTGRGYTRHFWFDPWGQGTLVT 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 AQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCARDTGRGYTRHFWFDPWGQGTLVT 120 Qy 121 VSS 123 ||| Db 121 VSS 123 US-17-531-380-718 Filing date in PALM: 2021-11-19 Sequence 718, US/17531380 Publication No. US20220162317A1 GENERAL INFORMATION APPLICANT: SURFACE ONCOLOGY, INC. APPLICANT: ADIMAB LLC TITLE OF INVENTION: ANTI-CD112R COMPOSITIONS AND METHODS FILE REFERENCE: 01219-0001-00PCT CURRENT APPLICATION NUMBER: US/17/531,380 CURRENT FILING DATE: 2021-11-19 PRIOR APPLICATION NUMBER: US 17/261,463 PRIOR FILING DATE: 2021-01-19 PRIOR APPLICATION NUMBER: US 62/701,065 PRIOR FILING DATE: 2018-07-20 PRIOR APPLICATION NUMBER: US 62/844,958 PRIOR FILING DATE: 2019-05-08 NUMBER OF SEQ ID NOS: 4018 SEQ ID NO 718 LENGTH: 106 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: Synthetic: 35 - VL Protein Query Match 100.0%; Score 541; Length 106; Best Local Similarity 100.0%; Matches 106; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 DIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYAASSLQSGVPS 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 DIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYAASSLQSGVPS 60 Qy 61 RFSGSGSGTDFTLTISSLQPEDFATYYCQQSDILYTFGGGTKVEIK 106 |||||||||||||||||||||||||||||||||||||||||||||| Db 61 RFSGSGSGTDFTLTISSLQPEDFATYYCQQSDILYTFGGGTKVEIK 106 Sequence alignment 2 US-18-930-273-712 Filing date in PALM: 2024-10-29 Sequence 712, US/18930273 Publication No. US20250051449A1 GENERAL INFORMATION APPLICANT: SURFACE ONCOLOGY, INC. (en) TITLE OF INVENTION: ANTI-CD112R COMPOSITIONS AND METHODS (en) FILE REFERENCE: LU67075 CURRENT APPLICATION NUMBER: US/18/930,273 CURRENT FILING DATE: 2024-10-29 NUMBER OF SEQ ID NOS: 4018 SEQ ID NO 712 LENGTH: 123 TYPE: PRT FEATURE: NAME/KEY: REGION LOCATION: 1..123 QUALIFIERS: note = Synthetic: 35 - VH Protein FEATURE: NAME/KEY: source LOCATION: 1..123 QUALIFIERS: mol_type = protein organism = synthetic construct Query Match 100.0%; Score 643; Length 123; Best Local Similarity 100.0%; Matches 123; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSAAISWVRQAPGQGLEWMGNIIPIVGIANY 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSAAISWVRQAPGQGLEWMGNIIPIVGIANY 60 Qy 61 AQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCARDTGRGYTRHFWFDPWGQGTLVT 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 AQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCARDTGRGYTRHFWFDPWGQGTLVT 120 Qy 121 VSS 123 ||| Db 121 VSS 123 US-18-930-273-718 Filing date in PALM: 2024-10-29 Sequence 718, US/18930273 Publication No. US20250051449A1 GENERAL INFORMATION APPLICANT: SURFACE ONCOLOGY, INC. (en) TITLE OF INVENTION: ANTI-CD112R COMPOSITIONS AND METHODS (en) FILE REFERENCE: LU67075 CURRENT APPLICATION NUMBER: US/18/930,273 CURRENT FILING DATE: 2024-10-29 NUMBER OF SEQ ID NOS: 4018 SEQ ID NO 718 LENGTH: 106 TYPE: PRT FEATURE: NAME/KEY: REGION LOCATION: 1..106 QUALIFIERS: note = Synthetic: 35 - VL Protein FEATURE: NAME/KEY: source LOCATION: 1..106 QUALIFIERS: mol_type = protein organism = synthetic construct Query Match 100.0%; Score 541; Length 106; Best Local Similarity 100.0%; Matches 106; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 DIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYAASSLQSGVPS 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 DIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYAASSLQSGVPS 60 Qy 61 RFSGSGSGTDFTLTISSLQPEDFATYYCQQSDILYTFGGGTKVEIK 106 |||||||||||||||||||||||||||||||||||||||||||||| Db 61 RFSGSGSGTDFTLTISSLQPEDFATYYCQQSDILYTFGGGTKVEIK 106
Read full office action

Prosecution Timeline

May 11, 2022
Application Filed
Jun 22, 2025
Non-Final Rejection — §DP
Oct 27, 2025
Response Filed
Feb 09, 2026
Final Rejection — §DP (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12600763
COMPOSITIONS AND METHODS FOR THE DELIVERY OF THERAPEUTIC BIOLOGICS FOR TREATMENT OF DISEASE
2y 5m to grant Granted Apr 14, 2026
Patent 12590146
CLDN18.2-TARGETING ANTIBODY, PREPARATION METHOD THEREFOR, AND USE THEREOF
2y 5m to grant Granted Mar 31, 2026
Patent 12564641
ERIBULIN ANTIBODY-DRUG CONJUGATES AND METHODS OF USE
2y 5m to grant Granted Mar 03, 2026
Patent 12540176
True human antibody specific for interleukin 1 alpha
2y 5m to grant Granted Feb 03, 2026
Patent 12529702
SCORING METHODS FOR ANTI-PD THERAPY ELIGIBILITY AND COMPOSITIONS FOR PERFORMING SAME
2y 5m to grant Granted Jan 20, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

AI Strategy Recommendation

Get an AI-powered prosecution strategy using examiner precedents, rejection analysis, and claim mapping.
Powered by AI — typically takes 5-10 seconds

Prosecution Projections

3-4
Expected OA Rounds
68%
Grant Probability
99%
With Interview (+51.7%)
3y 0m
Median Time to Grant
Moderate
PTA Risk
Based on 749 resolved cases by this examiner. Grant probability derived from career allow rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month