Prosecution Insights
Last updated: October 04, 2026
Application No. 17/786,913

BIOSYNTHETIC PLATFORM FOR THE PRODUCTION OF CANNABINOIDS AND OTHER PRENYLATED COMPOUNDS

Non-Final OA §112§DP
Filed
Jun 17, 2022
Priority
Dec 26, 2019 — provisional 62/953,719 +1 more
Examiner
RAMIREZ, DELIA M
Art Unit
1652
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
The Regents of the University of California
OA Round
3 (Non-Final)
65%
Grant Probability
Favorable
3-4
OA Rounds
0m
Est. Remaining
99%
With Interview

Examiner Intelligence

Grants 65% — above average
65%
Career Allowance Rate
557 granted / 855 resolved
+5.1% vs TC avg
Strong +56% interview lift
Without
With
+56.3%
Interview Lift
resolved cases with interview
Typical timeline
2y 9m
Avg Prosecution
52 currently pending
Career history
902
Total Applications
across all art units

Statute-Specific Performance

§101
7.0%
-33.0% vs TC avg
§103
21.9%
-18.1% vs TC avg
§102
19.5%
-20.5% vs TC avg
§112
37.9%
-2.1% vs TC avg
Black line = Tech Center average estimate • Based on career data from 855 resolved cases

Office Action

§112 §DP
DETAILED ACTION Status of the Application Claims 1-4, 6-18 are pending. The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . Applicant’s amendment of claim 1 as submitted in a communication filed on 5/15/2026 is acknowledged. A request for continued examination under 37 CFR 1.114, including the fee set forth in 37 CFR 1.17(e), was filed in this application after final rejection. Since this application is eligible for continued examination under 37 CFR 1.114, and the fee set forth in 37 CFR 1.17(e) has been timely paid, the finality of the previous Office action has been withdrawn pursuant to 37 CFR 1.114. Applicant's submission filed on 5/15/2026 has been entered. Applicant elected without traverse Group I, claim 1, drawn in part to a variant of the protein of SEQ ID NO: 30, and the combination of substitutions M14I, Y31W, T69P, T77I, T98I, S136A, E222D, G224S, A232S, N236T, Y288V and G297K, in a communication filed on 9/12/2025 is acknowledged. Claims 2-4, 6-18 are withdrawn from further consideration pursuant to 37 CFR 1.142(b) as being drawn to a nonelected invention, there being no allowable generic or linking claim. Election was made without traverse in the reply filed on 9/12/2025. Claim 1 is at issue and is being examined herein. The text of those sections of Title 35, U.S. Code not included in this action can be found in a prior Office action. Rejections and/or objections not reiterated from previous office actions are hereby withdrawn. Claim Rejections - 35 USC § 112(b) or Second Paragraph (pre-AIA ) Claim 1 remains rejected under 35 U.S.C. 112(b) or 35 U.S.C. 112 (pre-AIA ), second paragraph, as being indefinite for failing to particularly point out and distinctly claim the subject matter which the inventor or a joint inventor, or for pre-AIA the applicant regards as the invention. New grounds of rejection are necessitated by amendment. Claim 1 is indefinite in the recitation of “(i) an amino acid sequence that is a variant of SEQ ID NO: 30 having substitutions that correspond to an M14I substitution, a Y31W substitution, ….an N236T substitution, a Y288X substitution in the sequence of SEQ ID NO: 30..and wherein the amino acid sequence further comprises one or more substitutions that correspond to substitution of T69P and T77I of the sequence of SEQ ID NO: 30” for the following reasons. The term “M14I substitution, a Y31W substitution, ….an N236T substitution, a Y288X substitution in the sequence of SEQ ID NO: 30” is unclear because one cannot determine if the variant is required to have all the substitutions recited, or if the variant is required to have only one of the substitutions recited. Please note that there is no ”and” or “or” between the terms “an N236T substitution,” and “a Y288X substitution”. For examination purposes, it will be assumed that the claim reads “….an amino acid sequence that is a variant of SEQ ID NO: 30 having (a) substitutions that correspond to substitutions M14I, Y31W, T98I, S136A, E222D, G224S, A232S, N236T and Y288X in the sequence of SEQ ID NO: 30, wherein X is A, N, S, V, or a non-natural amino acid, and (b) one or more substitutions that correspond to substitutions T69P and T77I in the sequence of SEQ ID NO: 30”. Correction is required. Claim 1 is indefinite in the recitation of “(ii) an amino acid sequence that is a variant of SEQ ID NO: 30 having substitutions that correspond to an M14I substitution, a Y31W substitution, ….an N236T substitution, a Y288X substitution….wherein the amino acid sequence further comprises one or more substitutions that correspond to substitution of T69P and T77I of the sequence of SEQ ID NO: 30 and further comprising from 1-20 additional conservative substitutions corresponding to SEQ ID NO: 30” for the following reasons. The term “M14I substitution, a Y31W substitution, ….an N236T substitution, a Y288X substitution in the sequence of SEQ ID NO: 30” is unclear because one cannot determine if the variant is required to have all the substitutions recited, or if the variant is required to have only one of the substitutions recited. Please note that there is no ”and” or “or” between the terms “an N236T substitution,” and “a Y288X substitution”. In addition it is unclear as to how substitutions correspond to an amino acid sequence. For examination purposes, it will be assumed that the claim reads “….an amino acid sequence that is a variant of SEQ ID NO: 30 having (a) substitutions that correspond to substitutions M14I, Y31W, T98I, S136A, E222D, G224S, A232S, N236T and Y288X in the sequence of SEQ ID NO: 30, wherein X is A, N, S, V, or a non-natural amino acid, (b) one or more substitutions that correspond to substitutions T69P and T77I in the sequence of SEQ ID NO: 30, and (iii) 1 to 20 substitutions that correspond to conservative amino acid substitutions in the sequence of SEQ ID NO: 30”. Correction is required. Claim 1 is indefinite in the recitation of “(iii) an amino acid sequence that is at least 95% identical to SEQ ID NO: 30 having substitutions that correspond to an M14I substitution, a Y31W substitution, ….an N236T substitution, a Y288X substitution in the sequence of SEQ ID NO: 30….and wherein the amino acid sequence further comprises one or more substitutions that correspond to substitution of T69P and T77I of the sequence of SEQ ID NO: 30” for the following reasons. The term “M14I substitution, a Y31W substitution, ….an N236T substitution, a Y288X substitution in the sequence of SEQ ID NO: 30” is unclear because one cannot determine if the variant is required to have all the substitutions recited, or if the variant is required to have only one of the substitutions recited. Please note that there is no ”and” or “or” between the terms “an N236T substitution,” and “a Y288X substitution”. For examination purposes, it will be assumed that the claim reads “an amino acid sequence that is at least 95% identical to SEQ ID NO: 30 having (a) substitutions that correspond to substitutions M14I, Y31W, T98I, S136A, E222D, G224S, A232S, N236T and Y288X in the sequence of SEQ ID NO: 30, wherein X is A, N, S, V, or a non-natural amino acid, and (b) one or more substitutions that correspond to substitutions T69P and T77I in the sequence of SEQ ID NO: 30”. Correction is required. When amending the claims, applicant is advised to carefully review all examined claims and make the necessary changes to ensure proper antecedent basis and dependency. Claim Rejections - 35 USC § 112(a) or First Paragraph (pre-AIA ) Claim 1 remains rejected under 35 U.S.C. 112(a) or 35 U.S.C. 112 (pre-AIA ), first paragraph, as failing to comply with the written description requirement. The claim(s) contains subject matter which was not described in the specification in such a way as to reasonably convey to one skilled in the relevant art that the inventor or a joint inventor, or for pre-AIA the inventor(s), at the time the application was filed, had possession of the claimed invention. This rejection has been discussed at length in the prior Office action. It is maintained for the reasons of record and those set forth below. Applicant argues that the specification recites “…a sequence that is at least 85% …identical to the sequence of (i)-(iv) and which have NphB activity”. Applicant states that the specification contemplate and literally recites the subject matter claimed. Applicant states one of skill in the art would be able to review SEQ ID NO: 30, recognize the mutations recited, recognize which substitutions are conservative and generate a variant consistent with the claimed invention and assay the variants for “NphB” activity. Applicant states that claim 1 has been amended to recite 95% identity. Applicant’s arguments have been fully considered but not deemed persuasive to overcome the instant rejection. The Examiner acknowledges the amendments made to the claim. However, the Examiner disagrees with Applicant’s contention that the specification adequately describes the entire genus of proteins encompassed by the claim. Applicant is reminded that what is being under consideration is claim 1 and not the specification. The Examiner acknowledges the teachings of the specification. However, as set forth in MPEP § 2111.01(II), it is improper to import claim limitations from the specification. Claim 1 as currently presented and as interpreted in parts (i) and (ii) do not require any % sequence identity, let alone 95% sequence identity. Only the polypeptide of claim 1, part (iii) requires the recited 95 % sequence identity. Therefore, the polypeptides of claim 1, parts (i) and (ii) can have any structure so long as the polypeptides have the recited substitutions. Please note that parts (i) and (ii) of claim 1 do not limit the recombinant polypeptide to a variant of the polypeptide of SEQ ID NO: 30 that comprises all of SEQ ID NO: 30 except for the recited substitutions. There is absolutely no limit with regard to additional modifications that could be present in the recombinant polypeptide of parts (i) and (ii) of claim 1. Therefore, claim 1 encompasses a genus of recombinant polypeptides where only 11 amino acids at most are defined. In the case of variants of the protein of SEQ ID NO: 30 having at least 95% sequence identity to the protein of SEQ ID NO: 30, if the formula previously provided is used, the total number of variants of the protein of SEQ ID NO: 30 that have at least 95% sequence identity to the polypeptide of SEQ ID NO: 30 that result from amino acid substitutions is 307!x1916/(307-16)!/16! or 5.76x1046 variants. It is reiterated herein that while the specification in the instant application discloses the structure of a limited number of species of the genus of variants of the polypeptide of SEQ ID NO: 30 having the recited substitutions, it provides no clue as to the structural elements required in any protein having aromatic prenyltransferase activity, nor does it teach which structural elements within the polypeptide of SEQ ID NO: 30 are required in any protein having aromatic prenyltransferase activity. No disclosure of a structure/function correlation has been provided which would allow one of skill in the art to recognize which structural variants of the polypeptide of SEQ ID NO: 30 having the recited structural limitations have aromatic prenyltransferase activity, specifically the ability to catalyze the conversion of olivetolic acid or divarinic acid to cannabigerolic acid or cannabigerovarinic acid, respectively. Furthermore, while one could argue that the few species disclosed are representative of the structure of all the members of the genus, it is noted that the art teaches several examples of how even highly structurally homologous polypeptides can have different enzymatic activities. See the teachings of Witkowski et al., Seffernick et al. and Tang et al. previously discussed. Therefore, contrary to Applicant’s assertions, the entire genus of polypeptides claimed is not adequately described by the teachings of the specification and/or the prior art. Claim 1 remains rejected under 35 U.S.C. 112(a) or 35 U.S.C. 112 (pre-AIA ), first paragraph, because the specification, while being enabling for a protein that has aromatic prenyltransferase activity and comprises all of SEQ ID NO: 30 except for (a) substitutions that correspond to the substitutions M14I, Y31W, T98I, S163A, E222D, G224S, A232S, N236T, and Y288X in the polypeptide of SEQ ID NO: 30, wherein X is A, N, S, V or a non-natural amino acid, and (b) one or more substitutions that correspond to substitutions in the polypeptide of SEQ ID NO: 30 selected from T69P and T77I, does not reasonably provide enablement for a variant of the polypeptide of SEQ ID NO: 30 that comprises (i) substitutions that correspond to the substitutions M14I, Y31W, T98I, S163A, E222D, G224S, A232S, N236T, and Y288X in the polypeptide of SEQ ID NO: 30, wherein X is A, N, S, V or a non-natural amino acid, and (ii) one or more substitutions that correspond to substitutions in the polypeptide of SEQ ID NO: 30 selected from T69P and T77I, wherein said variant has any structure. The specification does not enable any person skilled in the art to which it pertains, or with which it is most nearly connected, to make and/or use the invention commensurate in scope with these claims. This rejection has been discussed at length in the prior Office action. It is maintained for the reasons of record and those set forth below. Applicant submits that this rejection appears to overlap with the 112(b) rejection above. Applicant states that the amendments made to the claim to address the 112(b) rejection also address the instant rejection. Applicant’s arguments have been fully considered but not deemed persuasive to overcome this rejection. It is reiterated herein that claim 1 as currently presented and as interpreted in parts (i) and (ii) do not require any % sequence identity. See Claim Rejections - 35 USC § 112(b) or Second Paragraph (pre-AIA ) for claim interpretation. Only the polypeptide of claim 1, part (iii) requires the recited 95 % sequence identity. As such, the polypeptides of claim 1, parts (i) and (ii) can have any structure so long as the polypeptides have the recited substitutions. Please note that parts (i) and (ii) of claim 1 do not limit the recombinant polypeptide to a variant of the polypeptide of SEQ ID NO: 30 that comprises all of SEQ ID NO: 30 except for the recited substitutions. There is absolutely no limit with regard to additional modifications that could be present in the recombinant polypeptide of parts (i) and (ii) of claim 1. Therefore, claim 1 encompasses recombinant polypeptides where only 11 amino acids at most are defined. With regard to the recombinant polypeptides of claim 1, part (iii), the total number of variants of the protein of SEQ ID NO: 30 that have at least 95% sequence identity to the polypeptide of SEQ ID NO: 30 that result from amino acid substitutions is 307!x1916/(307-16)!/16! or 5.76x1046 variants. It is reiterated herein that while the specification in the instant application discloses the structure of a limited number of species of the genus of variants of the polypeptide of SEQ ID NO: 30 having the recited substitutions, it provides no clue as to the structural elements required in any protein having aromatic prenyltransferase activity, nor does it teach which structural elements within the polypeptide of SEQ ID NO: 30 are required in any protein having aromatic prenyltransferase activity. No disclosure of a structure/function correlation has been provided which would allow one of skill in the art to recognize which structural variants of the polypeptide of SEQ ID NO: 30 having the recited structural limitations have aromatic prenyltransferase activity, specifically the ability to catalyze the conversion of olivetolic acid or divarinic acid to cannabigerolic acid or cannabigerovarinic acid, respectively. In addition, the art does not provide any teaching or guidance as to which changes can be made to the protein of SEQ ID NO: 30 such that the resulting variant would display the desired functional characteristics, or the general tolerance of aromatic prenyltransferases to structural modifications and the extent of such tolerance. The art clearly teaches that (a) determining function based solely on structural homology, and (b) modification of a protein’s amino acid sequence to obtain the desired activity without any guidance/knowledge as to which amino acids in a protein are tolerant of modification and which ones are conserved are highly unpredictable. See the teachings of Singh et al. and Sadowski et al. previously discussed. In the absence of (i) a rational and predictable scheme for selecting those proteins most likely to have the desired functional features, and/or (ii) a correlation between structure and aromatic prenyltransferase activity, one of skill in the art would have to test an essentially infinite number of proteins to determine which ones have the desired functional characteristics. This is not deemed routine experimentation. Thus, for the reasons of record and those set forth above one cannot reasonably conclude that the entire scope of the claim is fully enabled by the teachings of the specification and/or the prior art. Double Patenting Claim 1 remains rejected on the ground of nonstatutory obviousness-type double patenting as being unpatentable over (i) claim 5 of U.S. Patent No. 11,518,983, and (ii) claim 5 of U.S. Patent No. 12,084,689. This rejection has been discussed at length in the prior Office action. It is maintained for the reasons of record and those set forth below. Applicant argues that the ’983 and ’689 patents are not prior art. Applicant cites Ex Parte Baurin Appeal 2024-002920 in support of the argument that these patents are not proper ODP reference patents. Applicant states that a terminal disclaimer in the present case will serve absolutely no purpose in preventing patentees from obtaining a second patent to effectively extend the life of a first patent. Applicant states that it is impossible for the ‘983 and ‘689 to anticipate the present claims. Applicant states that anticipation requires that the disclosure of the ‘983 and 689’ be in the public domain prior to the priority date of the present anticipation. Applicant states that the ‘983 and the ‘689 disclosure were not publicly available prior the priority date of the present application. Applicant states that an OTDP rejection based upon a later filed, later expiring patent requires the Examiner perform a 2 way OTDP test. Applicant states that the OTDP rejection is not appropriate because (i) the earlier filed earlier expiring application is not a second later expiring patent for the same invention, (ii) the subject matter of the claims in the later filed, later expiring patent could not have been presented in the claim of the earlier filed, earlier expiring unrelated patent. Applicant’s arguments have been fully considered but not deemed persuasive to overcome the instant rejection. The Examiner has previously acknowledged that (i) U.S. Patent No. 11,518,983 was issued from application No. 17/824,118, which was filed on 5/25/2022, (ii) U.S. Patent No. 12,084,689 issued from application No. 17/934,560, which was filed on 9/22/2022 and is a continuation of application No. 17/824,118, which was filed on 5/25/2022, and (iii) the instant application is the US national application which entered the national stage from PCT/US2020/067032 filed on 12/24/2020 and was published as U.S. Publication No. 2023/0348866 on 11/2/2023, after the filing date of both 17/824,118 and 17/934,560. However, the Examiner disagrees with Applicant’s contention that U.S. Patent No. 11,518,983 and 12,084,689 are improper ODP reference patents. The Examiner had previously acknowledged the decision in Ex Parte Baurin. However, it is reiterated herein that (i) the Examiner cannot determine at this time the expiration date of any patent issued from the instant application because patent term can be extended or adjusted, (ii) it would be improper for the Examiner to make comments regarding the prosecution of applications No. 17/824,118 and 17/934,560, and ODP rejections in those applications, (iii) there is no prohibition in the MPEP for making double patenting rejections over patents or applications that have a later filing date, and (iv) the instant case is not the same as that discussed in Ex Parte Baurin. With regard to the argument that a terminal disclaimer in the present case will serve absolutely no purpose in preventing patentees from obtaining a second patent to effectively extend the life of a first patent, it is noted that as set forth in MPEP § 804, the doctrine of nonstatutory double patenting also seeks to prevent the possibility of multiple suits against an accused infringer by different assignees of patents claiming patentably indistinct variations of the same invention. With regard to the argument that it is impossible for the ‘983 and ‘689 to anticipate the present claims because anticipation requires that the disclosure of the ‘983 and 689’ be in the public domain prior to the priority date of the present anticipation, it is noted that if the ability to make nonstatutory double patenting rejections based on anticipation is based on the availability of the reference in the public domain, it would not be possible to make nonstatutory double patenting rejections based on anticipation with copending applications that have not been yet published. The Examiner has not been able to find any mention in the MPEP indicating that nonstatutory double patenting rejections based on anticipation can only be made if the conflicting claims are in applications which have been published, thus being in the public domain. It is also noted that a nonstatutory double patenting rejection based on anticipation is not a prior art rejection. Instead, anticipation in double patenting is based on whether the claims in the patent are the same or encompassed by the claims of the application under examination. There is no indication in the MPEP indicating that nonstatutory double patenting based on anticipation requires a two-way determination of obviousness. As previously indicated, the inventions of claim 5 of U.S. Patent No. 11,518,983 and claim 5 of U.S. Patent No. 12,084,689 anticipate the invention of claim 1. Claim 1 of the instant application is directed in part to a variant of the polypeptide of SEQ ID NO: 30 having any structure, or at least 95% sequence identity to the polypeptide of SEQ ID NO: 30, wherein said variant comprises (a) substitutions that correspond to the substitutions M14I, Y31W, T98I, S163A, E222D, G224S, A232S, N236T, and Y288X in the polypeptide of SEQ ID NO: 30, wherein X is A, N, S, V or a non-natural amino acid, and (b) one or more substitutions that correspond to substitutions in the polypeptide of SEQ ID NO: 30 selected from T69P and T77I, wherein said variant can optionally comprise 1-20 additional conservative substitutions, and wherein said variant may or may not have aromatic prenyltransferase activity. See Claim Rejections - 35 USC § 112(b) or Second Paragraph (pre-AIA ) for claim interpretation. Claim 5 of U.S. Patent No. 11,518,983 is directed in part to a recombinant polypeptide having prenyltransferase activity which is at least 90% sequence identical to the polypeptide of SEQ ID NO: 4, wherein said polypeptide comprises substitutions corresponding to substitutions A232S and Y288V of the polypeptide of SEQ ID NO: 4, as well as substitutions corresponding to substitutions M14I, Y31W, T69P, T77I, T98I, S136A, E222D, G224S, N236T, L33I and S277T in the polypeptide of SEQ ID NO: 4. The polypeptide of SEQ ID NO: 4 of U.S. Patent No. 11,518,983 is identical to the protein of SEQ ID NO: 30 of the instant application except for two substitutions, A232S and Y288V. See alignment below. The substitutions L33I and S277T are conservative substitutions. Therefore, the recombinant polypeptide of claim 5 that comprises the substitutions corresponding to substitutions M14I, Y31W, T69P, T77I, T98I, S136A, E222D, G224S, N236T, L33I and S277T in the polypeptide of SEQ ID NO: 4 is a variant of the polypeptide of SEQ ID NO: 30 that comprises the substitutions that correspond to substitutions A232S, Y288V, M14I, Y31W, T69P, T77I, T98I, S136A, E222D, G224S, and N236T as well as two additional conservative substitutions (L33I and S277T). As such, the variant of claim 1 of the instant application is anticipated by the polypeptide of claim 5 of U.S. Patent No. 11,518,983. Claim 5 of U.S. Patent No. 12,084,689 is directed in part to a recombinant polypeptide having prenyltransferase activity which is at least 85% sequence identity to the polypeptide of SEQ ID NO: 4, wherein said polypeptide comprises substitutions corresponding to substitutions A232S and Y288V of the polypeptide of SEQ ID NO: 4, as well as substitutions corresponding to substitutions M14I, Y31W, T69P, T77I, T98I, S136A, E222D, G224S, N236T, L33I and S277T in the polypeptide of SEQ ID NO: 4. The polypeptide of SEQ ID NO: 4 of U.S. Patent No. 12,084,689 is identical to the protein of SEQ ID NO: 30 of the instant application except for two substitutions, A232S and Y288V. See alignment below. The substitutions L33I and S277T are conservative substitutions. Therefore, the recombinant polypeptide of claim 5 that comprises the substitutions corresponding to substitutions M14I, Y31W, T69P, T77I, T98I, S136A, E222D, G224S, N236T, L33I and S277T in the polypeptide of SEQ ID NO: 4 is a variant of the polypeptide of SEQ ID NO: 30 that comprises the substitutions that correspond to substitutions A232S, Y288V, M14I, Y31W, T69P, T77I, T98I, S136A, E222D, G224S, and N236T as well as two additional conservative substitutions (L33I and S277T). As such, the variant of claim 1 of the instant application is anticipated by the polypeptide of claim 5 of U.S. Patent No. 12,084,689. Therefore, for the reasons of record and those set forth above, these patents are deemed proper ODP reference patents. SEQ ID NO:30 US-17-934-560-4 Filing date in PALM: 2022-09-22 Sequence 4, US/17934560 Patent No. 12084689 GENERAL INFORMATION APPLICANT: Invizyne Technologies, Inc. (en) TITLE OF INVENTION: PRENYLTRANSFERASE VARIANTS WITH INCREASED THERMOSTABILITY (en) FILE REFERENCE: 15041.002WO1 CURRENT APPLICATION NUMBER: US/17/934,560 CURRENT FILING DATE: 2022-09-22 NUMBER OF SEQ ID NOS: 58 SEQ ID NO 4 LENGTH: 307 TYPE: PRT FEATURE: NAME/KEY: REGION LOCATION: 1..307 QUALIFIERS: note = Synthetic polypeptide FEATURE: NAME/KEY: source LOCATION: 1..307 QUALIFIERS: mol_type = protein organism = synthetic construct ALIGNMENT: Query Match 99.3%; Score 1573; Length 307; Best Local Similarity 99.3%; Matches 305; Conservative 1; Mismatches 1; Indels 0; Gaps 0; Qy 1 MSEAADVERVYAAMEEAAGLLGVACARDKIYPLLSTFQDTLVEGGSVVVFSMASGRHSTE 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MSEAADVERVYAAMEEAAGLLGVACARDKIYPLLSTFQDTLVEGGSVVVFSMASGRHSTE 60 Qy 61 LDFSISVPTSHGDPYATVVEKGLFPATGHPVDDLLADTQKHLPVSMFAIDGEVTGGFKKT 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 LDFSISVPTSHGDPYATVVEKGLFPATGHPVDDLLADTQKHLPVSMFAIDGEVTGGFKKT 120 Qy 121 YAFFPTDNMPGVAELSAIPSMPPAVAENAELFARYGLDKVQMTSMDYKKRQVNLYFSELS 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 YAFFPTDNMPGVAELSAIPSMPPAVAENAELFARYGLDKVQMTSMDYKKRQVNLYFSELS 180 Qy 181 AQTLEAESVLALVRELGLHVPNELGLKFCKRSFSVYPTLNWETGKIDRLCFAVISNDPTL 240 |||||||||||||||||||||||||||||||||||||||||||||||||||:|||||||| Db 181 AQTLEAESVLALVRELGLHVPNELGLKFCKRSFSVYPTLNWETGKIDRLCFSVISNDPTL 240 Qy 241 VPSSDEGDIEKFHNYATKAPYAYVGEKRTLVYGLTLSPKEEYYKLGAYYHITDVQRGLLK 300 ||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||| Db 241 VPSSDEGDIEKFHNYATKAPYAYVGEKRTLVYGLTLSPKEEYYKLGAVYHITDVQRGLLK 300 Qy 301 AFDSLED 307 ||||||| Db 301 AFDSLED 307 SEQ ID NO:30 RESULT 162 US-17-824-118-4 (NOTE: this sequence has 1 duplicate in the database searched. See complete list at the end of this report) Sequence 4, US/17824118 Patent No. 11518983 GENERAL INFORMATION APPLICANT: Invizyne Technologies, Inc. APPLICANT: KORMAN, Tyler P. TITLE OF INVENTION: PRENYLTRANSFERASE VARIANTS WITH INCREASED THERMOSTABILITY FILE REFERENCE: 15041.002WO1 CURRENT APPLICATION NUMBER: US/17/824,118 CURRENT FILING DATE: 2022-05-25 PRIOR APPLICATION NUMBER: US 63/193,221 PRIOR FILING DATE: 2021-05-26 NUMBER OF SEQ ID NOS: 58 SEQ ID NO 4 LENGTH: 307 TYPE: PRT ORGANISM: artificial FEATURE: OTHER INFORMATION: Synthetic polypeptide Query Match 99.3%; Score 1573; Length 307; Best Local Similarity 99.3%; Matches 305; Conservative 1; Mismatches 1; Indels 0; Gaps 0; Qy 1 MSEAADVERVYAAMEEAAGLLGVACARDKIYPLLSTFQDTLVEGGSVVVFSMASGRHSTE 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MSEAADVERVYAAMEEAAGLLGVACARDKIYPLLSTFQDTLVEGGSVVVFSMASGRHSTE 60 Qy 61 LDFSISVPTSHGDPYATVVEKGLFPATGHPVDDLLADTQKHLPVSMFAIDGEVTGGFKKT 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 LDFSISVPTSHGDPYATVVEKGLFPATGHPVDDLLADTQKHLPVSMFAIDGEVTGGFKKT 120 Qy 121 YAFFPTDNMPGVAELSAIPSMPPAVAENAELFARYGLDKVQMTSMDYKKRQVNLYFSELS 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 YAFFPTDNMPGVAELSAIPSMPPAVAENAELFARYGLDKVQMTSMDYKKRQVNLYFSELS 180 Qy 181 AQTLEAESVLALVRELGLHVPNELGLKFCKRSFSVYPTLNWETGKIDRLCFAVISNDPTL 240 |||||||||||||||||||||||||||||||||||||||||||||||||||:|||||||| Db 181 AQTLEAESVLALVRELGLHVPNELGLKFCKRSFSVYPTLNWETGKIDRLCFSVISNDPTL 240 Qy 241 VPSSDEGDIEKFHNYATKAPYAYVGEKRTLVYGLTLSPKEEYYKLGAYYHITDVQRGLLK 300 ||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||| Db 241 VPSSDEGDIEKFHNYATKAPYAYVGEKRTLVYGLTLSPKEEYYKLGAVYHITDVQRGLLK 300 Qy 301 AFDSLED 307 ||||||| Db 301 AFDSLED 307 The filing of a terminal disclaimer by itself is not a complete reply to a nonstatutory double patenting (NSDP) rejection. A complete reply requires that the terminal disclaimer be accompanied by a reply requesting reconsideration of the prior Office action. Even where the NSDP rejection is provisional the reply must be complete. See MPEP § 804, subsection I.B.1. For a reply to a non-final Office action, see 37 CFR 1.111(a). For a reply to final Office action, see 37 CFR 1.113(c). A request for reconsideration while not provided for in 37 CFR 1.113(c) may be filed after final for consideration. See MPEP §§ 706.07(e) and 714.13. Conclusion No claim is in condition for allowance. Applicant is advised that any Internet email communication by the Examiner has to be authorized by Applicant in written form. See MPEP § 502.03 (II). Without a written authorization by Applicant in place, the USPTO will not respond via Internet email to any Internet correspondence which contains information subject to the confidentiality requirement as set forth in 35 U.S.C. 122. Sample written authorization language can be found in MPEP § 502.03 (II). An Authorization for Internet Communications in a Patent Application or Request to Withdraw Authorization for Internet Communications form (SB/439) can be found at https://www.uspto.gov/patent/forms/ forms-patent-applications-filed-or-after-september-16-2012, which can be electronically filed. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. Any inquiry concerning this communication or earlier communications from the examiner should be directed to DELIA M RAMIREZ, Ph.D., whose telephone number is (571) 272-0938. The examiner can normally be reached on Monday-Friday from 8:30 AM to 5:00 PM. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Robert B. Mondesi, can be reached at (408) 918-7584. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. /DELIA M RAMIREZ/Primary Examiner, Art Unit 1652 DR June 26, 2026
Read full office action

Prosecution Timeline

Jun 17, 2022
Application Filed
Sep 22, 2025
Non-Final Rejection mailed — §112, §DP
Dec 19, 2025
Response Filed
Jan 15, 2026
Final Rejection mailed — §112, §DP
May 15, 2026
Request for Continued Examination
May 18, 2026
Response after Non-Final Action
Jun 29, 2026
Non-Final Rejection mailed — §112, §DP (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12716081
MUTANT OF CORYNEBACTERIUM GLUTAMICUM WITH ENHANCED L-CITRULLINE PRODUCTIVITY AND METHOD FOR PREPARING L-CITRULLINE USING THE SAME
2y 10m to grant Granted Aug 25, 2026
Patent 12698515
GENETICALLY ENGINEERED BACTERIUM USING GLUCOSE AS SUBSTRATE FOR DE NOVO SYNTHESIS OF VANILLIN AND APPLICATION THEREOF
2y 4m to grant Granted Aug 04, 2026
Patent 12698492
ISOLATED CAS13 PROTEIN AND USE THEREOF
2y 3m to grant Granted Aug 04, 2026
Patent 12668785
COMBINATION TREATMENT
2y 11m to grant Granted Jun 30, 2026
Patent 12655405
SEQUENCE SPECIFIC DEGRADATION OF SINGLE-STRANDED POLYNUCLEOTIDES WITH CARD1 NUCLEASE
3y 4m to grant Granted Jun 16, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

Strategy Recommendation AI-generated — please review before filing

Get a prosecution strategy drawn from examiner precedents, rejection analysis, and claim mapping.
Typically takes 5-10 seconds — AI-generated, attorney review required before filing

Prosecution Projections

3-4
Expected OA Rounds
65%
Grant Probability
99%
With Interview (+56.3%)
2y 9m (~0m remaining)
Median Time to Grant
High
PTA Risk
Based on 855 resolved cases by this examiner. Grant probability derived from career allowance rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month