Prosecution Insights
Last updated: August 06, 2026
Application No. 17/808,901

EXPRESSION OF SEVERE ACUTE RESPIRATORY SYNDROME CORONAVIRUS 2 (SARS-CoV-2) SPIKE PROTEIN SEQUENCES IN PLANTS AND PLANT PRODUCED VACCINE FOR SAME

Non-Final OA §103
Filed
Jun 24, 2022
Priority
Jun 25, 2021 — provisional 63/202,816
Examiner
ZHENG, LI
Art Unit
1662
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
Applied Biotechnology Institute, Inc.
OA Round
4 (Non-Final)
84%
Grant Probability
Favorable
4-5
OA Rounds
0m
Est. Remaining
96%
With Interview

Examiner Intelligence

Grants 84% — above average
84%
Career Allowance Rate
1067 granted / 1276 resolved
+23.6% vs TC avg
Moderate +13% lift
Without
With
+12.8%
Interview Lift
resolved cases with interview
Typical timeline
2y 6m
Avg Prosecution
31 currently pending
Career history
1303
Total Applications
across all art units

Statute-Specific Performance

§101
2.9%
-37.1% vs TC avg
§103
17.0%
-23.0% vs TC avg
§102
21.0%
-19.0% vs TC avg
§112
50.6%
+10.6% vs TC avg
Black line = Tech Center average estimate • Based on career data from 1276 resolved cases

Office Action

§103
Notice of Pre-AIA or AIA Status The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . DETAILED ACTION Continued Examination Under 37 CFR 1.114 1. A request for continued examination under 37 CFR 1.114, including the fee set forth in 37 CFR 1.17(e), was filed in this application after final rejection. Since this application is eligible for continued examination under 37 CFR 1.114, and the fee set forth in 37 CFR 1.17(e) has been timely paid, the finality of the previous Office action has been withdrawn pursuant to 37 CFR 1.114. Applicant's submission filed May 8, 2026 has been entered. Applicant’s amendments to claims 21 and 26, and cancellation of claims 25, 27, 28 and 33 in the paper filed 4/17/2026 are acknowledged. As a result, claim 39 are withdrawn from consideration for being drawn to non-elected invention. Claims 21, 23, 26, 31, 34, 36-38 and 40-41 and SEQ ID NO: 1-4 and 17-20 as well as construct pr44-BAASS:C0v-S1 are examined on the merits. 2. The rejections and objections not recited in this action are withdrawn. Claim Rejections - 35 USC § 103 The following is a quotation of 35 U.S.C. 103 which forms the basis for all obviousness rejections set forth in this Office action: A patent for a claimed invention may not be obtained, notwithstanding that the claimed invention is not identically disclosed as set forth in section 102, if the differences between the claimed invention and the prior art are such that the claimed invention as a whole would have been obvious before the effective filing date of the claimed invention to a person having ordinary skill in the art to which the claimed invention pertains. Patentability shall not be negated by the manner in which the invention was made. 3. Claim(s) 21, 23 and 40-41 remain rejected under 35 U.S.C. 103 as being unpatentable over Virtanen et al. (WO 2021/2113311) in view of Howard et al. (WO 97/10347) and Conrad et al. (CA2246242) and Hauser et al. (WO 2021/163622). Instant claims are drawn to a method of expressing Spike(S1) protein of SARS-CoV-2 comprising introducing into a plant a construct comprising a sequence that is with 95%/98%/99% homology to SEQ ID NO:1 and wherein the construct comprises: a) a promoter preferentially directing expression to seed tissue; b) a nucleic acid encoding a S1 polypeptide of said SARS-CoV-2 or a sequence having at least 95% identity thereto operably linked to the promoter and c) a nucleic acid molecule targeting expression of said polypeptide in the endoplasmic reticulum of said plant and selecting a plant expressing said plant levels of at least 50mg/kg of seed of said plant; or wherein said construct comprises two copies of said nucleic acid molecule encoding a S1 polypeptide; or wherein expression of said polypeptide in the endoplasmic reticulum of said plant and expressing said plant levels of at least 50mg/kg of seed of said plant. . Virtanen et al. teach using plant as a host to express spike protein of SARS-CoV-2 (paragraph [0236]. Virtanen et al. do not teach seed preferential promoter, or using leader sequence targeting expression in ER or expressing said plant levels of at least 1mg/kg of seed of said plant or two copies of S1 encoding sequence. Virtanen et al. do not teach a construct comprising a sequence that is with 95% homology to SEQ ID NO:1. Howard et al. a method of expressing spike protein of TGEV under seed specific promoter (Claims 3 and 9). Conrad et al. teach expression of heterologous protein in plant using seed specific promoter with ER retention signal, KDEL (claim 1). Hauser et al. teach spike protein that is 98% homology to SEQ ID NO:17 (alignment below). Given the importance to obtained spike protein of SARS-CoV-2 expressed from plant host, would have been obvious for skilled in the art to adopt expression system of Conrad which comprises both seed preferential promoter and leader sequence targeting expression in ER with reasonable expectation for success given the teaching of Howard that spike protein can be produced in plant seed using seed specific promoter. Although the combined teaching does not teach a construct comprising a sequence that is with 95%/98%/99% homology to SEQ ID NO:1, such construct is considered as an obvious design choice as skilled in the art can readily use different codon usage to design a nucleotide sequence that is at least 95%/98%/99% to SEQ ID NO:1 encoding the spike protein of Hauser et al. Although combined teachings do not teach expressing said plant levels of at least 10mg/kg or 50 mg/kg of seed of said plant, such feature would have been obviously exhibited by the modified method Although combined teachings do not teach two copies of S1 encoding sequence, such limitation is merely considered as a design choice. Although the combined teaching does not teach spike protein that is 98% homology to SEQ ID NO:17, such protein is considered obvious design choice given that homology could be further improved by conserved amino acid substitution. Applicants traverse in the paper filed 4/17/2026. Applicants’ arguments have been fully considered but were not found persuasive. Applicants argue that the combined teachings may, in some case, result in seed having at least 50 mg of S1 polypeptide per kg of seed, but the result is not with certainty (response, pages 7-9). The Office contends that the modified method of combined teachings use the same promoter to express the same gene as claimed method, therefore, the expression level of 50 mg/kg are considered obvious results. Further, there is no requirement for 100% of the modified plant of combined teaching to have 50 mg/kg of S1 polypeptide expressed. The variance of the expression level is likely due to the location effect of the transgene not from the structure of the transgene of combined teaching itself. RESULT 16 BJU96677 ID BJU96677 standard; protein; 1269 AA. XX AC BJU96677; XX DT 30-SEP-2021 (first entry) XX DE MARV GPS-truncated-S-GPTM sequence, SEQ ID 113. XX KW Glycoprotein; coronavirus infection; immune stimulation; KW prophylactic to disease; respiratory-gen.; vaccine, antiviral; virucide. XX OS Marburg marburgvirus. OS Synthetic. XX CC PN WO2021163622-A1. XX CC PD 19-AUG-2021. XX CC PF 12-FEB-2021; 2021WO-US018033. XX PR 14-FEB-2020; 2020US-0976913P. PR 16-FEB-2020; 2020US-0977402P. PR 20-MAR-2020; 2020US-0992710P. PR 18-MAY-2020; 2020US-0026580P. XX CC PA (GEOV-) GEOVAX INC. XX CC PI Hauser MJ, Domi A, Guirakhoo F; XX DR WPI; 2021-95768R/072. XX CC PT New recombinant modified vaccinia Ankara viral vector useful for reducing CC PT or preventing severe acute respiratory syndrome-coronavirus 2 infection CC PT in human, comprises heterologous nucleic acid sequence encoding spike, CC PT membrane, and envelope proteins linked to promoter with systems. XX CC PS Disclosure; SEQ ID NO 113; 392pp; English. XX CC The present invention relates to a novel recombinant modified vaccinia CC Ankara viral vector, useful for reducing or preventing severe acute CC respiratory syndrome-coronavirus 2 infection in human. The invention CC further relates to a vaccine composition for reducing or preventing a CC SARS-CoV2 infection in human. The rMVA viral vector is useful for CC reducing or preventing SARS-CoV2 infection. XX SQ Sequence 1269 AA; Query Match 97.5%; Score 3577; Length 1269; Best Local Similarity 98.0%; Matches 671; Conservative 4; Mismatches 6; Indels 4; Gaps 1; Qy 7 SLSLFLVLLGLSAS----LASGVQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFF 62 :| :||||| | :| | : ||||||||||||||||||||||||||||||||||||| Db 18 TLFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFF 77 Qy 63 SNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLI 122 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 78 SNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLI 137 Qy 123 VNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDL 182 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 138 VNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDL 197 Qy 183 EGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQ 242 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 198 EGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQ 257 Qy 243 TLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSET 302 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 258 TLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSET 317 Qy 303 KCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRIS 362 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 318 KCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRIS 377 Qy 363 NCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIA 422 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 378 NCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIA 437 Qy 423 DYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTP 482 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 438 DYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTP 497 Qy 483 CNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCV 542 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 498 CNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCV 557 Qy 543 NFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVIT 602 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 558 NFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVIT 617 Qy 603 PGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNS 662 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 618 PGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNS 677 Qy 663 YECDIPIGAGICASYQTQTNSPRRA 687 ||||||||||||||||||||||||| Db 678 YECDIPIGAGICASYQTQTNSPRRA 702 . 4. Claim(s) 21, 23, 26, 31, 34, 36-38 and 40-41 remain rejected under 35 U.S.C. 103 as being unpatentable over Virtanen et al. (WO 2021/2113311) in view of Howard et al. (WO 97/10347) and Conrad et al. (CA2246242) as applied for claims 21, 23 and 40-41 further in view of Yang et al. (US Patent No. 11,020,474). Instant claims 21, 23 and 40-41 are discussed above. The teachings of Virtanen et al., Conrad et al., Howard et al. and Hauser et al. are discussed above. Claims 26, 31, 34 and 36-38 further contain limitations that a method for using purified SARS-CoV-2 spike protein as vaccine by combining with a recipient. The combined teachings do not teach using purified SARS-CoV-2 spike protein as vaccine by combining with a recipient. Howard et al. teach isolate the vaccine antigen from the plant (claim 29). Howard et al. teach a method to administer the immunogenic composition orally to an animal (claim 25). Yang et al. teach using SARS-CoV-2 spike protein as vaccine. Teach using SARS-CoV-2 spike protein carrier protein combined with spike protein (claims 1-7). It would have been obvious to use the SARS-CoV-2 spike protein isolated from the combined teaching of Virtanen et al., Conrad et al. and Howard et al. to further combine with carrier protein as taught by Yang et al. and administer the composition as a vaccine orally to animals given such combined method would prevent or reduce the disease caused by the virus. Although the combined teachings do not teach nasal administration, such limitation would be merely regarded as an obvious design choice for applying vaccine. Applicants traverse in the paper filed 4/17/2026. Applicants’ arguments have been fully considered but were not found persuasive. Applicants presented same argument as above. Therefore for the same reason the rejection is maintained. Conclusion No claim is allowable. Any inquiry concerning this communication or earlier communications from the examiner should be directed to LI ZHENG whose telephone number is (571)272-8031. The examiner can normally be reached Monday-Friday (9-5). Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, BRATISLAV STANKOVIC can be reached on 571-270-0305. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /LI ZHENG/Primary Examiner, Art Unit 1662
Read full office action

Prosecution Timeline

Show 3 earlier events
Jun 17, 2025
Response Filed
Aug 13, 2025
Non-Final Rejection mailed — §103
Nov 19, 2025
Response Filed
Feb 17, 2026
Final Rejection mailed — §103
Apr 17, 2026
Response after Non-Final Action
May 08, 2026
Request for Continued Examination
May 11, 2026
Response after Non-Final Action
Jun 23, 2026
Non-Final Rejection mailed — §103 (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12698507
METHODS AND COMPOSITIONS FOR CONFERRING AND/OR ENHANCING HERBICIDE TOLERANCE USING PROTOPORPHYRINOGEN IX OXIDASE OF VARIOUS CYANOBACTERIA OR VARIANT THEREOF
4y 8m to grant Granted Aug 04, 2026
Patent 12696863
PLANTS AND SEEDS OF CORN VARIETY CV991361
2y 7m to grant Granted Aug 04, 2026
Patent 12692507
GENE ZmPLD3 FOR INDUCING MAIZE MATERNAL HAPLOID PRODUCTION AND ITS APPLICATION THEREOF
4y 4m to grant Granted Jul 28, 2026
Patent 12690533
CHLOROSIS RESISTANT CYTOPLASMIC MALE STERILE BRASSICA PLANTS
3y 1m to grant Granted Jul 28, 2026
Patent 12690542
SOYBEAN CULTIVAR 25120839
2y 6m to grant Granted Jul 28, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

Strategy Recommendation AI-generated — please review before filing

Get a prosecution strategy drawn from examiner precedents, rejection analysis, and claim mapping.
Typically takes 5-10 seconds — AI-generated, attorney review required before filing

Prosecution Projections

4-5
Expected OA Rounds
84%
Grant Probability
96%
With Interview (+12.8%)
2y 6m (~0m remaining)
Median Time to Grant
High
PTA Risk
Based on 1276 resolved cases by this examiner. Grant probability derived from career allowance rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month