Prosecution Insights
Last updated: April 19, 2026
Application No. 17/815,539

MICROORGANISMS SYNTHESIZING ANTI-INFLAMMATORY MOLECULES

Non-Final OA §103§112
Filed
Jul 27, 2022
Examiner
SINGH, SATYENDRA K
Art Unit
1657
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
Enbiosis Biotechnology Limited
OA Round
1 (Non-Final)
61%
Grant Probability
Moderate
1-2
OA Rounds
3y 6m
To Grant
99%
With Interview

Examiner Intelligence

Grants 61% of resolved cases
61%
Career Allow Rate
391 granted / 643 resolved
+0.8% vs TC avg
Strong +66% interview lift
Without
With
+66.4%
Interview Lift
resolved cases with interview
Typical timeline
3y 6m
Avg Prosecution
37 currently pending
Career history
680
Total Applications
across all art units

Statute-Specific Performance

§101
4.8%
-35.2% vs TC avg
§103
35.4%
-4.6% vs TC avg
§102
14.6%
-25.4% vs TC avg
§112
26.8%
-13.2% vs TC avg
Black line = Tech Center average estimate • Based on career data from 643 resolved cases

Office Action

§103 §112
Notice of Pre-AIA or AIA Status The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . DETAILED ACTION Applicant’s response filed on 11/10/2025 is duly acknowledged. Claims 1-16, as currently amended/presented, are pending in this application. Priority This application claims foreign priority from an European application EP 22185858.2 filed on 07/19/2022. Information Disclosure Statement The listing of references in the specification is not a proper information disclosure statement. 37 CFR 1.98(b) requires a list of all patents, publications, or other information submitted for consideration by the Office, and MPEP § 609.04(a) states, "the list may not be incorporated into the specification but must be submitted in a separate paper." Therefore, unless the references have been cited by the examiner on form PTO-892, they have not been considered. Election/Restrictions Applicant’s election without traverse of the species “SEQ ID NO: 7” (from claim 7 reciting different species of genes encoding “polysaccharide A biosynthesis pathway”) in the reply filed on 11/10/2025 (see REM, p. 5) is acknowledged. Claim Terms It is to be noted that the terms “microorganism” or “microbial anti-inflammatory molecule (MAM)” as recited in instant claim 1 have not been specifically defined by applicants in the instant disclosure of record (see for instance, specification, p. 4, 2nd paragraph; p. 6, section “Microorganism”; p. 2, last paragraph). For this office action, plain meaning of the terms have been used for prior art purposes. It is also to be noted that no such “microorganism comprising a microbial anti-inflammatory molecule (MAM) gene and one or more gene(s) encoding polysaccharide A biosynthesis pathway” (genetically engineered, or otherwise) has been exemplified and/or disclosed by the applicants in the instant disclosure of record (see specification, conceptual disclosure on p. 10-11, “Example”, in particular). Claim Objections Claim 1 is objected to because of the following informalities: claim 1 recites abbreviated limitations “UpaY” and “UpaZ” in line 5. Applicants are advised to recite the full names of the gene(s) at least the first time they appear in a claim set. The abbreviated and italicized form of the gene can be recited in a parenthesis along with the full name, at least the first time it appears in a claim set. It is noted that instant specification also does not provide the full names of aforementioned genes “UpaY” and “UpaZ” (see specification, p. 4, line 3, for instance), which should be amended accordingly to provide the full names of the genes on record. Appropriate correction is required. Claim Rejections - 35 USC § 112 The following is a quotation of 35 U.S.C. 112(b): (b) CONCLUSION.—The specification shall conclude with one or more claims particularly pointing out and distinctly claiming the subject matter which the inventor or a joint inventor regards as the invention. The following is a quotation of 35 U.S.C. 112 (pre-AIA ), second paragraph: The specification shall conclude with one or more claims particularly pointing out and distinctly claiming the subject matter which the applicant regards as his invention. Claims 1-16 (as presented) are rejected under 35 U.S.C. 112(b) or 35 U.S.C. 112 (pre-AIA ), second paragraph, as being indefinite for failing to particularly point out and distinctly claim the subject matter which the inventor or a joint inventor (or for applications subject to pre-AIA 35 U.S.C. 112, the applicant), regards as the invention. Claim 1 recites the following: PNG media_image1.png 281 712 media_image1.png Greyscale Claim 1 recites limitations “one or more gene(s) encoding polysaccharide A biosynthesis pathway” (lines 2-3), and also requires the limitations of “wherein one or more gene(s) encoding a metabolic pathway is selected from the group consisting of one or more of the genes encoding UpaY…protein” (lines 4-7), which is ambiguous and confusing because it is unclear if the two sets of limitations (i.e. for “one or more gene(s) encoding polysaccharide A biosynthesis pathway” and “one or more gene(s) encoding a metabolic pathway”) refer to the same “one or more gene(s)” that are recited for “metabolic pathway” are they refer to distinct “one or more genes”. Since the term “metabolic pathway” would normally (to an artisan of ordinary skill in the art) encompass the “biosynthesis pathways” as well as biodegradation or catabolic pathways (i.e. both narrower and broader limitations in the same claim), it is unclear if the later recitations of the genes are just exemplary, or are in fact required by the claimed product. The disclosure of record (see instant specification, p. 3, last full paragraph), and dependent claims 2-16, do not specifically provide clarification regarding the two different sets of limitations for “one or more gene(s)” as currently required in instant claim 1. The recitation as currently presented renders the claimed invention indefinite because the metes and bounds of the claimed product does not seem to be properly defined. Appropriate correction is required. Claim Rejections - 35 USC § 103 In the event the determination of the status of the application as subject to AIA 35 U.S.C. 102 and 103 (or as subject to pre-AIA 35 U.S.C. 102 and 103) is incorrect, any correction of the statutory basis (i.e., changing from AIA to pre-AIA ) for the rejection will not be considered a new ground of rejection if the prior art relied upon, and the rationale supporting the rejection, would be the same under either status. The following is a quotation of 35 U.S.C. 103 which forms the basis for all obviousness rejections set forth in this Office action: A patent for a claimed invention may not be obtained, notwithstanding that the claimed invention is not identically disclosed as set forth in section 102, if the differences between the claimed invention and the prior art are such that the claimed invention as a whole would have been obvious before the effective filing date of the claimed invention to a person having ordinary skill in the art to which the claimed invention pertains. Patentability shall not be negated by the manner in which the invention was made. The factual inquiries for establishing a background for determining obviousness under 35 U.S.C. 103 are summarized as follows: 1. Determining the scope and contents of the prior art. 2. Ascertaining the differences between the prior art and the claims at issue. 3. Resolving the level of ordinary skill in the pertinent art. 4. Considering objective evidence present in the application indicating obviousness or nonobviousness. Claims 1-16 (as presented) are rejected under 35 U.S.C. 103 as being unpatentable over Langella et al (WO 2017/129515 A1; FOR cited as ref. [N] on PTO 892 form) taken with Quevrain et al (2016; NPL cited as ref. [U] on PTO 892 form), Mazmanian et al (2008; NPL cited as ref. [V] on PTO 892 form) and Coyne et al (2001; NPL cited as ref. [W] on PTO 892 form). Claim 1 is directed to “A microorganism comprising a microbial anti-inflammatory molecule (MAM) gene and one or more gene(s) encoding polysaccharide A biosynthesis pathway for use in the prevention and/or treatment of Inflammatory Bowel Diseases, wherein one or more gene(s) encoding Claims 6 and 7 have been reproduced as follows: PNG media_image2.png 267 695 media_image2.png Greyscale See also limitations of dependent claims 2-5 and 8-16, as currently presented. Applicant’s elected species from instant claim 7 is SEQ ID NO: 7. Langella et al (2017) disclose a Faecalibacterium prausnitzi strain (deposited as accession number CNCM I-4573) intended for the treatment and prevention of Gastrointestinal (GI) tract inflammation and related disorders such as inflammatory bowel disease in an individual in need thereof (see title, Abstract, “Summary of the invention”), wherein said bacterial strain (isolated from healthy male patient; see p. 9, line 5) was unexpectedly demonstrated to reduce GI inflammation, both in vitro as well as in vivo conditions tested, by decreasing pro-inflammatory cytokines and increasing the production of anti-inflammatory cytokine molecules such as interleukin-10 (IL-10; see p. 2, lines 11-21, for instance); wherein said strain is a probiotic strain (see p. 2, lines 28-29), and compositions comprising said strain (regarding instant claims 1, 8-16) can be prepared as pharmaceutical or nutraceutical products for oral administration in suitable medium/carriers, and used for treatment of inflammatory bowel disease (IBD), including Crohn’s disease and ulcerative colitis in patients in need thereof (see p. 3, lines 1-5), for instance in the form of food or beverage compositions including fermented dairy products such as yogurt (see p. 3, lines 6-18; p. 6-7, section “Compositions”; and Claims on p. 18-19, for instance), powdered, or solid dosage forms including various pharmaceutical dosage forms such as tablets, capsules, granules, etc. Langella et al. does not disclose a microorganism comprising a gene expressing a “microbial anti-inflammatory molecule (MAM)” in combination with one or more genes encoding “polysaccharide A” biosynthetic pathway as recited in instant claim 1 (and genetically engineered bacteria as in instant claims 2-4). Quevrain et al (2016), while teaching the identification and characterization of an anti-inflammatory protein of 15 KDa isolated from commensal bacterium, Faecalibacterium prausnitzii (see Title, Abstract, p. 15 “Summary Box”, and Table 1 on p. 26, disclosed as “Protein ZP 05614546.1”) designated as “Microbial Anti-inflammatory Molecule (MAM)”, disclose genetically modified bacteria comprising gene encoding said MAM (which was PCR amplified from genomic DNA of F. prausnitzii), including Escherichia coli as expression host (see p. 4, section “Production of MAM protein in a bacterial heterologous system”), and Lactococcus lactis as a delivery vector for in vivo experiments (see p.5, section “In vivo assays for anti-inflammatory effect of MAM protein”; p. 24, Fig. 9); wherein the MAM protein ZP 05614546.1, is 100% identical to applicant’s disclosure for 15 KDa MAM protein of amino acid sequence of SEQ ID NO: 2 (that is derived from the nucleic acid sequence SEQ ID NO: 1 in instant claim 6; see instant Specification, p. 3, lines 26-29; and p. 6, section “Genes”, in particular) derived from the same commensal bacteria species F. prausnitzii as shown below (Qy is SEQ ID NO: 2 of the instant application; Db is MAM Protein ZP 05614546.1 disclosed by Quevrain et al, p. 26, Table 1): AMINO ACID SEQUENCE ALIGNMENT: RESULT 1 AASEQ2_01232026_082104 Query Match 100.0%; Score 699; DB 1; Length 135; Best Local Similarity 100.0%; Matches 135; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 MMMPANYSVIAENEMTYVNGGANFIDAIGAVTAPIWTLDNVKTFNTNIVTLVGNTFLQST 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MMMPANYSVIAENEMTYVNGGANFIDAIGAVTAPIWTLDNVKTFNTNIVTLVGNTFLQST 60 Qy 61 INRTIGVLFSGNTTWKEVGNIGKNLFGTNVKGNPIEKNNFGDYAMNALGIAAAVYNLGVA 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 INRTIGVLFSGNTTWKEVGNIGKNLFGTNVKGNPIEKNNFGDYAMNALGIAAAVYNLGVA 120 Qy 121 PTKNTVKETEVKFTV 135 ||||||||||||||| Db 121 PTKNTVKETEVKFTV 135 Quevrain et al disclose the fact that “F. prausnitzii is a major inducer of Clostridium-specific IL-10-secreting regulatory T cell subset present in the human colonic lamina propria and blood” (see p. 11, 1st paragraph; and cited references therein), which was one of the art-known anti-inflammatory cytokines (among other factors) helping to restore, maintain and shape gut barrier immune function. Thus, genetically engineered bacteria (E. coli as well as L. lactis) comprising a “microbial anti-inflammatory molecule (MAM) gene” have been nevertheless fully disclosed by Quevrain et al. Quevrain et al. do not disclose genetically engineered bacteria that also comprise (i.e. in addition to MAM protein gene from F. prausnitzii) one or more biosynthesis genes for “polysaccharide A” (regarding instant claim 1), they do disclose the art-known fact that “[O]ther species-specific bacterial molecules, such as B. fragilis-derived polysaccharide A, have previously been demonstrated to have immunomodulatory functions…” (see p. 11, 1st paragraph; and cited references therein), eluding to complex interplay involving different species of gut commensal bacteria and their various metabolic products that help limit the inflammatory processes in the GI tract. Mazmanian et al (2008) disclose the microbial symbiosis factor “polysaccharide A” (PSA; see Title, Abstract on p. 620) that acts as a gut immunomodulatory molecule and prevents intestinal inflammatory disease; wherein they disclose that “…the prominent human symbiont Bacteroides fragilis strain 9343 protects animals from experimental colitis induced by Helicobacter hepaticus, a commensal bacterium with pathogenic potential. This beneficial activity requires a single microbial molecule (polysaccharide A, PSA)…. Furthermore, PSA protects from inflammatory disease through a functional requirement for interleukin-10-producing CD41 T cells” (see Abstract on p. 620); wherein “animals harbouring B. fragilis not expressing PSA, H. hepaticus colonization leads to disease and pro-inflammatory cytokine production in colonic tissues”, directly demonstrating the beneficial effects of a commensal bacteria producing PSA for gut inflammatory disorders including IBD (see p. 620, right column, 2nd paragraph; and p. 621, section “Protection from colitis by B. fragilis”, for instance); wherein they experimentally demonstrated that IL-10 is required for PSA-mediated protection from intestinal inflammation and experimental colitis (see p. 624, Figure 5, for instance). Thus, Mazmanian et al disclose the fact that B. fragilis naturally expresses an anti-inflammatory PSA molecule, and B. fragilis strain that does not express PSA (such as DPSA), does not show the beneficial effects in the gut of animals having inflammatory disease. Although Mazmanian et al. do not explicitly disclose the genes encoding “polysaccharide A” biosynthesis pathway, such would have been obvious to an artisan of ordinary skill in the art because Coyne et al (2001) had already disclosed the locus of the chromosomal genes from B. fragilis strain 9343 for polysaccharide biosynthesis (see Coyne et al, Title, Abstract on p. 4342; Table 1 on p. 4343, section “Creation of deletion mutant 9343DPSA”; Figure 1; and p. 4345, entire section “Genetic complement of the PS A locus”, for instance) that comprises such biosynthesis genes including gene encoding PSA (that is common to all species of B. fragilis, and that has been disclosed as expressing a “putative flippase” with Protein ID of “AAK68914.1”, and has 100% identity to nucleic acid sequence of SEQ ID NO: 7, applicant’s elected species for a gene from instant claim 7; see below for the nucleic acid sequence homology search results), and the fact that they had provided all the information for construction and genetic manipulations for making DPSA chromosomal mutant employed in the cited reference of Mazmanian et al, as discussed above (see Mazmanian et al, P. 623, section “IL-10-producing T cells suppress colitis”; and p. 624, section “Methods Summary”, for instance). The sequence homology for SEQ ID NO: 7 is as follows: SEQ ID NO: 7 (Query: Instant claim 7): RESULT 1 (GenEmbl database) AF189282 LOCUS AF189282 16792 bp DNA linear BCT 23-JUL-2016 DEFINITION Bacteroides fragilis NCTC 9343 capsular polysaccharide A gene locus, partial sequence. ACCESSION AF189282 VERSION AF189282.1 KEYWORDS . SOURCE Bacteroides fragilis NCTC 9343 ORGANISM Bacteroides fragilis NCTC 9343 Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides. REFERENCE 1 (bases 1 to 16792) AUTHORS Coyne,M.J., Tzianabos,A.O., Mallory,B.C., Carey,V.J., Kasper,D.L. and Comstock,L.E. TITLE Polysaccharide biosynthesis locus required for virulence of Bacteroides fragilis JOURNAL Infect. Immun. 69 (7), 4342-4350 (2001) PUBMED 11401972 REFERENCE 2 (bases 1 to 16792) AUTHORS Coyne,M.J. Jr. and Comstock,L.E. TITLE Direct Submission JOURNAL Submitted (23-SEP-1999) Channing Laboratory, Brigham & Women's Hospital/Harvard Medical School, 181 Longwood Avenue, Boston, MA 02115-5821, USA FEATURES Location/Qualifiers source 1..16792 /organism="Bacteroides fragilis NCTC 9343" /mol_type="genomic DNA" /strain="NCTC 9343" /type_material="type strain of Bacteroides fragilis" /db_xref="taxon:272559" /note="polysaccharide genes named in accordance with the Bacterial Polysaccharide Gene Nomenclature scheme (Reeves,P.R., et al. Trends Microbiol. 1996, 4(12):495-503.)" CDS 98..1102 /note="ORF1" /codon_start=1 /transl_table=11 /product="unknown" /protein_id="AAK68911.1" /translation="MNLKFLYLLLLISALCISCSKDEEPSDKGSTSPQEPVYTTFTDA GEVVVPGVLPANFTPRSVRVKGDTLFVANTNAADRSVLLLNLTTGELIGRIDSWVRKG VKETFNAEIGDMAVSDRYIFVGMYNSRINIFDRRTLQFVNAIGRSDGKWGDDIYSMTH CYGLRECGERLMVRDKNTIRGYWIYEAVTEPAFRVPWIGKVKVPEGVGYDYQARIHGM AEYDGRMYLTDWYNKSVQVFTPSKMEIVFGEETHITSDAVFKYDDIQPLGLLAYGGEL LMSVQKSGKIQRYDPETGDLLGVLAEFPGKEIGRMEIARGMLYYIDLKAGKLMKAKGE " gene 2425..2943 /gene="upaY" CDS 2425..2943 /gene="upaY" /codon_start=1 /transl_table=11 /product="UpaY" /protein_id="AAK68912.1" /translation="MSEQQEYWFAARTKKDQEFSVRNALEKLGIEYFLPTQFVIRQLK YRRRRVEVPVIKNLIFVRTTKDRAWSITKDDHVPLYYMKDLYTHTLLIVPNKQMEDFK FVMDLAPENVTFDDLPLTVGTKVQVVKGEFCGIEGELSSLANRTYVVIRIHGVLSASV KVPKSYLRILSA" gene 2963..3436 /gene="upaZ" CDS 2963..3436 /gene="upaZ" /codon_start=1 /transl_table=11 /product="UpaZ" /protein_id="AAK68913.1" /translation="MNQVQNLQHIARELLYLGMDGSPIYTDHFRQLNTEVFRLSEALF SMKGATSEEEAAICLSLLMGYNATIYNDGDKESKIQSILDRSFAVLDHLPASLLKCQL LTYCYGEVFEEDLAQEAHQIMDSWKNRALSEEELEVMETLQTMEDNRYPCSEVED" gene 3504..4952 /gene="wzx" CDS 3504..4952 /gene="wzx" /codon_start=1 /transl_table=11 /product="putative flippase" /protein_id="AAK68914.1" /translation="MGQSIKNNFLLNLSTTITGLLFPLITFPYASRILMADGIGQVQF FQSIIDYVSLCTALGIPLYAVREIARIRDNKELRSRTTIEILLLHAILTLVGYIVVFI LAKTVAKIEIDASLFFLLSTTLFFNTIGVAWFYQAIEDFKYITLRSLFVRILSLVALF IFVKTKQDLFYYAGILVIGTVGNNIFNFFRLRKYIKLSKGEFKRLNLLRHLIPALKIF ILNLVISIYVNLDSVMLGFLKNEESVGYYAAATRLTKAILGIVSSLGAVLLPRFSNMI TNGQKEEFQLLANKAASFTIALSLPMSVGLIFMAAPIIHIFCGNGFEPSILTLKLVAP IVLFIGLSGIIGMQILYPQGREKYVIISTMVGACINLLINYLLIPQYGQYGAALGTVI AEFMVTVIMILLGRKYLPINILSKQNLHYLIGSIVISILLAFLFVFPLHEVNYLLIGI LLSVIVYYAYLLMIKDTLALQLKKLLLSIFKQ" gene 4949..6043 /gene="wcfM" CDS 4949..6043 /gene="wcfM" /codon_start=1 /transl_table=11 /product="putative galactopyranose mutase" /protein_id="AAK68915.1" /translation="MKKKYDYLIVGAGLYGSVFAYKAQRNGKKCLLIDKRPHNGGNIY CENIEGINVHKYGAHIFHTSNKEVWDFVNAIVEFNRYTNSPIANYKGKLYNLPFNMNT FYALWGTKTPEEAKMKIEEQRREAGILTPKNLEEQAISLVGKDIYEILIKGYTEKQWG RKATELPAFIIKRLPVRFTFDNNYFNDKYQGIPVGGYNKLINGLLDGIEVRTNTDFFQ NKEYFKGLADKILFTGKIDEYYNYQFGRLEYRTVEFETQVLDCENYQGNAVVNYTERE VPYTRIIEHKHFEFGTQPKTVISKEYSSEWKDGSEPFYPVNDERNNSLYLEYKKLVDR EKNVLFGGRLAEYKYYDMNVIVEKVINSDL" gene 6040..6915 /gene="wcfN" CDS 6040..6915 /gene="wcfN" /codon_start=1 /transl_table=11 /product="putative glycosyltransferase" /protein_id="AAK68916.1" /translation="MKIFAVVVTYNRLALLKKVIDLLKRQTRQLDSIVIVNNGSTDGT KEWLEQEKNITLINQSNSGGAGGFETGVKYAYENEADWIWMMDDDVFPNIDCLEKLLG WTSISQCIQPRRYYSDDVEVNFEQWLDPITYSKFGYWQEKSFNNGKKFCAINVGCFEG MFVSKSIVNKIGFPDKRFFIAEDDTIYGFAASFYTNVILVSDAIMVRARRSSDRSVSP MYTYYACRNFHLVYESLNLLLDKKNRFLYIKYIYQFVHQIYLSIFLYDNKMKHLISVF RGFYDCFRKKNGATY" gene 6920..8224 /gene="wzy" CDS 6920..8224 /gene="wzy" /codon_start=1 /transl_table=11 /product="putative polymerase" /protein_id="AAK68917.1" /translation="MTSTSFFIIKAISFIVFVYNLASSDWSNLSRVLLFIISFFVFLL VTNVYQRKVKIVTLGYLVYFFLAFLAQNVGPYAIIYNSHIQNLIQRFPNICVPNDHYT LYFLIFIFVSTVIYIYLLCIDKISIEQKVWVYMPTRQEARKIMMAFFIILLPIWILGN RSYATILVPFTSYFIISIWKYPFTRKIVVFIIGFIASVLILISQLFSRFIFVQYVFPF ILIWFLNNGLLFSRKEKISYKVIGFFLLFCSLAILYGIISEMMKLNANFDGNYTFNDM FEVLSEPQLLQNWLSRQTYRIFDIWSHLGGNIIDYIDQKGYLWGITYVKSFAPILGFD YVSLPLISANMIGADYAQPGLVAEGYANWGIYGAIINMIFVFFVAELLFDYFLRKQST LNLLLYIGTFSQVLLDGGTINSIIFMSIFCFLTCLFNAKIKF" gene 8235..9278 /gene="wcfO" CDS 8235..9278 /gene="wcfO" /codon_start=1 /transl_table=11 /product="putative glycosyltransferase" /protein_id="AAK68918.1" /translation="MRKILLTYGDIKTINIGDYIQSIAAKQFFDDDNYIFFNRDELKL YKGEPAKVIMNAWMTYKPYNWPPSSQVYPLFVALHINSSAESRFLSHDSIKYLKKYEP IGCRDYHTMNILKGKGVNAYFSGCLTTTLGKTYKYNGKREGIYIVDPLSYMPNGNNFF EIMKAVVQTVFYMKPVLKILRNYKKNNRFTINISKVGIGRLLLITKSYLLLRKLVVPD VLYNAIFITQFNMSNEYSSESERFARADELLTKMASAQYVITSRIHCALPCLGFETPV VYIRNLSESKKSTCRLGGLESLFNVITVKGENVTSNFFDGLFKRDSSFKNKIDFVEYR DRLINICNKFMMS" gene 9275..10411 /gene="wcfP" CDS 9275..10411 /gene="wcfP" /codon_start=1 /transl_table=11 /product="putative glycosyltransferase" /protein_id="AAK68919.1" /translation="MRDGKPIEILHIVGTRPVGGIGALLKNINTSIDLNKFHFTYVFS ADSNIGDFDNYVRKLGSDIVVFPSYHLKYLFLYLKVIFCFYKRNAKKYDIIHVHSANT GVLDLLFAKIYGIRIRILHSHSTKYSSKKIRSIRNYFLQFPTIYLANTYFACGYKAAE FLFGKKRLEKVYIIHNAIFSKKFIYNATVRERVRVELKIENDCLLLGHIGNFTKEKNH GFLIDILEELLNINDNVKLLLVGDGQLRSEIEEKVKLKRLQKYVCFLGRRTDISELLQ AMDFLIFPSFFEGLPVTLIEAQASGLRCVVSDRITLETKITNNISYLNLNRDPSTWAE VVWKLFEDKTFIRKDTSKEICESGYDIHLESEYLERIYLNLLHK" gene 10408..11214 /gene="wcfQ" CDS 10408..11214 /gene="wcfQ" /codon_start=1 /transl_table=11 /product="putative glycosyltransferase" /protein_id="AAK68920.1" /translation="MKLAVISSIYKNDSLSKIKQSLQSLLNQENVTCDIYLYCDGPVS IDIVHFLDSFDQNSLYIFKQEQNRGLAHALNELLNIVLTKEYEYIARMDADDISMPER FVKQIAFMNSHPDIDCLGTWAIEIDDDGKEYFRKKMPITHEECLELFKKRDCMIHPTV MFRRSYFEKAGLYPEDTYFGEDTMMWAKGFKSGCKFANVPEYLFKFRLDSNFFERRRG WKHAKSIYTLRHRVNRMLGFGWKEDCYALLYAMAKLMPKSILDIIYKTVR" gene 11243..12466 /gene="wcfR" CDS 11243..12466 /gene="wcfR" /codon_start=1 /transl_table=11 /product="putative amino sugar synthetase" /protein_id="AAK68921.1" /translation="MKIPFSPPYIDEAVINEVVDSLRSGWITSGPKVKALEEEIKSFS GAKEVLCVNSWTSGAIMMLRWLGVKEGDEVIVPAYTYSATALAVLHAGAKPVMVDSGT DFNISVEAVRKAITPKTKAIIPVDIAGFPCDYERIMALVQEPEMVKLFRSESPVQEKL GRILVMNDAAHSLGARYSSRQRTGCETDVAIFSLHAVKNVTTAEGGAICLNLPKPFDN TELYKELRMTSLNCQTKDAFSKSKAGGWRYDIVGFGMKINMADVNAAIGLAQIREYPE LLKERKRVFNAYSDAFSACDWAIVPPSVDGEKESSYHIYALRIKDFTEEQRDRMIDEI AKSEVAVNVHFIPMPMLSFFKSMGYDIKDYPQAYQNFKSEISLPIYPQLDSEKLNFII ETVKAAYATVIAENR" gene 12489..13085 /gene="wcfS" CDS 12489..13085 /gene="wcfS" /note="may utilize an alternative start codon" /codon_start=1 /transl_table=11 /product="putative undecaprenyl-phosphate galactose phosphotransferase" Query Match 100.0%; Score 1449; Length 16792; Best Local Similarity 100.0%; Matches 1449; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 ATGGGACAATCAATAAAGAATAACTTCCTACTGAATCTAAGTACTACAATTACTGGGCTA 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3504 ATGGGACAATCAATAAAGAATAACTTCCTACTGAATCTAAGTACTACAATTACTGGGCTA 3563 Qy 61 TTATTTCCACTAATAACTTTTCCCTATGCTTCACGTATATTAATGGCAGATGGTATAGGG 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3564 TTATTTCCACTAATAACTTTTCCCTATGCTTCACGTATATTAATGGCAGATGGTATAGGG 3623 Qy 121 CAAGTACAATTTTTCCAATCCATAATTGACTATGTCTCTCTTTGTACTGCTTTGGGAATC 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3624 CAAGTACAATTTTTCCAATCCATAATTGACTATGTCTCTCTTTGTACTGCTTTGGGAATC 3683 Qy 181 CCTTTGTATGCCGTTAGAGAAATTGCAAGAATAAGGGATAATAAGGAATTAAGAAGTAGA 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3684 CCTTTGTATGCCGTTAGAGAAATTGCAAGAATAAGGGATAATAAGGAATTAAGAAGTAGA 3743 Qy 241 ACAACAATCGAAATACTATTGCTTCATGCTATTTTGACTTTAGTCGGATATATAGTTGTT 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3744 ACAACAATCGAAATACTATTGCTTCATGCTATTTTGACTTTAGTCGGATATATAGTTGTT 3803 Qy 301 TTTATACTTGCTAAGACCGTTGCCAAAATAGAAATAGATGCTTCTCTTTTCTTTTTGTTA 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3804 TTTATACTTGCTAAGACCGTTGCCAAAATAGAAATAGATGCTTCTCTTTTCTTTTTGTTA 3863 Qy 361 AGTACAACTTTATTTTTTAACACGATAGGAGTTGCATGGTTTTATCAGGCAATTGAAGAT 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3864 AGTACAACTTTATTTTTTAACACGATAGGAGTTGCATGGTTTTATCAGGCAATTGAAGAT 3923 Qy 421 TTTAAATACATAACTTTACGTTCCTTATTTGTAAGGATACTATCTTTAGTGGCCTTATTT 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3924 TTTAAATACATAACTTTACGTTCCTTATTTGTAAGGATACTATCTTTAGTGGCCTTATTT 3983 Qy 481 ATCTTTGTTAAGACCAAGCAAGATCTGTTTTATTATGCTGGAATATTAGTTATTGGTACT 540 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3984 ATCTTTGTTAAGACCAAGCAAGATCTGTTTTATTATGCTGGAATATTAGTTATTGGTACT 4043 Qy 541 GTTGGTAATAATATATTTAATTTTTTTCGATTACGTAAATATATAAAACTTAGTAAAGGC 600 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 4044 GTTGGTAATAATATATTTAATTTTTTTCGATTACGTAAATATATAAAACTTAGTAAAGGC 4103 Qy 601 GAATTTAAGCGTTTGAATCTGTTGAGGCATTTAATACCTGCACTTAAAATTTTTATATTA 660 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 4104 GAATTTAAGCGTTTGAATCTGTTGAGGCATTTAATACCTGCACTTAAAATTTTTATATTA 4163 Qy 661 AATTTGGTTATAAGTATTTATGTGAATCTTGATTCTGTGATGCTTGGATTTCTTAAAAAT 720 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 4164 AATTTGGTTATAAGTATTTATGTGAATCTTGATTCTGTGATGCTTGGATTTCTTAAAAAT 4223 Qy 721 GAAGAATCAGTTGGTTATTATGCTGCTGCTACTCGACTTACAAAAGCTATTTTGGGTATA 780 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 4224 GAAGAATCAGTTGGTTATTATGCTGCTGCTACTCGACTTACAAAAGCTATTTTGGGTATA 4283 Qy 781 GTTTCTTCATTAGGAGCTGTTTTATTACCTCGTTTTAGTAATATGATAACTAATGGTCAA 840 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 4284 GTTTCTTCATTAGGAGCTGTTTTATTACCTCGTTTTAGTAATATGATAACTAATGGTCAA 4343 Qy 841 AAAGAAGAATTCCAATTATTGGCAAATAAAGCTGCTAGTTTTACAATTGCTTTAAGTCTT 900 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 4344 AAAGAAGAATTCCAATTATTGGCAAATAAAGCTGCTAGTTTTACAATTGCTTTAAGTCTT 4403 Qy 901 CCTATGAGTGTGGGACTTATTTTTATGGCAGCACCTATTATACATATTTTTTGTGGAAAT 960 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 4404 CCTATGAGTGTGGGACTTATTTTTATGGCAGCACCTATTATACATATTTTTTGTGGAAAT 4463 Qy 961 GGTTTTGAACCTTCTATTTTGACATTAAAATTAGTTGCACCTATTGTTTTATTTATTGGA 1020 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 4464 GGTTTTGAACCTTCTATTTTGACATTAAAATTAGTTGCACCTATTGTTTTATTTATTGGA 4523 Qy 1021 TTATCTGGAATTATTGGAATGCAAATATTGTATCCGCAAGGGAGAGAAAAGTACGTAATT 1080 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 4524 TTATCTGGAATTATTGGAATGCAAATATTGTATCCGCAAGGGAGAGAAAAGTACGTAATT 4583 Qy 1081 ATATCTACTATGGTAGGAGCATGTATAAATCTCCTTATAAACTATTTACTAATACCCCAA 1140 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 4584 ATATCTACTATGGTAGGAGCATGTATAAATCTCCTTATAAACTATTTACTAATACCCCAA 4643 Qy 1141 TATGGGCAGTATGGAGCGGCGCTTGGGACTGTTATCGCAGAATTTATGGTAACGGTTATA 1200 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 4644 TATGGGCAGTATGGAGCGGCGCTTGGGACTGTTATCGCAGAATTTATGGTAACGGTTATA 4703 Qy 1201 ATGATTTTGCTGGGAAGAAAATATTTACCTATAAATATTCTCTCCAAGCAGAATTTACAC 1260 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 4704 ATGATTTTGCTGGGAAGAAAATATTTACCTATAAATATTCTCTCCAAGCAGAATTTACAC 4763 Qy 1261 TATCTAATAGGTTCTATAGTGATATCTATTCTATTAGCTTTTTTGTTTGTCTTCCCTTTA 1320 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 4764 TATCTAATAGGTTCTATAGTGATATCTATTCTATTAGCTTTTTTGTTTGTCTTCCCTTTA 4823 Qy 1321 CATGAAGTAAATTATTTATTGATAGGTATACTGTTATCTGTTATTGTTTATTACGCATAT 1380 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 4824 CATGAAGTAAATTATTTATTGATAGGTATACTGTTATCTGTTATTGTTTATTACGCATAT 4883 Qy 1381 TTATTAATGATAAAAGATACCCTCGCATTACAACTAAAGAAATTATTACTTTCAATATTT 1440 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 4884 TTATTAATGATAAAAGATACCCTCGCATTACAACTAAAGAAATTATTACTTTCAATATTT 4943 Qy 1441 AAACAATGA 1449 ||||||||| Db 4944 AAACAATGA 4952 Although the focus of Coyne et al was for identifying the role of polysaccharide biosynthesis locus genes including PSA in relation to virulence of B. fragilis 9343 strain, they nevertheless disclose all the required details for an artisan in order to perform required genetic manipulations to identify, amplify, clone/transfer, and/or mutate such polysaccharide biosynthesis loci or genes in a desired bacteria. Thus, given the detailed disclosure for the roles of two different gut commensal bacteria-based anti-inflammatory molecules (MAM and polysaccharide A), as taught in the cited prior art references of Quevrain et al when taken with the disclosure from Mazmanian et al and Coyne et al, it would have been obvious to an artisan of ordinary skill in the art to modify the composition disclosed by Langella et al comprising commensal bacteria Faecalibacterium prausnitzii that are known to possess gene and express 15 KDa anti-inflammatory MAM protein (as explicitly taught by Quevrain et al) in combination with one or more polysaccharide A biosynthesis gene(s) such as a flippase (as specifically taught by Mazmanian et al when taken with Coyne et al, as discussed above) in order to enhance the efficacy of the compositions comprising commensal bacteria Faecalibacterium prausnitzii that can be employed for treatment and/or prevention of gut inflammation and related disorders including IBD, ulcerative colitis, et c., as already eluded and/or suggested by all the three cited prior art references of Langella et al taken with Quevrain et al and Mazmanian et al discussed above. Since, such genetic manipulation techniques for chromosomal as well as plasmid amplification/cloning, etc. were already known in the prior art as provided by the cited prior art of Coyne et al as discussed above, an artisan in the art would have had a reasonable expectation of success in modifying the desired commensal bacteria in order to create a genetically engineered variant that comprises a combination of both genes (i.e. encoding for MAM protein as well as polysaccharide A) that are disclosed in the prior art for their IL-10-based anti-inflammatory response in the gut of human individuals, or in patients having gut inflammation and/or related disorders such as IBD, Crohn’s disease, ulcerative colitis, etc. Since, Langella et al already disclose suitable compositions (such as food, beverage, pharmaceutical solid dosage forms, etc.; see detailed teachings above) comprising efficacious commensal probiotic bacteria F. prausnitzii strain that is used for increasing production of anti-inflammatory molecules of IL-10 in the gut, such modification of the strain providing combination of two different anti-inflammatory molecules would be expected to enhance the efficacy of treatment and/or prevention of gut inflammatory disorders in patients in need thereof, as already eluded and/or desired by the cited prior art of Langella et al. It is to be noted that instant claims are directed to a “microorganism” (instant claim 1) reciting specifically “bacteria, yeast or fungi” (see instant claims 2-4) produced by genetic engineering. However, the disclosure of record appears to be mainly conceptual, and fails to provide any such example(s) of the genetically engineered bacteria, yeast or fungi per se (see instant specification, p. 10-11, “Example”, for instance). Applicants are reminded that the scope of the showing must be commensurate with the scope of claims to consider evidence probative of unexpected results, for example. In re Dill, 202 USPQ 805 (CCPA, 1979), In re Lindner 173 USPQ 356 (CCPA 1972), In re Hyson, 172 USPQ 399 (CCPA 1972), In re Boesch, 205 USPQ 215, (CCPA 1980), In re Grasselli, 218 USPQ 769 (Fed. Cir. 1983), In re Clemens, 206 USPQ 289 (CCPA 1980). It should be clear that the probative value of the data provided on record (see instant claim 1, in particular) is not commensurate in scope with the degree of protection sought by the claim. Thus, the claim as a whole would have been prima facie obvious to a person of ordinary skill in the art before the effective filing date of the invention as claimed. As per MPEP 2111.01, during examination, the claims must be interpreted as broadly as their terms reasonably allow. In re American Academy of Science Tech Center, F.3d, 2004 WL 1067528 (Fed. Cir. May 13, 2004)(The USPTO uses a different standard for construing claims than that used by district courts; during examination the USPTO must give claims their broadest reasonable interpretation.). This means that the words of the claim must be given their plain meaning unless applicant has provided a clear definition in the specification. In re Zletz, 893 F.2d 319, 321, 13 USPQ2d 1320, 1322 (Fed. Cir. 1989). SEQUENCE ALIGNMENTS SEQ ID NO: 1 (Query: Instant claim 6): RESULT 1 (Geneseq database) BBJ30778 (NOTE: this sequence has 1 duplicate in the database searched. See complete list at the end of this report) ID BBJ30778 standard; DNA; 408 BP. XX AC BBJ30778; XX DT 28-AUG-2014 (first entry) XX DE F. prausnitzii protein (ZP05614546.1) encoding DNA, SEQ ID: 19. XX KW allergic rhinitis; allergy; alzheimers disease; anaphylaxis; KW antiinflammatory; arthritis; atopic dermatitis; autoimmune disease; KW contact dermatitis; crohns disease; diabetes mellitus; ds; eczema; KW encephalitis; enteritis; gene; glomerulonephritis; KW graft versus host disease; hypersensitivity; ileitis; immunosuppressive; KW inflammatory bowel disease; inflammatory disease; meningitis; KW multiple sclerosis; neuroprotective; nootropic; osteoarthritis; KW prophylactic to disease; protein therapy; systemic lupus erythematosus; KW therapeutic; transplant rejection; ulcerative colitis; urticaria; KW vasculitis. XX OS Faecalibacterium prausnitzii. XX FH Key Location/Qualifiers FT CDS 1..408 FT /*tag= a FT /product= "Faecalibacterium prausnitzii derived protein FT (ZP05614546.1)" XX CC PN WO2014102009-A1. XX CC PD 03-JUL-2014. XX CC PF 26-DEC-2013; 2013WO-EP003917. XX PR 26-DEC-2012; 2012EP-00008611. XX CC PA (INRG ) INRA INST NAT RECH AGRONOMIQUE. XX CC PI Langella Philippe; XX DR WPI; 2014-M43615/46. DR P-PSDB; BBJ30761. XX CC PT New polypeptide useful for treating or preventing inflammatory diseases CC PT e.g. inflammatory bowel disease, e.g. enteritis, comprising or consisting CC PT of specified amino acid sequence, and conservative derivative or its CC PT fragment. XX CC PS Claim 8; SEQ ID NO 19; 55pp; English. XX CC The present invention relates to a novel polypeptide useful for treating CC or preventing inflammatory diseases. The invention further includes: a CC nucleic acid sequence encoding the polypeptide; a vector comprising the CC nucleic acid sequence; a host cell which has been transfected, infected CC or transformed by the nucleic acid sequence; and a pharmaceutical CC composition comprising the polypeptide, the nucleic acid sequence, the CC vector or host cell and carrier. The polypeptide is also useful for CC preventing: inflammatory diseases chosen from inflammatory bowel disease, CC ulcerative colitis, ileitis and enteritis, Crohn disease, systemic CC anaphylaxis or hypersensitivity responses, drug allergies, eczema, atopic CC dermatitis, allergic contact dermatitis, urticaria, vasculitis, allergic CC rhinitis; autoimmune diseases, selected from arthritis, osteoarthritis, CC multiple sclerosis, systemic lupus erythematosus, diabetes mellitus, and CC glomerulonephritis; graft rejection chosen from allograft rejection and CC graft vs host disease; and other diseases in which undesired inflammatory CC responses are to be inhibited preferably, Alzheimer's disease, CC encephalitis, and meningitis. The present sequence represents a DNA CC encoding a Faecalibacterium prausnitzii protein (ZP05614546.1) which is CC used for treating or preventing inflammatory diseases in the invention. XX SQ Sequence 408 BP; 106 A; 117 C; 95 G; 90 T; 0 U; 0 Other; Query Match 100.0%; Score 408; Length 408; Best Local Similarity 100.0%; Matches 408; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 ATGATGATGCCTGCAAACTACTCTGTTATCGCAGAGAACGAAATGACCTACGTCAACGGT 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 ATGATGATGCCTGCAAACTACTCTGTTATCGCAGAGAACGAAATGACCTACGTCAACGGT 60 Qy 61 GGCGCTAACTTCATCGACGCTATCGGCGCTGTTACCGCTCCTATCTGGACTCTGGACAAC 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 GGCGCTAACTTCATCGACGCTATCGGCGCTGTTACCGCTCCTATCTGGACTCTGGACAAC 120 Qy 121 GTTAAGACCTTCAACACCAACATCGTGACTCTGGTTGGCAACACCTTCCTGCAGTCCACC 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 GTTAAGACCTTCAACACCAACATCGTGACTCTGGTTGGCAACACCTTCCTGCAGTCCACC 180 Qy 181 ATTAACCGCACCATCGGTGTCCTGTTCAGCGGCAACACCACCTGGAAGGAAGTCGGCAAC 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 ATTAACCGCACCATCGGTGTCCTGTTCAGCGGCAACACCACCTGGAAGGAAGTCGGCAAC 240 Qy 241 ATCGGCAAGAACCTGTTCGGCACCAATGTTAAGGGCAACCCGATCGAGAAGAACAACTTT 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 ATCGGCAAGAACCTGTTCGGCACCAATGTTAAGGGCAACCCGATCGAGAAGAACAACTTT 300 Qy 301 GGTGACTATGCTATGAACGCTCTGGGCATTGCTGCTGCTGTCTACAACCTGGGCGTGGCT 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 GGTGACTATGCTATGAACGCTCTGGGCATTGCTGCTGCTGTCTACAACCTGGGCGTGGCT 360 Qy 361 CCCACCAAGAACACCGTCAAGGAGACTGAGGTTAAGTTCACTGTCTAA 408 |||||||||||||||||||||||||||||||||||||||||||||||| Db 361 CCCACCAAGAACACCGTCAAGGAGACTGAGGTTAAGTTCACTGTCTAA 408 Conclusion Any inquiry concerning this communication or earlier communications from the examiner should be directed to SATYENDRA K. SINGH whose telephone number is (571)272-8790. The examiner can normally be reached M-F 8:00- 5:00. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, LOUISE W HUMPHREY can be reached at 571-272-5543. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /SATYENDRA K SINGH/Primary Examiner, Art Unit 1657 SATYENDRA K. SINGH Primary Examiner Art Unit 1657
Read full office action

Prosecution Timeline

Jul 27, 2022
Application Filed
Oct 31, 2025
Response after Non-Final Action
Jan 23, 2026
Non-Final Rejection — §103, §112 (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12600995
BIOCATALYST AS A CORE COMPONENT OF AN ENZYME-CATALYZED REDOX SYSTEM FOR THE BIOCATALYTIC REDUCTION OF CYSTINE
2y 5m to grant Granted Apr 14, 2026
Patent 12599142
BACTERIOPHAGE, BACTERIAL WILT DISEASE CONTROL AGENT, AND BACTERIAL WILT DISEASE CONTROL METHOD
2y 5m to grant Granted Apr 14, 2026
Patent 12584101
COMPOSITIONS AND METHOD OF USE FOR H5 COMPETENT BIFIDOBACTERIUM LONGUM SUBSP. INFANTIS
2y 5m to grant Granted Mar 24, 2026
Patent 12576118
BACTERIOPHAGES FOR THE TREATMENT OF TUBERCULOSIS
2y 5m to grant Granted Mar 17, 2026
Patent 12559784
IN CHEMICO TEST FOR TOXICITY
2y 5m to grant Granted Feb 24, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

AI Strategy Recommendation

Get an AI-powered prosecution strategy using examiner precedents, rejection analysis, and claim mapping.
Powered by AI — typically takes 5-10 seconds

Prosecution Projections

1-2
Expected OA Rounds
61%
Grant Probability
99%
With Interview (+66.4%)
3y 6m
Median Time to Grant
Low
PTA Risk
Based on 643 resolved cases by this examiner. Grant probability derived from career allow rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month