Prosecution Insights
Last updated: August 06, 2026
Application No. 17/917,264

COMPOSITIONS COMPRISING RECOMBINANT EPO AND METHODS OF USE THEREOF

Final Rejection §112
Filed
Oct 06, 2022
Priority
Apr 09, 2020 — provisional 63/007,716 +1 more
Examiner
WANG, CHANG YU
Art Unit
1675
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
UNIVERSITY OF SOUTH DAKOTA
OA Round
2 (Final)
33%
Grant Probability
At Risk
3-4
OA Rounds
0m
Est. Remaining
87%
With Interview

Examiner Intelligence

Grants only 33% of cases
33%
Career Allowance Rate
289 granted / 865 resolved
-26.6% vs TC avg
Strong +53% interview lift
Without
With
+53.3%
Interview Lift
resolved cases with interview
Typical timeline
3y 10m
Avg Prosecution
59 currently pending
Career history
950
Total Applications
across all art units

Statute-Specific Performance

§101
4.8%
-35.2% vs TC avg
§103
27.2%
-12.8% vs TC avg
§102
15.0%
-25.0% vs TC avg
§112
35.5%
-4.5% vs TC avg
Black line = Tech Center average estimate • Based on career data from 865 resolved cases

Office Action

§112
Notice of Pre-AIA or AIA Status The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . DETAILED ACTION RESPONSE TO AMENDMENT Status of Application/Amendments/claims Applicant’s amendment filed April 7, 2026 is acknowledged. Claims 2-3, 9-16 and 18 are cancelled. Claims 1, 4-8, 17, 19, 21-23, 26 and 28 are amended. Claims 1, 4-8, 17 and 19-28 are pending in this application. Claims 19-28 are withdrawn from further consideration pursuant to 37 CFR 1.142(b) as being drawn to nonelected inventions, there being no allowable generic or linking claim. Election was made without traverse in the reply filed on October 28, 2025. Applicant’s request rejoinder of method claims 19-28 is moot because not all claims of the elected invention are allowable. See the details under the 112(a) rejection below. 4. Claims 1, 4-8 and 17 are under examination in this office action. 5. Applicant’s arguments filed on April 7, 2026 have been fully considered but they are not deemed to be persuasive for the reasons set forth below. Drawings 6. The objection to figure 24C is withdrawn in response to Applicant’s amendment to the specification. Specification 7. The objection to trademarks recited in the specification is withdrawn in response to Applicant’s amendment to the specification. However, the disclosure is still objected to because there is no brief description for figures 29A-B. Appropriate correction is required. Claim Rejections/Objections Withdrawn 8. The objection to claims 19-28 is withdrawn in response to Applicant’s amendment to the claims. The rejection of claims 2-6, 8-9 and 17 under 35 U.S.C. 112(b) or 35 U.S.C. 112 (pre-AIA ), second paragraph, as being indefinite is withdrawn I response to Applicant’s amendment to the claims. The rejection of claims 1-9 and 17 under 35 U.S.C. 112(a) or 35 U.S.C. 112 (pre-AIA ), first paragraph, as failing to comply with the written description requirement is withdrawn in response to Applicant’s amendment to the claims and cancelation of claims 2-3 and 9. The rejection of claims 1-5, 7-9 and 17 under 35 U.S.C. 102(a)(1) as being anticipated by Guyon et al. (US8252743; also published as WO2008065372) is withdrawn in response to Applicant’s amendment to the claims and cancelation of claims 2-3 and 9. The rejection of claim 6 under 35 U.S.C. 103 as being unpatentable over Guyon et al. (US8252743; also published as WO2008065372) in view of Nemetz et al. (Chapter 14, p. 157-163, Book: Cell-Free Translation Systems edited by A.S. Spirin, 2002, Springer-Verlag Berlin Heidelbreg) and Jenny et al. (Protein Expression and Purification, 2003; 31:1-11) is withdrawn in response to Applicant’s amendment to the claims. Claim Rejections/Objections Maintained In view of the amendment filed on April 7, 2026, the following rejections are maintained. Claim Rejections - 35 USC § 112 9. The following is a quotation of the first paragraph of 35 U.S.C. 112(a): (a) IN GENERAL.—The specification shall contain a written description of the invention, and of the manner and process of making and using it, in such full, clear, concise, and exact terms as to enable any person skilled in the art to which it pertains, or with which it is most nearly connected, to make and use the same, and shall set forth the best mode contemplated by the inventor or joint inventor of carrying out the invention. The following is a quotation of the first paragraph of pre-AIA 35 U.S.C. 112: The specification shall contain a written description of the invention, and of the manner and process of making and using it, in such full, clear, concise, and exact terms as to enable any person skilled in the art to which it pertains, or with which it is most nearly connected, to make and use the same, and shall set forth the best mode contemplated by the inventor of carrying out his invention. Claims 4 and 6 stand rejected under 35 U.S.C. 112(a) or 35 U.S.C. 112 (pre-AIA ), first paragraph, as failing to comply with the written description requirement. The claim(s) contains subject matter which was not described in the specification in such a way as to reasonably convey to one skilled in the relevant art that the inventor or a joint inventor, or for pre-AIA the inventor(s), at the time the application was filed, had possession of the claimed invention. The rejection is maintained for the reasons of record and the reasons set forth below. Claim 4 encompasses a genus of maltose binding protein sequence. Claim 6 encompasses a genus of Factor Xa peptide sequence. Applicant has not disclosed sufficient species for the broad genus of maltose binding protein sequence and the broad genus of Factor Xa peptide sequence. Response to Arguments On p. 10-11 of the response, Applicant argues that the rejection has been overcome because instant claims are directed to a polypeptide comprising SEQ ID NO:1 or 2. Applicant's arguments have been fully considered but they are not found persuasive. Contrary to Applicant's arguments, the examiner asserts that based on MPEP §2163, MPEP §§2163.01-2163.03, the specification fails to provide sufficient description or information or evidence to demonstrate that Applicant is in possession of the claimed genus of maltose binding protein sequence or the claimed genus of Factor Xa peptide sequence for the polypeptide of SEQ ID NO:1 (QPO) or QPO fusion proteins because: i. The structural and functional relationship or correlation between the claimed genus of maltose binding protein or Factor Xa peptide sequence and the polypeptide of SEQ ID NO:2 (i.e.MBP/6x-His QPO fusion protein that can be cleaved by Factor Xa Protease) is unknown. The specification only describes QPO of SEQ ID NO:1 or QPO fusion protein of SEQ ID NO:2 (i.e.MBP/6x-His QPO fusion protein that can be cleaved by Factor Xa Protease) which has the property of retaining the activity of activating EPOR/CD131 heterodimer and mimicking CEPO’s inability to activate the EPOR homodimer, and can upregulate BDNF and EGR1 expression in PC12 cells or mouse hippocampus, or enhance memory recognition in 5xFAD mice (an animal model of Alzheimer’s disease) when compared to controls (see para. [00144]; [00166]-[00169]; [00182]-[0192]; Figures 3-5, 29 & 9-18; [0066]-[0072]; [0076]). Based on Applicant’s own admission, not all variants of SEQ ID NO:1 or 2 can maintain the activity of QPO which has specific K to Q substitutions at positions 20, 45 and 97 of SEQ ID NO:3 on wild type human EPO in upregulating BDNF expression and enhancing memory recognition in 5xFAD mice because RPO (SEQ ID NO:3 with K20R, K45R and K97R) does not have the activity of upregulating BDNF in hippocampus or enhancing memory recognition in 5xFAD mice as QPO or EPO (see para. [00182]-[0192]; Figures 9-18). The specification fails to teach what other maltose binding protein sequences and other Factor Xa peptide sequences are, and can be encompassed in QPO fusion proteins to maintain the activity of activating EPOR/CD131 heterodimer and mimicking CEPO’s inability to activate the EPOR homodimer, and upregulating BDNF and EGR1 expression in PC12 cells or mouse hippocampus, or enhancing memory recognition in 5xFAD mice (an animal model of Alzheimer’s disease) when compared to controls. The instant specification fails to provide sufficient descriptive information, such as definitive structural or functional features of the claimed genus of maltose binding protein sequence and the claimed genus of a Factor Xa peptide sequence. The specification provides no description of the conserved regions which are critical to the function of the genus claimed. The specification provides no information regarding the relation of structure of other maltose binding protein sequences and other Factor Xa peptide sequences to the function of the polypeptide of instant SEQ ID NO:2 (i.e. QPO fusion protein comprising instant SEQ ID NO: 2). Furthermore, the prior art does not provide compensatory structural or correlative teachings sufficient to enable one of skill to identify what other QPO fusion proteins comprising other maltose binding protein sequences and other Factor Xa peptide sequences might be. Since the common characteristics/features of other maltose binding protein sequences and other Factor Xa peptide sequences and other QPO fusion protein are unknown, a skilled artisan cannot envision the functional correlations of the genus with the claimed invention. Accordingly, in the absence of sufficient recitation of distinguishing identifying characteristics, the specification does not provide adequate written description of the genus of maltose binding protein sequence and the genus of Factor Xa peptide sequence encompassed in the claimed polypeptide to maintain the activity of QPO of SEQ ID NO:1 or QPO fusion protein of SEQ ID NO:2. Based on MPEP § 2161.01 and §2163, “to satisfy the written description requirement, a patent specification must describe the claimed invention in sufficient detail that one skilled in the art can reasonably conclude that the inventor had possession of the claimed invention. See, e.g., Moba, B.V. v. Diamond Automation, Inc., 325 F.3d 1306, 1319, 66 USPQ2d 1429, 1438 (Fed. Cir. 2003); Vas-Cath, Inc. v. Mahurkar, 935 F.2d at 1563, 19 USPQ2d at 1116”. Vas-Cath Inc. v. Mahurkar, 19USPQ2d 1111, clearly states “applicant must convey with reasonable clarity to those skilled in the art that, as of the filing date sought, he or she was in possession of the invention. The invention is, for purposes of the ‘written description’ inquiry, whatever is now claimed.” (See page 1117.) The specification does not “clearly allow persons of ordinary skill in the art to recognize that [he or she] invented what is claimed.” (See Vas-Cath at page 1116). Therefore, the claimed polypeptides further comprising a maltose binding protein sequence, or a Factor Xa peptide sequence have not met the written description provision of 35 U.S.C. §112, first paragraph. Applicant is reminded that Vas-Cath makes clear that the written description provision of 35 U.S.C. §112 is severable from its enablement provision (see page 1115). Applicant is directed to the Guidelines for the Examination of Patent Applications Under the 35 U.S.C. 112, ¶ 1 "Written Description" Requirement. See MPEP § 2161.01 and 2163. Accordingly, the rejection of claims 4 and 6 under 35 U.S.C. 112(a) or 35 U.S.C. 112 (pre-AIA ), first paragraph, as failing to comply with the written description requirement is maintained. Conclusion Allowable Subject Matter 10. Claims 1, 5, 7-8 and 17 are allowed. 11. Claims 4 and 6 are rejected. Sequence alignment SEQ ID NO:1 1 APPRLICDSRVLERYLLEAQEAENITTGCAEHCSLNENITVPDTQVNFYAWKRMEVGQQA 60 SEQ ID NO:2 398 APPRLICDSRVLERYLLEAQEAENITTGCAEHCSLNENITVPDTQVNFYAWKRMEVGQQA 457 SEQ ID NO:3 1 APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQA 60 SEQ ID NO:3/20/45/97Q 1 APPRLICDSRVLERYLLEAQEAENITTGCAEHCSLNENITVPDTQVNFYAWKRMEVGQQA 60 SEQ ID NO:1 61 VEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDQAVSGLRSLTTLLRALGAQKEAIS 120 SEQ ID NO:2 458 VEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDQAVSGLRSLTTLLRALGAQKEAIS 517 SEQ ID NO:3 61 VEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGL-SLTTLLRALGAQKEAIS 119 SEQ ID NO:3/20/45/97Q 61 VEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDQAVSGL-SLTTLLRALGAQKEAIS 119 SEQ ID NO:1 121 PPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR 166 SEQ ID NO:2 518 PPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR 563 SEQ ID NO:3 120 PPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR 165 SEQ ID NO:3/20/45/97Q 120 PPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR 165 12. The prior art made of record and not relied upon is considered pertinent to applicant's disclosure. Sathyanesan et al. (Transl. Psychi. 2018; 8:113. DOI 10.1038/s41398-018-0168-9) teaches carbamoylated erthropoietin (CEPO) and its effects on inducing expression of BDNF, VGF, Arc, TH and neuritrin in medial prefrontal cortex (mPFC) and hippocampal subfield and potential use for treatment of cognitive dysfunction in neuropsychiatric diseases (see abstract) and that the positions K45 and K20 are in close proximity to the high affinity active site residues and K97 is the only carbamoylated lysine that is close to the low affinity site (see p. 10, discussion). Guyon et al. (US8252743 or WO2008065372) teach a modified EPO polypeptide comprising the sequence of SEQ ID NO:79, which is 99.1% identical to instant SEQ ID NO:1 (see the sequence alignment below),wherein the modified EPO polypeptide contains one or more amino acid replacements including K20Q, K45Q and K97Q (see col. 62, lines 50-60; col.63, line 3; col. 64, lines 4; 8; 14, table 3; col. 66, lines 63, 66; col. 67, line 5; 29-35; col. 69, line 9-15). Guyon teaches a fusion protein comprising the modified EPO polypeptide and a maltose binding protein sequence in claim 4 (col. 114, line 20-28), a histidine tag in claim 5 (col. 113, lines 42-56) or a composition comprising the modified EPO (see col. 14, lines 1-67). SEQ ID NO:1 US-11-998-387A-79 Sequence 79, US/11998387A Patent No. 8252743 GENERAL INFORMATION APPLICANT: Thierry Guyon APPLICANT: Gilles Borrelly APPLICANT: Xavier Gallet APPLICANT: Lila Drittanti APPLICANT: Manuel Vega TITLE OF INVENTION: MODIFIED ERYTHROPOIETIN POLYPEPTIDES AND USE THEREOF FOR TREATMENT FILE REFERENCE: 119365-00049/931 CURRENT APPLICATION NUMBER: US/11/998,387A CURRENT FILING DATE: 2009-02-25 PRIOR APPLICATION NUMBER: 60/861,615 PRIOR FILING DATE: 2006-11-28 NUMBER OF SEQ ID NOS: 310 SEQ ID NO 79 LENGTH: 166 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: EPO_77_K97Q Query Match 99.1%; Score 843; Length 166; Best Local Similarity 98.8%; Matches 164; Conservative 2; Mismatches 0; Indels 0; Gaps 0; Qy 1 APPRLICDSRVLERYLLEAQEAENITTGCAEHCSLNENITVPDTQVNFYAWKRMEVGQQA 60 |||||||||||||||||||:||||||||||||||||||||||||:||||||||||||||| Db 1 APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQA 60 Qy 61 VEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDQAVSGLRSLTTLLRALGAQKEAIS 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 VEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDQAVSGLRSLTTLLRALGAQKEAIS 120 Qy 121 PPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR 166 |||||||||||||||||||||||||||||||||||||||||||||| Db 121 PPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR 166 SEQ ID NO:1 ARW15606 (NOTE: this sequence has 3 duplicates in the database searched) ID ARW15606 standard; protein; 166 AA. XX AC ARW15606; XX DT 07-AUG-2008 (first entry) XX DE Human modified erythropoietin (EPO) protein SEQ ID:19. XX KW diagnostic test; therapeutic; protein stabilization; protein therapy; KW protein production; protein detection; mutagenesis; cytokine; anemia; KW seizure disorder; multiple sclerosis; cerebral ischemia; hypotension; KW cardiac arrest; ischemia; myocardial infarction; inflammation; KW cognitive disorder; radiation injury; cerebral palsy; KW neurodegenerative disease; Alzheimers disease; Parkinsons disease; KW Leigh disease; hiv associated dementia; amnesia; KW amyotrophic lateral sclerosis; alcoholism; mood disorder; KW anxiety disorder; attention deficit hyperactivity disorder; KW schizophrenia; autism; creutzfeldt jakob disease; trauma; brain injury; KW spinal cord injury; head injury; macular degeneration; neuropathy; KW diabetic neuropathy; diabetic retinopathy; glaucoma; ocular disease; KW renal failure; cancer; vulnerary; vasotropic; tranquilizer; KW ophthalmological; nootropic; neuroprotective; neuroleptic; nephrotropic; KW muscular-gen.; hypertensive; cytostatic; cns-gen.; cerebroprotective; KW cardiant; antiparkinsonian; antiinflammatory; anti-hiv; antidiabetic; KW antianemic; antialcoholic; anticonvulsant; erythropoietin; EPO; mutein. XX OS Homo sapiens. OS Synthetic. XX CC PN WO2008065372-A2. XX CC PD 05-JUN-2008. XX CC PF 27-NOV-2007; 2007WO-GB004520. XX PR 28-NOV-2006; 2006US-0861615P. XX CC PA (NAUT-) NAUTILUS BIOTECH SA. XX CC PI Guyon T, Borrelly G, Gallet X, Drittanti L, Vega M; XX DR WPI; 2008-H01039/44. XX CC PT New pharmaceutical composition comprises modified therapeutic polypeptide CC PT or an active fragment of the polypeptide in a vehicle, useful for CC PT treating disease or condition, e.g. anemia, seizure disorder, CC PT hypotension, or inflammation. XX CC PS Claim 89; SEQ ID NO 19; 272pp; English. XX CC The present invention relates to novel modified erythropoietin (EPO) CC polypeptides and other modified therapeutic polypeptides such as CC granulocyte macrophage-colony stimulating factor (GM-CSF); macrophage- CC colony stimulating factor (M-CSF); granulocyte colony-stimulating factor CC (G-CSF); leukemia inhibitory factor (LIF); interleukin 1beta (IL-1beta); CC interleukin-2 (IL-2); interleukin-3 (IL-3); interleukin-4 (IL-4); CC interleukin-5 (IL-5); interleukin-6 (IL-6); oncostatin M (OSM); stem cell CC factor (SCF); interferon-beta (IFN-beta) and interferon-gamma (IFN- CC gamma). The polypeptides are modified to exhibit physical properties and CC activities that differ from the corresponding unmodified polypeptides and CC nucleic acid molecules encoding these polypeptides also are provided. The CC invention provides methods for treatment and diagnosis using these CC therapeutic polypeptides and also discloses a pharmaceutical composition CC which comprises a modified therapeutic polypeptide or its active CC fragment. The modified therapeutic polypeptide of the invention comprises CC one or more amino acid replacements, insertions and deletions and CC modifications at one or more of glycosylation sites compared to the CC unmodified therapeutic polypeptide; exhibits increased resistance to CC proteolysis; is not glycosylated and exhibits therapeutic activity. Also CC claimed is a modified Erythropoietin (EPO) polypeptide; a nucleic acid CC molecule encoding the modified EPO polypeptide; a vector comprising the CC nucleic acid molecule which is linked to a promoter; a eukaryotic or a CC prokaryotic host cell consisting of the nucleic acid molecule or the CC vector which is useful for the production of a modified EPO polypeptide CC and a method for expressing a modified EPO polypeptide which comprises CC detection of the modified EPO polypeptide. The invention further CC discloses that the modified therapeutic polypeptide is a cytokine and it CC is present in the precursor or mature form. The pharmaceutical CC composition of the invention is useful for diagnosing and treating CC diseases such as anemia, seizure disorder, multiple sclerosis, cerebral CC ischemia, hypotension, cardiac arrest, ischemia, myocardial infarction, CC inflammation, cognitive disorder, radiation injury, cerebral palsy, CC neurodegenerative disease, Alzheimers disease, Parkinsons disease, Leigh CC disease, hiv associated dementia, amnesia, amyotrophic lateral sclerosis, CC alcoholism, mood disorder, anxiety disorder, attention deficit CC hyperactivity disorder, schizophrenia, autism, creutzfeldt jakob disease, CC trauma, brain injury, spinal cord injury, head injury, macular CC degeneration, neuropathy, diabetic neuropathy, diabetic retinopathy, CC glaucoma, ocular disease, renal failure and cancer. The present sequence CC is a Human modified erythropoietin (EPO) protein. XX SQ Sequence 166 AA; Query Match 99.1%; Score 843; Length 166; Best Local Similarity 98.8%; Matches 164; Conservative 2; Mismatches 0; Indels 0; Gaps 0; Qy 1 APPRLICDSRVLERYLLEAQEAENITTGCAEHCSLNENITVPDTQVNFYAWKRMEVGQQA 60 ||||||||||||||||||||||||||||||||||||||||||||:||||||||||||||| Db 1 APPRLICDSRVLERYLLEAQEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQA 60 Qy 61 VEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDQAVSGLRSLTTLLRALGAQKEAIS 120 ||||||||||||||||||||||||||||||||||||:||||||||||||||||||||||| Db 61 VEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAIS 120 Qy 121 PPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR 166 |||||||||||||||||||||||||||||||||||||||||||||| Db 121 PPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR 166 WO2004022593 teaches a modified cytokine protein comprising the amino acid sequence of SEQ ID NO: 942, which is 99.1% identical to instant SEQ ID NO:1 (see the sequence alignment below). ADL89608 (NOTE: this sequence has 6 duplicates in the database searched) ID ADL89608 standard; protein; 166 AA. XX AC ADL89608; XX DT 03-JUN-2004 (first entry) XX DE Human modified cytokine protein #890. XX KW Human; cytokine; proteolysis; interferon; IFN; interleukin-10; IL-10; KW long-chain cytokine family; short-chain cytokine family; infection; KW allergy; heart disease; cancer; liver disorder; autoimmune disease; KW growth disorder; diabetes; neurodegenerative disease; antimicrobial; KW antiallergic; cytostatic; immunosuppressive; antidiabetic; KW neuroprotective; mutant; mutein. XX OS Homo sapiens. OS Synthetic. XX CC PN WO2004022593-A2. XX CC PD 18-MAR-2004. XX CC PF 08-SEP-2003; 2003WO-IB004347. XX PR 09-SEP-2002; 2002US-0409898P. PR 21-MAR-2003; 2003US-0457135P. XX CC PA (NAUT-) NAUTILUS BIOTECH. XX CC PI Gantier R, Guyon T, Vega M, Drittanti L; XX DR WPI; 2004-248447/23. XX CC PT New modified cytokines with increased resistance to proteolysis, useful CC PT for diagnosing and treating diseases such as infections, allergies, heart CC PT diseases, cancer, liver disorders, autoimmune diseases or diabetes. XX CC PS Disclosure; SEQ ID NO 942; 316pp; English. XX CC The invention relates to modified cytokines that exhibit increased CC resistance to proteolysis compared to unmodified cytokines. The invention CC also relates to nucleic acid molecules encoding the cytokines, a CC pharmaceutical composition comprising a nucleic acid molecule in a CC pharmaceutical carrier, and a method of generating a protein or peptide CC molecule having a predetermined property or activity, or a pre-selected CC altered phenotype. The modified cytokine is selected from a member of the CC interferons (IFNs)/interleukin (IL)-10 protein family, a member of the CC long-chain cytokine family or a member of the short-chain cytokine CC family. The composition and method are useful for diagnosing and treating CC diseases such as infections, allergies, heart diseases, cancer, liver CC disorders, autoimmune diseases, growth disorders, diabetes or CC neurodegenerative diseases. This sequence represents a human modified CC cytokine protein of the invention. XX SQ Sequence 166 AA; Query Match 99.1%; Score 843; Length 166; Best Local Similarity 98.8%; Matches 164; Conservative 2; Mismatches 0; Indels 0; Gaps 0; Qy 1 APPRLICDSRVLERYLLEAQEAENITTGCAEHCSLNENITVPDTQVNFYAWKRMEVGQQA 60 |||||||||||||||||||:|||||||||||||||||||||||||||||||||||||||| Db 1 APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTQVNFYAWKRMEVGQQA 60 Qy 61 VEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDQAVSGLRSLTTLLRALGAQKEAIS 120 ||||||||||||||||||||||||||||||||||||:||||||||||||||||||||||| Db 61 VEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAIS 120 Qy 121 PPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR 166 |||||||||||||||||||||||||||||||||||||||||||||| Db 121 PPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR 166 WO2009152944 teaches a human EPO mature protein mutant comprising the amino acid sequence of SEQ ID NO: 19, which is 99.1% identical to instant SEQ ID NO:1 (see the sequence alignment below). SEQ ID NO:1 ID AXX71688 standard; protein; 166 AA. XX AC AXX71688; XX DT 10-JUN-2010 (first entry) XX DE Human erythropoietin (EPO) mature protein mutant, SEQ ID 19. XX KW Erythropoietin ligand; acquired immune deficiency syndrome; anemia; KW antianemic; antiinflammatory; antisickling; cancer; chronic inflammation; KW cytostatic; genetic-disease-gen.; hematological-gen.; hemorrhage; KW hemostatic; immunostimulant; iron metabolism disorder; metabolic-gen.; KW mutein; neurological disease; neuroprotective; protein therapy; KW sickle cell anemia; thalassemia; therapeutic. XX OS Homo sapiens. OS Synthetic. XX FH Key Location/Qualifiers FT Misc-difference 20 FT /note= "Wild-type Lys substituted by Gln" XX CC PN WO2009152944-A1. XX CC PD 23-DEC-2009. XX CC PF 29-MAY-2009; 2009WO-EP003862. XX PR 29-MAY-2008; 2008US-0130376P. XX CC PA (HANA-) HANALL PHARM CO LTD. XX CC PI Borrelly G, Drittanti L, Gallet X, Guyon T, Vega M; XX DR WPI; 2009-S67343/08. XX CC PT New modified erythropoietin polypeptide, comprises two amino acid CC PT modifications at masked is-Hit residues masked by different glycosylation CC PT sites, useful for treating a disease or condition, e.g. anemias. XX CC PS Claim 10; SEQ ID NO 19; 279pp; English. XX CC The present invention relates to novel modified erythropoietin (EPO) CC polypeptides that exhibit increased protease resistance and CC pharmaceutical compositions comprising them. The modified erythropoietin CC polypeptide, comprises two amino acid modifications at the masked is-Hit CC residues which are masked by different glycosylation sites; and one or CC more additional amino acid modifications at un-masked is-Hit residue. The CC invention also provides a nucleic acid sequence encoding the modified EPO CC polypeptide; a vector, comprising the nucleic acid sequence; a host cell, CC comprising the vector; a pharmaceutical composition, comprising the CC modified EPO polypeptide and a method for treating a disorder that is CC amenable to treatment by EPO. The modified therapeutic polypeptide CC contains one or more additional amino acid modifications that contributes CC to altered immunogenicity, carboxylation, hydroxylation, carbamylation, CC sulfation, phosphorylation, oxidation, PEGylation or protease resistance. CC The modified EPO polypeptide, nucleic acid molecule, pharmaceutical CC compositions and methods are useful for treating anemias that accompany CC renal failure, AIDS, malignancy, chronic inflammation, perioperative CC surgeries; iron overload disorder; abnormal hemostasis; tissue protective CC therapy; neurological condition, thalassemia, sickle cell anemia, the CC anemia of prematurity, anemia that accompanies cis-platinum chemotherapy, CC and anemia following intensive radiotherapy, chemotherapy and bone marrow CC transplantation. The recombinant EPO polypeptide has improved half-life CC and useful as a biotherapeutic agent. The present sequence is a Human CC erythropoietin (EPO) mature protein mutant that has improved half-life CC and increase protease resistance. XX SQ Sequence 166 AA; Query Match 99.1%; Score 843; Length 166; Best Local Similarity 98.8%; Matches 164; Conservative 2; Mismatches 0; Indels 0; Gaps 0; Qy 1 APPRLICDSRVLERYLLEAQEAENITTGCAEHCSLNENITVPDTQVNFYAWKRMEVGQQA 60 ||||||||||||||||||||||||||||||||||||||||||||:||||||||||||||| Db 1 APPRLICDSRVLERYLLEAQEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQA 60 Qy 61 VEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDQAVSGLRSLTTLLRALGAQKEAIS 120 ||||||||||||||||||||||||||||||||||||:||||||||||||||||||||||| Db 61 VEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAIS 120 Qy 121 PPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR 166 |||||||||||||||||||||||||||||||||||||||||||||| Db 121 PPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR 166 US20080260820 teaches a human EPO mutein comprising the amino acid sequence of SEQ ID NO: 1529, which is 99.1% identical to instant SEQ ID NO:1 (see the sequence alignment below). SEQ ID NO:1 ID ATS36124 standard; protein; 166 AA. XX AC ATS36124; XX DT 24-DEC-2008 (first entry) XX DE Human erythropoietin (EPO) mutein, SEQ ID 1529. XX KW protein therapy; therapeutic; viral infection; virucide; fibrosis; KW antiinflammatory; condyloma; antimicrobial-gen.; dermatological; cancer; KW cytostatic; growth disorder; growth-disorder-gen.; KW acquired immune deficiency syndrome; immunostimulant; aging; KW surgical procedure; surgical-gen.; congestive cardiomyopathy; cardiant; KW liver transplantation; renal failure; nephrotropic; renal osteodystrophy; KW osteoporosis; endocrine-gen.; osteopathic; achondroplasia; dysplasia; KW inflammatory disease; Crohns disease; gastrointestinal-gen.; KW immunosuppressive; short bowel syndrome; nutrition-disorder-gen.; KW juvenile rheumatoid arthritis; antiarthritic; cystic fibrosis; KW respiratory-gen.; male infertility; antiinfertility; uropathic; rickets; KW osteopathic; down syndrome; nootropic; Spina bifida; neuroprotective; KW genetic-disease-gen.; Noonan Syndrome; obesity; anorectic; fibromyalgia; KW muscular-gen.; hepatitis c virus infection; hepatitis B virus infection; KW hepatotropic; hairy cell leukemia; hematological-gen.; immunomodulator; KW lymphoma; follicle center lymphoma; kaposis sarcoma; pulmonary fibrosis; KW liver fibrosis; Turners syndrome; prader-willi syndrome; thalassemia; KW erythropoietin; mutein. XX OS Homo sapiens. OS Synthetic. XX CC PN US2008260820-A1. XX CC PD 23-OCT-2008. XX CC PF 19-APR-2007; 2007US-00788836. XX PR 19-APR-2007; 2007US-00788836. XX CC PA (BORR/) BORRELLY G. CC PA (CHAU/) CHAUCHARD C. CC PA (DRIT/) DRITTANTI L. CC PA (VEGA/) VEGA M. XX CC PI Borrelly G, Chauchard C, Drittanti L, Vega M; XX DR WPI; 2008-M78313/75. XX CC PT New oral dosage formulation comprises a therapeutic polypeptide, tablet CC PT or capsule, useful for treating a disease or condition, e.g. viral CC PT infection, a fibrotic disorder, condylomata acuminate, cancer, and a CC PT growth deficiency disorder. XX CC PS Claim 18; SEQ ID NO 1529; 120pp; English. XX CC The present invention relates to novel oral dosage formulations CC comprising protease-resistant therapeutic peptides and their uses. In the CC oral dosage formulation above, the therapeutic polypeptide contains one CC or two amino acid sequence substitutions that render it more protease CC resistant than in the absence of the modifications. The therapeutic CC polypeptide is an interleukin (IL)-10, an interferon beta, an interferon CC alpha, an interferon gamma, granulocyte colony stimulating leukemia CC inhibitory factor, a growth hormone, ciliary neurotrophic factor, leptin, CC insulin, oncostatin M, relaxin, IL-6, IL-12, erythropoietin, granulocyte- CC macrophage colony stimulating factor, IL-2, IL-3, IL-4, IL-5, IL-13, F1t3 CC ligand, a monoclonal antibody or its fragment or a stem cell factor. The CC invention also provides a tablet or capsule comprising 10-100 mg of an CC interferon alpha (IFN-a), where the IFN-alpha is protease resistant by CC virtue of its modifications and a method for treating a disease or CC condition, comprising administering the oral dosage formulation of a CC modified therapeutic polypeptide. The dosage formulation is useful for CC treating viral infections, fibrotic disorders, condylomata acuminate, CC cancer, growth deficiency disorders, AIDS, aging, impaired immune CC function of HIV-infected subjects, catabolic illness, surgical recovery, CC congestive cardiomyopathy, liver transplantation, liver regeneration CC after hepatectomy, chronic renal failure, renal osteodystrophy, CC osteoporosis, achondroplasia/hypochondroplasia, skeletal dysplasia, CC chronic inflammatory disorder, Crohn's disease, short bowel syndrome, CC juvenile chronic arthritis, cystic fibrosis, male infertility, X-linked CC hypophosphatemic rickets, Down's syndrome, Spina bifida, Noonan Syndrome, CC obesity, impaired muscle strength, fibromyalgia, hepatitis C infection, CC hepatitis B infection, hairy cell leukemia, malignant lymphoma, CC follicular lymphoma, AIDS-related Kaposi sarcoma, idiopathic pulmonary CC fibrosis, liver fibrosis, renal fibrosis, Turner's syndrome, intrauterine CC growth retardation, idiopathic short stature, Prader Willi syndrome, and CC thalassemia. The present sequence is a Human erythropoietin (EPO) mutein, CC used in the scope of the invention. XX SQ Sequence 166 AA; 4 ID AWO44428 standard; p Query Match 99.1%; Score 843; Length 166; Best Local Similarity 98.8%; Matches 164; Conservative 2; Mismatches 0; Indels 0; Gaps 0; Qy 1 APPRLICDSRVLERYLLEAQEAENITTGCAEHCSLNENITVPDTQVNFYAWKRMEVGQQA 60 ||||||||||||||||||||||||||||||||||||||||||||:||||||||||||||| Db 1 APPRLICDSRVLERYLLEAQEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQA 60 Qy 61 VEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDQAVSGLRSLTTLLRALGAQKEAIS 120 ||||||||||||||||||||||||||||||||||||:||||||||||||||||||||||| Db 61 VEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAIS 120 Qy 121 PPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR 166 |||||||||||||||||||||||||||||||||||||||||||||| Db 121 PPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR 166 KR2008094312 teaches a human EPO mutant polypeptide comprising the amino acid sequence of SEQ ID NO: 1529, which is 99.1% identical to instant SEQ ID NO:1 (see the sequence alignment below). SEQ ID NO:1 ID AWO44428 standard; protein; 166 AA. XX AC AWO44428; XX DT 04-AUG-2022 (revised) DT 23-JUL-2009 (first entry) XX DE Human EPO mutant polypeptide K20Q, SEQ ID 1529. XX KW protein therapy; therapeutic; prophylactic to disease; KW metabolic disorder; metabolic-gen.; inflammatory disease; KW antiinflammatory; autoimmune disease; immunosuppressive; viral infection; KW virucide; antimicrobial-gen.; hematological disease; hematological-gen.; KW heart disease; cardiant; neuropathy; neuroprotective; KW gastrointestinal disease; gastrointestinal-gen.; cancer; cytostatic; KW obesity; anorectic; nutrition-disorder-gen.; EPO; Erythropoietin ligand; KW mutein. XX OS Homo sapiens. OS Synthetic. XX FH Key Location/Qualifiers FT Misc-difference 20 FT /note= "Wild-type Lys substituted by Gln" XX CC PN KR2008094312-A. XX CC PD 23-OCT-2008. XX CC PF 19-APR-2007; 2007KR-00038557. XX PR 19-APR-2007; 2007KR-00038557. XX CC PA (NAUT-) NAUTILUS BIOTECH. XX CC PI Borrelly G, Chauchard C, Drittanti L, Vega M; XX DR WPI; 2009-E78925/23. XX CC PT Oral dosage formulation for preventing and treating diseases e.g. cancer, CC PT comprises therapeutic polypeptide having amino acid substitutions and CC PT showing higher protease resistance than therapeutic polypeptide without CC PT variation. XX CC PS Claim 18; SEQ ID NO 1529; 1901pp; Korean. XX CC The present invention relates to oral dosage formulations comprising CC protease-resistant polypeptides. The present invention provides a method CC for treating or preventing diseases by administering the oral dose CC formulation. The present invention further provides refinement or CC capsule, for e.g., enteric coated. In the invention, the polypeptides are CC selected from interleukin-10 (IL-10), interferon-beta, interferon alpha, CC interferon-gamma, granulocyte colony-stimulating factor (G-CSF), leukemia CC inhibitory factor (LIF), growth hormone (GH), ciliary neurotrophic factor CC (CNTF), leptin, insulin, oncostatin M, relaxin, interleukin-6 (IL-6), CC interleukin-12 (IL-12), erythropoietin (EPO), granulocyte-macrophage CC colony-stimulating factor (GM-CSF), interleukin-2 (IL-2), interleukin-3 CC (IL-3), interleukin-4 (IL-4), interleukin-5 (IL-5), interleukin-13 (IL- CC 13), Flt3 ligand, monoclonal antibody or its fraction and stem cell CC factor. The polypeptides used in the formulations comprise mutation in CC the amino acid sequence when compared to its wild-type sequence. In the CC invention, the diseases are selected from metabolic disease, CC proliferative disease, inflammatory disease, autoimmune disease, viral CC infection, microbism, blood disease, heart disease, neuropathy, CC gastrointestinal disease, cancer, obesity, etc. The present sequence is a CC human EPO mutant polypeptide used in the invention. CC CC Revised record issued on 04-AUG-2022 : Addition of DWPI-enhanced title CC (PT field). XX SQ Sequence 166 AA; Query Match 99.1%; Score 843; Length 166; Best Local Similarity 98.8%; Matches 164; Conservative 2; Mismatches 0; Indels 0; Gaps 0; Qy 1 APPRLICDSRVLERYLLEAQEAENITTGCAEHCSLNENITVPDTQVNFYAWKRMEVGQQA 60 ||||||||||||||||||||||||||||||||||||||||||||:||||||||||||||| Db 1 APPRLICDSRVLERYLLEAQEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQA 60 Qy 61 VEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDQAVSGLRSLTTLLRALGAQKEAIS 120 ||||||||||||||||||||||||||||||||||||:||||||||||||||||||||||| Db 61 VEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAIS 120 Qy 121 PPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR 166 |||||||||||||||||||||||||||||||||||||||||||||| Db 121 PPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR 166 13. THIS ACTION IS MADE FINAL. Applicant is reminded of the extension of time policy as set forth in 37 CFR 1.136(a). A shortened statutory period for reply to this final action is set to expire THREE MONTHS from the mailing date of this action. In the event a first reply is filed within TWO MONTHS of the mailing date of this final action and the advisory action is not mailed until after the end of the THREE-MONTH shortened statutory period, then the shortened statutory period will expire on the date the advisory action is mailed, and any nonprovisional extension fee (37 CFR 1.17(a)) pursuant to 37 CFR 1.136(a) will be calculated from the mailing date of the advisory action. In no event, however, will the statutory period for reply expire later than SIX MONTHS from the mailing date of this final action. 14. Any inquiry concerning this communication or earlier communications from the examiner should be directed to CHANG-YU WANG whose telephone number is (571)272-4521. The examiner can normally be reached Monday-Thursday, 7:00am-5:00pm EST. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Jeffrey Stucker can be reached at 571-272-0911. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. Chang-Yu Wang June 19, 2026 /CHANG-YU WANG/Primary Examiner, Art Unit 1675
Read full office action

Prosecution Timeline

Oct 06, 2022
Application Filed
Nov 15, 2025
Non-Final Rejection (signed) — §112
Jan 07, 2026
Non-Final Rejection mailed — §112
Apr 07, 2026
Response Filed
May 27, 2026
Examiner Interview (Telephonic)
Jun 25, 2026
Final Rejection mailed — §112 (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12662528
NOVEL ANTI-NOGO-A ANTIBODIES
4y 2m to grant Granted Jun 23, 2026
Patent 12662678
HUMAN ALZHEIMER'S DISEASE AND TRAUMATIC BRAIN INJURY ASSOCIATED TAU VARIANTS AS BIOMARKERS AND METHODS OF USE THEREOF
3y 6m to grant Granted Jun 23, 2026
Patent 12655201
ISOLATED ANTIGEN BINDING PROTEIN AND USE THEREOF
3y 6m to grant Granted Jun 16, 2026
Patent 12653872
MIMOTOPES OF ALPHA-SYNUCLEIN AND VACCINES THEREOF FOR THE TREATMENT OF SYNUCLEINOPATHY
3y 6m to grant Granted Jun 16, 2026
Patent 12624396
METHODS FOR DETERMINING THE PRESENCE OR RISK OF DEVELOPING FACIOSCAPULOHUMERAL DYSTROPHY (FSHD)
5y 5m to grant Granted May 12, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

Strategy Recommendation AI-generated — please review before filing

Get a prosecution strategy drawn from examiner precedents, rejection analysis, and claim mapping.
Typically takes 5-10 seconds — AI-generated, attorney review required before filing

Prosecution Projections

3-4
Expected OA Rounds
33%
Grant Probability
87%
With Interview (+53.3%)
3y 10m (~0m remaining)
Median Time to Grant
Moderate
PTA Risk
Based on 865 resolved cases by this examiner. Grant probability derived from career allowance rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month