Prosecution Insights
Last updated: October 02, 2026
Application No. 17/997,252

LONG-ACTING GLP-1 AND GLUCAGON RECEPTOR DUAL AGONIST

Non-Final OA §112
Filed
Oct 27, 2022
Priority
Apr 29, 2020 — RE 10-2020-0052923 +1 more
Examiner
BOWLES, DAVID PAUL
Art Unit
1654
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
Dong-A St Co. Ltd.
OA Round
2 (Non-Final)
73%
Grant Probability
Favorable
2-3
OA Rounds
0m
Est. Remaining
95%
With Interview

Examiner Intelligence

Grants 73% — above average
73%
Career Allowance Rate
32 granted / 44 resolved
+12.7% vs TC avg
Strong +22% interview lift
Without
With
+22.4%
Interview Lift
resolved cases with interview
Typical timeline
3y 6m
Avg Prosecution
40 currently pending
Career history
86
Total Applications
across all art units

Statute-Specific Performance

§101
2.3%
-37.7% vs TC avg
§103
27.4%
-12.6% vs TC avg
§102
15.1%
-24.9% vs TC avg
§112
36.0%
-4.0% vs TC avg
Black line = Tech Center average estimate • Based on career data from 44 resolved cases

Office Action

§112
DETAILED ACTION Notice of Pre-AIA or AIA Status The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . Priority Receipt is acknowledged of certified copies of papers required by 37 CFR 1.55. Information Disclosure Statement The information disclosure statement (IDS) submitted on 12/30/2025 was filed after the mailing date of the non-final office action on 10/1/2025. The submission is in compliance with the provisions of 37 CFR 1.97. Accordingly, the information disclosure statement is being considered by the examiner. Claim Interpretation The claim language “An acylated oxyntomodulin peptide analog of the following Chemical Formula I” has been interpreted as “An acylated oxyntomodulin peptide analog consisting of the following Chemical Formula I” in light of the specification. Given the description of the specification and the claim language of claim 4, this is the broadest reasonable interpretation. Claim Objections Response to Arguments Applicant’s arguments, see Applicant Reply page 7, para. 3, filed 12/30/2025, with respect to the objection to claim 9 have been fully considered and are persuasive. The objection to claim 9 has been withdrawn. Claim Rejections - 35 USC § 112 Response to Arguments Applicant’s arguments, see Applicant Reply page 7, para. 5, filed 12/30/2025, with respect to the rejections of claim 9 under USC 112(a) have been fully considered and are persuasive. Therefore, the rejection has been withdrawn. However, upon further consideration, a new grounds of rejection is made. New Rejections Claims 9 and 10 are rejected under 35 U.S.C. 112(a) or 35 U.S.C. 112 (pre-AIA ), first paragraph, because the specification, while being enabling for treating obesity, overweight, obesity- related inflammation, obesity-related gallbladder disease, obesity-induced sleep apnea, and diabetes accompanied by obesity, metabolic syndrome, hypertension, arteriosclerosis-inducing dyslipidemia, atherosclerosis, arteriosclerosis, coronary heart disease, stroke, or non-insulin dependent diabetes mellitus, does not reasonably provide enablement preventing obesity, overweight, obesity- related inflammation, obesity-related gallbladder disease, obesity-induced sleep apnea, and diabetes accompanied by obesity, metabolic syndrome, hypertension, arteriosclerosis-inducing dyslipidemia, atherosclerosis, arteriosclerosis, coronary heart disease, stroke, or non-insulin dependent diabetes mellitus. The specification does not enable any person skilled in the art to which it pertains, or with which it is most nearly connected, to use the invention commensurate in scope with these claims. MPEP 2164.01(a) states: “In order to determine compliance with the enablement requirement of 35 U.S.C. 112(a), the Federal Circuit developed a framework of factors in In re Wands, 858 F.2d 731, 737, 8 USPQ2d 1400, 1404 (Fed. Cir. 1988), referred to as the Wands factors to assess whether any necessary experimentation required by the specification is ‘reasonable’ or is ‘undue.’” These factors include, but are not limited to: The breadth of the claims; Claims 9 and 10 are not particularly broad in terms of conditions to be treated, but the “preventing” refers to any action that suppresses or delays the onset of a target disease. The nature of the invention; The nature of the invention is a method for preventing or treating a variety of conditions: obesity, overweight, obesity- related inflammation, obesity-related gallbladder disease, obesity-induced sleep apnea, and diabetes accompanied by obesity, metabolic syndrome, hypertension, arteriosclerosis-inducing dyslipidemia, atherosclerosis, arteriosclerosis, coronary heart disease, stroke, or non-insulin dependent diabetes mellitus. The state of the prior art; Hruby et al. (Hruby, et al. Pharmacoeconomics 33.7: 673-689 (2015)) discloses various degrees of obesity such as Class 1, class 2, class 3. PNG media_image1.png 502 1251 media_image1.png Greyscale (Hruby et al., page 674 Table 1). Jastreboff et al. (Jastreboff, et al. New England Journal of Medicine 387.3: 205-216 (2022)) discloses the following results for a GLP-1/glucagon dual agonist: “At baseline, the mean body weight was 104.8 kg, the mean BMI was 38.0, and 94.5% of participants had a BMI of 30 or higher. The mean percentage change in weight at week 72 was −15.0% (95% confidence interval [CI], −15.9 to −14.2) with 5-mg weekly doses of tirzepatide, −19.5% (95% CI, −20.4 to −18.5) with 10-mg doses, and −20.9% (95% CI, −21.8 to −19.9) with 15-mg doses and −3.1% (95% CI, −4.3 to −1.9) with placebo (P<.0001 for all comparisons with placebo). The percentage of participants who had weight reduction of 5% or more was 85% (95% CI, 82 to 89), 89% (95% CI, 86 to 92), and 91% (95% CI, 88 to 94) with 5 mg, 10 mg, and 15 mg of tirzepatide, respectively, and 35% (95% CI, 30 to 39) with placebo; 50% (95% CI, 46 to 54) and 57% (95% CI, 53 to 61) of participants in the 10-mg and 15-mg groups had a reduction in body weight of 20% or more, as compared with 3% (95% CI, 1 to 5) in the placebo group.” (Jastreboff et al., page 205, para. 3). Jastreboff2 et al. (Jastreboff, et al. New England Journal of Medicine 392.10: 958-971 (2025)) discloses the following results for a GLP-1/glucagon dual agonist: “ Fewer participants received a diagnosis of type 2 diabetes in the tirzepatide groups than in the placebo group (1.3% vs. 13.3%; hazard ratio, 0.07; 95% confidence interval [CI], 0.0 to 0.1; P<0.001). After 17 weeks off treatment or placebo, 2.4% of the participants who received tirzepatide and 13.7% of those who received placebo had type 2 diabetes (hazard ratio, 0.12; 95% CI, 0.1 to 0.2; P<0.001).” (Jastreboff2 et al., page 958, para. 3). The level of one of ordinary skill; One of ordinary skill in the art is high; typically a master’s level education or higher. The level of predictability in the art; The predictability of protein-protein interactions is low. A single point mutation can change the biophysical properties of a peptide: “In summary, we have shown that the structural changes in the fibrillar state of the Aβ42 peptide that are observed to occur upon introduction of single point mutations can be accompanied by changes in the dominance of the microscopic processes by which these aggregates are themselves formed.” (Bolognesi et al. ACS Chem Bio 9:2 (2013) page 381 col. 2 para. 3) and “In summary, while ovispirin-1 and novispirin G-10 both had solution structures that were helical and amphipathic in the presence of TFE, a relatively simple change in their primary structure (a single glycine–isoleucine exchange) had profound effects on their respective toxicities for human erythrocytes and epithelial cells.” (Sawai et al. Protein Eng. 15:3 (2002) page 232 col. 1 para. 3). Furthermore, many sequences allowed by the current scope of the claims, result in non-functional aggregates. Wang (Wang, et al. MAbs. Vol. 1. No. 3. Taylor & Francis, (2009)) discloses a variety of aggregation prone motifs that occur in commercial antibodies (Wang, page 262, Table 2). The scope of the claims currently may incorporate such motifs and result in non-functional aggregates. The amount of direction provided by the inventor and the existence of working examples; and The quantity of experimentation needed to make or use the invention based on the content of the disclosure. Applicant does not provide data with respect to suppression of obesity (Claim 9) nor the suppression of non-insulin dependent diabetes mellitus (Claim 10). Regarding claim 9, Hruby discloses the ranges of obesity as described above. Jastreboff discloses that subjects with an average BMI of 38 averaged a 15% reduction in mass, yielding an average resultant BMI of 32.3, which is still obese as disclosed by Hruby. Due to this result and lack of data in the specification, it would require an undue amount of experimentation for a person of ordinary skill in the art to determine if the claimed molecules can effectively prevent obesity. Consequently, claim 9 is rejected. Regarding claim 10, Jastreboff2 et al. discloses above that 1.3% of subjects developed type 2 diabetes while being treated with a GLP-1/glucagon dual agonist and 2.4% of subjects developed type 2 diabetes after treatment. Due to this result and lack of data in the specification, it would require an undue amount of experimentation for a person of ordinary skill in the art to determine if the claimed molecules can effectively prevent non-insulin dependent diabetes mellitus (type 2 diabetes). Consequently, claim 10 is rejected. Examiner Note: Examiner is aware of the dates of Jastreboff and Jastreboff2. However, these references are illustrative of properties that a GLP-1/glucagon dual agonist would possess either before or after the effective filing date of the application. Closest Prior Art Regarding claims 1-8, Carrington et al. discloses SEQ ID NO: 60, which is aligned against Applicant SEQ ID NO: 2 below: SQ Sequence 32 AA; Query Match 83.4%; Score 151; Length 32; Best Local Similarity 90.3%; Matches 28; Conservative 0; Mismatches 3; Indels 0; Gaps 0; Qy 1 HXQGTFTSDXSKYLDXRRAQDFVQWLMNTKE 31 | ||||||| ||||| ||||||||||||||| Db 1 HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKE 31 This sequence lacks sufficient identity to render Applicant SEQ ID NO: 2 obvious and also doesn’t include the side chain modifications. Consequently, claims 1-8 are free of the prior art. Conclusion Claims 9 and 10 are rejected. Claims 1-8 are allowable. Any inquiry concerning this communication or earlier communications from the examiner should be directed to David Paul Bowles whose telephone number is (571)272-0919. The examiner can normally be reached Monday-Friday 8:30-5:00. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Lianko Garyu can be reached on (571) 270-7367. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /DAVID PAUL BOWLES/ Examiner, Art Unit 1654 /CHRISTINA BRADLEY/ Primary Examiner, Art Unit 1654
Read full office action

Prosecution Timeline

Oct 27, 2022
Application Filed
Oct 01, 2025
Non-Final Rejection mailed — §112
Dec 30, 2025
Response Filed
Apr 01, 2026
Non-Final Rejection mailed — §112 (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12703726
COMPOSITIONS AND METHODS FOR THE TREATMENT OF CYSTIC FIBROSIS
3y 9m to grant Granted Aug 11, 2026
Patent 12698307
NOVEL CELLULAR DELIVERY METHODS
4y 1m to grant Granted Aug 04, 2026
Patent 12648942
METHOD FOR TREATING ACUTE ISCHEMIC STROKE
2y 8m to grant Granted Jun 09, 2026
Patent 12629405
EZRIN PEPTIDE 1 FOR USE IN A METHOD OF TREATING COVID-19
3y 7m to grant Granted May 19, 2026
Patent 12594326
COMPOSITIONS OF GLP-1 PEPTIDES AND PREPARATION THEREOF
1y 1m to grant Granted Apr 07, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

Strategy Recommendation AI-generated — please review before filing

Get a prosecution strategy drawn from examiner precedents, rejection analysis, and claim mapping.
Typically takes 5-10 seconds — AI-generated, attorney review required before filing

Prosecution Projections

2-3
Expected OA Rounds
73%
Grant Probability
95%
With Interview (+22.4%)
3y 6m (~0m remaining)
Median Time to Grant
Moderate
PTA Risk
Based on 44 resolved cases by this examiner. Grant probability derived from career allowance rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month