Prosecution Insights
Last updated: April 19, 2026
Application No. 17/999,235

COMPOSITIONS AND METHODS FOR PREVENTION OF CORONAVIRUS INFECTION

Non-Final OA §103§112§DP
Filed
Nov 18, 2022
Examiner
KONOPELSKI SNAVEL, SARA ELIZABETH
Art Unit
1658
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
UNIVERSITY OF PITTSBURGH - OF THE COMMONWEALTH SYSTEM OF HIGHER EDUCATION
OA Round
1 (Non-Final)
33%
Grant Probability
At Risk
1-2
OA Rounds
3y 3m
To Grant
63%
With Interview

Examiner Intelligence

Grants only 33% of cases
33%
Career Allow Rate
6 granted / 18 resolved
-26.7% vs TC avg
Strong +30% interview lift
Without
With
+30.0%
Interview Lift
resolved cases with interview
Typical timeline
3y 3m
Avg Prosecution
53 currently pending
Career history
71
Total Applications
across all art units

Statute-Specific Performance

§101
7.7%
-32.3% vs TC avg
§103
27.3%
-12.7% vs TC avg
§102
18.3%
-21.7% vs TC avg
§112
25.7%
-14.3% vs TC avg
Black line = Tech Center average estimate • Based on career data from 18 resolved cases

Office Action

§103 §112 §DP
DETAILED ACTION Notice of Pre-AIA or AIA Status The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . Election/Restrictions Applicant’s election without traverse of Group II, claims 12-20, drawn to an intranasal spray formulation comprising a modified griffithsin polypeptide in the reply filed on 9/5/2025 is acknowledged. Applicant’s election of a griffithsin polypeptide wherein X1 is M, X2 is E, X3 is Q, X4 is S, X5 is A, X6 is I, and X7 is E; the compatible preservative is methylparaben; and the compatible viscosity modifier is hydroxyethyl cellulose (HEC) in the reply filed on 9/5/2025 is acknowledged. Because applicant did not distinctly and specifically point out the supposed errors in the restriction requirement, the election has been treated as an election without traverse (MPEP § 818.01(a)). Claim Status Claims 1-21 are pending. Claims 1-11, 16, and 21 are withdrawn as non-elected inventions (claims 1-11 and 21) and species (claim 16). Priority The instant application is the 371 national stage entry of PCT/US21/33009, filed 5/18/2022, which claims priority to provisional applications 63/070,375, filed 8/26/2020, and 63/026,375, filed 5/18/2020. The priority date of 5/18/2020 is acknowledged. Information Disclosure Statement The IDS’s submitted on 8/30/2023 and 8/1/2024 are under consideration. Any strikethrough is owed to lack of a copy in the file wrapper. Drawings The drawings are objected to because Figures 4 and 5 are illegible. Corrected drawing sheets in compliance with 37 CFR 1.121(d) are required in reply to the Office action to avoid abandonment of the application. Any amended replacement drawing sheet should include all of the figures appearing on the immediate prior version of the sheet, even if only one figure is being amended. The figure or figure number of an amended drawing should not be labeled as “amended.” If a drawing figure is to be canceled, the appropriate figure must be removed from the replacement sheet, and where necessary, the remaining figures must be renumbered and appropriate changes made to the brief description of the several views of the drawings for consistency. Additional replacement sheets may be necessary to show the renumbering of the remaining figures. Each drawing sheet submitted after the filing date of an application must be labeled in the top margin as either “Replacement Sheet” or “New Sheet” pursuant to 37 CFR 1.121(d). If the changes are not accepted by the examiner, the applicant will be notified and informed of any required corrective action in the next Office action. The objection to the drawings will not be held in abeyance. Nucleotide and/or Amino Acid Sequence Disclosures REQUIREMENTS FOR PATENT APPLICATIONS CONTAINING NUCLEOTIDE AND/OR AMINO ACID SEQUENCE DISCLOSURES Items 1) and 2) provide general guidance related to requirements for sequence disclosures. 37 CFR 1.821(c) requires that patent applications which contain disclosures of nucleotide and/or amino acid sequences that fall within the definitions of 37 CFR 1.821(a) must contain a "Sequence Listing," as a separate part of the disclosure, which presents the nucleotide and/or amino acid sequences and associated information using the symbols and format in accordance with the requirements of 37 CFR 1.821 - 1.825. This "Sequence Listing" part of the disclosure may be submitted: In accordance with 37 CFR 1.821(c)(1) via the USPTO patent electronic filing system (see Section I.1 of the Legal Framework for Patent Electronic System (https://www.uspto.gov/PatentLegalFramework), hereinafter "Legal Framework") as an ASCII text file, together with an incorporation-by-reference of the material in the ASCII text file in a separate paragraph of the specification as required by 37 CFR 1.823(b)(1) identifying: the name of the ASCII text file; ii) the date of creation; and iii) the size of the ASCII text file in bytes; In accordance with 37 CFR 1.821(c)(1) on read-only optical disc(s) as permitted by 37 CFR 1.52(e)(1)(ii), labeled according to 37 CFR 1.52(e)(5), with an incorporation-by-reference of the material in the ASCII text file according to 37 CFR 1.52(e)(8) and 37 CFR 1.823(b)(1) in a separate paragraph of the specification identifying: the name of the ASCII text file; the date of creation; and the size of the ASCII text file in bytes; In accordance with 37 CFR 1.821(c)(2) via the USPTO patent electronic filing system as a PDF file (not recommended); or In accordance with 37 CFR 1.821(c)(3) on physical sheets of paper (not recommended). When a “Sequence Listing” has been submitted as a PDF file as in 1(c) above (37 CFR 1.821(c)(2)) or on physical sheets of paper as in 1(d) above (37 CFR 1.821(c)(3)), 37 CFR 1.821(e)(1) requires a computer readable form (CRF) of the “Sequence Listing” in accordance with the requirements of 37 CFR 1.824. If the "Sequence Listing" required by 37 CFR 1.821(c) is filed via the USPTO patent electronic filing system as a PDF, then 37 CFR 1.821(e)(1)(ii) or 1.821(e)(2)(ii) requires submission of a statement that the "Sequence Listing" content of the PDF copy and the CRF copy (the ASCII text file copy) are identical. If the "Sequence Listing" required by 37 CFR 1.821(c) is filed on paper or read-only optical disc, then 37 CFR 1.821(e)(1)(ii) or 1.821(e)(2)(ii) requires submission of a statement that the "Sequence Listing" content of the paper or read-only optical disc copy and the CRF are identical. Specific deficiencies and the required response to this Office Action are as follows: Specific deficiency - This application fails to comply with the requirements of 37 CFR 1.821 - 1.825 because it does not contain a "Sequence Listing" as a separate part of the disclosure or a CRF of the “Sequence Listing.”. Required response - Applicant must provide: A "Sequence Listing" part of the disclosure; together with An amendment specifically directing its entry into the application in accordance with 37 CFR 1.825(a)(2); A statement that the "Sequence Listing" includes no new matter as required by 37 CFR 1.821(a)(4); and A statement that indicates support for the amendment in the application, as filed, as required by 37 CFR 1.825(a)(3). If the "Sequence Listing" part of the disclosure is submitted according to item 1) a) or b) above, Applicant must also provide: A substitute specification in compliance with 37 CFR 1.52, 1.121(b)(3) and 1.125 inserting the required incorporation-by-reference paragraph, consisting of: A copy of the previously-submitted specification, with deletions shown with strikethrough or brackets and insertions shown with underlining (marked-up version); A copy of the amended specification without markings (clean version); and A statement that the substitute specification contains no new matter. If the "Sequence Listing" part of the disclosure is submitted according to item 1) c) or d) above, applicant must also provide: A CRF in accordance with 37 CFR 1.821(e)(1) or 1.821(e)(2) as required by 1.825(a)(5); and A statement according to item 2) a) or b) above. Specific deficiency – Nucleotide and/or amino acid sequences appearing in the specification are not identified by sequence identifiers in accordance with 37 CFR 1.821(d). Required response – Applicant must provide: A substitute specification in compliance with 37 CFR 1.52, 1.121(b)(3) and 1.125 inserting the required sequence identifiers, consisting of: A copy of the previously-submitted specification, with deletions shown with strikethrough or brackets and insertions shown with underlining (marked-up version); A copy of the amended specification without markings (clean version); and A statement that the substitute specification contains no new matter. Specifically, see [0054] where a polypeptide sequence is disclosed without a SEQ ID NO. Specific deficiency – Nucleotide and/or amino acid sequences appearing in the drawings are not identified by sequence identifiers in accordance with 37 CFR 1.821(d). Sequence identifiers for nucleotide and/or amino acid sequences must appear either in the drawings or in the Brief Description of the Drawings. Required response – Applicant must provide: Replacement and annotated drawings in accordance with 37 CFR 1.121(d) inserting the required sequence identifiers; AND/OR A substitute specification in compliance with 37 CFR 1.52, 1.121(b)(3) and 1.125 inserting the required sequence identifiers into the Brief Description of the Drawings, consisting of: A copy of the previously-submitted specification, with deletions shown with strikethrough or brackets and insertions shown with underlining (marked-up version); A copy of the amended specification without markings (clean version); and A statement that the substitute specification contains no new matter. SEQ ID NO should appear in either the Brief Description of the Drawings or the Drawings themselves. Specific deficiency - The Incorporation by Reference paragraph required by 37 CFR 1.821(c)(1) is missing or incomplete. See item 1) a) or 1) b) above. Required response – Applicant must provide: A substitute specification in compliance with 37 CFR 1.52, 1.121(b)(3) and 1.125 inserting the required incorporation-by-reference paragraph, consisting of: A copy of the previously-submitted specification, with deletions shown with strikethrough or brackets and insertions shown with underlining (marked-up version); A copy of the amended specification without markings (clean version); and A statement that the substitute specification contains no new matter. Specification The title of the invention is not descriptive. A new title is required that is clearly indicative of the invention to which the claims are directed. The following title is suggested: Griffithsin polypeptides, compositions, and methods for prevention of coronavirus infection. Claim Objections Claims 17 is objected to because of the following informality: The claim lists an amino acid sequence with 4 or more specifically defined and enumerated residues and therefore requires a SEQ ID NO. However, no SEQ ID NO is listed in the claim. See MPEP 2422 and 37 C.F.R. 1.821. Appropriate correction is required. Claim Rejections - 35 USC § 112 The following is a quotation of 35 U.S.C. 112(b): (b) CONCLUSION.—The specification shall conclude with one or more claims particularly pointing out and distinctly claiming the subject matter which the inventor or a joint inventor regards as the invention. The following is a quotation of 35 U.S.C. 112 (pre-AIA ), second paragraph: The specification shall conclude with one or more claims particularly pointing out and distinctly claiming the subject matter which the applicant regards as his invention. Claims 12 and 15-20 are rejected under 35 U.S.C. 112(b) or 35 U.S.C. 112 (pre-AIA ), second paragraph, as being indefinite for failing to particularly point out and distinctly claim the subject matter which the inventor or a joint inventor (or for applications subject to pre-AIA 35 U.S.C. 112, the applicant), regards as the invention. Claim 12 recites the limitations “compatible preservative” or “compatible viscosity modifier”. It is unclear whether “compatible” refers to a preservative or viscosity modifier that is compatible with the griffithsin polypeptide or compatible with the subject receiving the intranasal spray formulation. As there are no definitions in the instant specification, the scope of claim 12 is indefinite. Moreover, by virtue of their dependency on claim 12, claims 15 and 17-20 are hereby also rejected for this same reasoning. For purposes of examination, a “compatible” preservative or viscosity modifier will be interpreted as being compatible with the griffithsin polypeptide. A broad range or limitation together with a narrow range or limitation that falls within the broad range or limitation (in the same claim) may be considered indefinite if the resulting claim does not clearly set forth the metes and bounds of the patent protection desired. See MPEP § 2173.05(c). In the present instance, claim 15 recites the broad recitation “about 7.5mg/mL”, and the claim also recites “about 0.1mg/mL” which is the narrower statement of the range/limitation. The claim(s) are considered indefinite because there is a question or doubt as to whether the feature introduced by such narrower language is (a) merely exemplary of the remainder of the claim, and therefore not required, or (b) a required feature of the claims. Claims 17 and 18 are further rejected here as they do not define X7 (final line of claim 17), thus rendering the scope of both claims indefinite. Claim Rejections - 35 USC § 103 In the event the determination of the status of the application as subject to AIA 35 U.S.C. 102 and 103 (or as subject to pre-AIA 35 U.S.C. 102 and 103) is incorrect, any correction of the statutory basis (i.e., changing from AIA to pre-AIA ) for the rejection will not be considered a new ground of rejection if the prior art relied upon, and the rationale supporting the rejection, would be the same under either status. The following is a quotation of 35 U.S.C. 103 which forms the basis for all obviousness rejections set forth in this Office action: A patent for a claimed invention may not be obtained, notwithstanding that the claimed invention is not identically disclosed as set forth in section 102, if the differences between the claimed invention and the prior art are such that the claimed invention as a whole would have been obvious before the effective filing date of the claimed invention to a person having ordinary skill in the art to which the claimed invention pertains. Patentability shall not be negated by the manner in which the invention was made. The factual inquiries for establishing a background for determining obviousness under 35 U.S.C. 103 are summarized as follows: 1. Determining the scope and contents of the prior art. 2. Ascertaining the differences between the prior art and the claims at issue. 3. Resolving the level of ordinary skill in the pertinent art. 4. Considering objective evidence present in the application indicating obviousness or nonobviousness. This application currently names joint inventors. In considering patentability of the claims the examiner presumes that the subject matter of the various claims was commonly owned as of the effective filing date of the claimed invention(s) absent any evidence to the contrary. Applicant is advised of the obligation under 37 CFR 1.56 to point out the inventor and effective filing dates of each claim that was not commonly owned as of the effective filing date of the later invention in order for the examiner to consider the applicability of 35 U.S.C. 102(b)(2)(C) for any potential 35 U.S.C. 102(a)(2) prior art against the later invention. Claim(s) 12-15 and 17-20 rejected under 35 U.S.C. 103 as being unpatentable over O’Keefe et al. (WO 2016/130628 A1, published 8/18/2016) and Kulkarni et al. (Formulation and characterization of nasal sprays, as appeared in Inhalation, June 2012). O’Keefe teaches griffithsin polypeptides and methods of inhibiting viral infection (Abstract). As part of the method for prophylactically or therapeutically inhibiting a viral infection, particularly a coronavirus (e.g. SARS or MERS), O’Keefe teaches topically administering to the host an effective amount of a griffithsin polypeptide or composition thereof to the host, preferably as an aerosol or microparticulate powder ([0051]). O’Keefe does not teach that the griffithsin polypeptide is formulated as an intranasal spray including a compatible preservative and a compatible viscosity modifier. Kulkarni teaches nasal spray formulation parameters and their influence on key in vitro tests (Abstract). Kulkarni teaches that the nasal cavity of an average adult has substantial surface area and is highly vascularized with microvilli epithelial cells, conferring quick bioavailability and fast onset of drug action (Pg 1, left column). Critical parameters affecting nasal spray formulation performance and bioavailability include physical properties of formulations, pH and buffer, osmolality, viscosity, excipient selection, and improving the resistance time in the nasal cavity, all of which can impact nasal spray plumes (entire document). In particular, viscosity impacts residence time of the spray in the nasal cavity (Pg 2, “Viscosity”), and preservatives are important for maintaining non-sterile products (Pg 2, “Excipient selection”). Thus, it is important to choose the appropriate excipients and maintain their optimum levels in a given formulation (Pg 5, Conclusion). Thus, regarding claim 12, O’Keefe teaches griffithsin polypeptides and compositions useful for preventing and/or treating coronavirus infections that can be administered to subjects via aerosols and microparticulate powder. Kulkarni teaches that administration of drugs to the nasal cavity has biological advantages and parameters such as viscosity and preservative selection are important to consider. Therefore, it would be prima facie obvious to formulate a nasal spray comprising a griffithsin polypeptide so that it can be more easily and rapidly administered to treat respiratory infections (coronaviruses). One skilled in the art would have a reasonable expectation of success as it was known that griffithsin polypeptide could be formulated as aerosols and/or microparticulate powder, as taught by O’Keefe, and other drugs could be formulated and administered intranasally to treat other respiratory diseases, such as the common cold, as taught by Kulkarni. Regarding claim 13, Kulkarni teaches methylparaben as a preservative (Table 2). Regarding claim 14, Kulkarni teaches hydroxymethylcellulose (HEC) is a muco-adhesive and gelling agent (“Improving residence time in the nasal cavity”, Pg 2). Regarding claim 15, O’Keefe teaches solutions of griffithsin polypeptide mutants with concentrations >6mg/ml ([0076 and Table 3]). Regarding claims 17 and 18, O’Keefe teaches the same griffithsin polypeptide formula ([0005]). O’Keefe teaches SEQ ID NO: 18, which is the same as the elected species wherein X1 is M, X2 is E, X3 is Q, X4 is S, X5 is A, X6 is I, and X7 is E (Sequence Listing). Regarding claim 19, Kulkarni teaches hydrochloric acid as a pH adjusting agent (Table 2). Regarding claim 20, Kulkarni teaches that intranasal spray doses are administered via nasal spray devices (“Characterization of nasal sprays”, left column of Pg 4). Double Patenting The nonstatutory double patenting rejection is based on a judicially created doctrine grounded in public policy (a policy reflected in the statute) so as to prevent the unjustified or improper timewise extension of the “right to exclude” granted by a patent and to prevent possible harassment by multiple assignees. A nonstatutory double patenting rejection is appropriate where the conflicting claims are not identical, but at least one examined application claim is not patentably distinct from the reference claim(s) because the examined application claim is either anticipated by, or would have been obvious over, the reference claim(s). See, e.g., In re Berg, 140 F.3d 1428, 46 USPQ2d 1226 (Fed. Cir. 1998); In re Goodman, 11 F.3d 1046, 29 USPQ2d 2010 (Fed. Cir. 1993); In re Longi, 759 F.2d 887, 225 USPQ 645 (Fed. Cir. 1985); In re Van Ornum, 686 F.2d 937, 214 USPQ 761 (CCPA 1982); In re Vogel, 422 F.2d 438, 164 USPQ 619 (CCPA 1970); In re Thorington, 418 F.2d 528, 163 USPQ 644 (CCPA 1969). A timely filed terminal disclaimer in compliance with 37 CFR 1.321(c) or 1.321(d) may be used to overcome an actual or provisional rejection based on nonstatutory double patenting provided the reference application or patent either is shown to be commonly owned with the examined application, or claims an invention made as a result of activities undertaken within the scope of a joint research agreement. See MPEP § 717.02 for applications subject to examination under the first inventor to file provisions of the AIA as explained in MPEP § 2159. See MPEP § 2146 et seq. for applications not subject to examination under the first inventor to file provisions of the AIA . A terminal disclaimer must be signed in compliance with 37 CFR 1.321(b). The filing of a terminal disclaimer by itself is not a complete reply to a nonstatutory double patenting (NSDP) rejection. A complete reply requires that the terminal disclaimer be accompanied by a reply requesting reconsideration of the prior Office action. Even where the NSDP rejection is provisional the reply must be complete. See MPEP § 804, subsection I.B.1. For a reply to a non-final Office action, see 37 CFR 1.111(a). For a reply to final Office action, see 37 CFR 1.113(c). A request for reconsideration while not provided for in 37 CFR 1.113(c) may be filed after final for consideration. See MPEP §§ 706.07(e) and 714.13. The USPTO Internet website contains terminal disclaimer forms which may be used. Please visit www.uspto.gov/patent/patents-forms. The actual filing date of the application in which the form is filed determines what form (e.g., PTO/SB/25, PTO/SB/26, PTO/AIA /25, or PTO/AIA /26) should be used. A web-based eTerminal Disclaimer may be filled out completely online using web-screens. An eTerminal Disclaimer that meets all requirements is auto-processed and approved immediately upon submission. For more information about eTerminal Disclaimers, refer to www.uspto.gov/patents/apply/applying-online/eterminal-disclaimer. Claims 12-14 and 17-20 are rejected on the ground of nonstatutory double patenting as being unpatentable over claims 1, 2, 10, 11, and 13-16 of U.S. Patent No. US10,501,507 (‘507) in view of Kulkarni et al. (Formulation and characterization of nasal sprays, as appeared in Inhalation, June 2012). Although the claims at issue are not identical, they are not patentably distinct from each other because they contain overlapping subject matter. Claim 1 of US ‘507 recites a polypeptide comprising the amino acid sequence of SLTHRKFGGSGGSPFSGLSSIAVRSGSYLDAIIIDGVHHGGSGGNLSPTFTFGSGEYISN X1TIRSGDYIDNISFX2TNX3GRRFGPYGGSGGSANTLSNVKVIQINGX4X5GDYLDSLD X6YYX7QY (SEQ ID NO: 1), wherein X1 can be M or V, X2 is Q, X3 can be M, A, K, V, F, L, I, Q, R, or G, X4 can be S or R, X5 can be A or S, X6 can be I or F, and X7 can be E or Q provided that the polypeptide does not comprise the amino acid sequence of SEQ ID NO: 2. SEQ ID NO: 1 reads on the sequence recited in claims 17 and 18. Dependent claims include additional variants of the polypeptide (claims 2, 14, 15, and 16), a composition thereof (claim 10), and methods of prophylactically or therapeutically treating a viral infection (claims 11, 13). US ‘507 does not teach that the polypeptide or composition thereof is formulated as a nasal spray. Kulkarni teaches nasal spray formulation parameters and their influence on key in vitro tests. In particular, viscosity impacts residence time of the spray in the nasal cavity, and preservatives are important to maintain non-sterile products. Therefore, it is important to choose the appropriate excipients and maintain their optimum levels in a given formulation. Therefore, it would be prima facie obvious to one of ordinary skill in the art to incorporate the teachings of Kulkarni into US ‘507, thereby arriving at the instant invention. One skilled in the art would have a reasonable expectation of success as Kulkarni teaches means to formulate effective nasal sprays. Thus, the claims are obvious in view of US ‘507. Claims 12-14 and 17-20 are rejected on the ground of nonstatutory double patenting as being unpatentable over claims 1 of U.S. Patent No. US11,339,195 (‘195) in view of Kulkarni et al. (Formulation and characterization of nasal sprays, as appeared in Inhalation, June 2012). Although the claims at issue are not identical, they are not patentably distinct from each other because they contain overlapping subject matter. Claim 1 of US ‘195 recites a polypeptide consisting of the amino acid sequence SEQ ID NO: 18. SEQ ID NO: 18 is identical to the elected species, recited in instant claims 17 and 18. US ‘195 does not teach that the polypeptide is formulated as a nasal spray. Kulkarni teaches nasal spray formulation parameters and their influence on key in vitro tests. In particular, viscosity impacts residence time of the spray in the nasal cavity, and preservatives are important to maintain non-sterile products. Therefore, it is important to choose the appropriate excipients and maintain their optimum levels in a given formulation. Therefore, it would be prima facie obvious to one of ordinary skill in the art to incorporate the teachings of Kulkarni into US ‘195, thereby arriving at the instant invention. One skilled in the art would have a reasonable expectation of success as Kulkarni teaches means to formulate effective nasal sprays. Thus, the claims are obvious in view of US ‘195. Claims 12-14 and 17-20 are rejected on the ground of nonstatutory double patenting as being unpatentable over claims 1, 2 and 7-12 of U.S. Patent No. US12,384,820 (‘820) in view of Kulkarni et al. (Formulation and characterization of nasal sprays, as appeared in Inhalation, June 2012). Although the claims at issue are not identical, they are not patentably distinct from each other because they contain overlapping subject matter. Claim 1 of US ‘820 recites a polypeptide comprising the amino acid sequence of SLTHRKFGGSGGSPFSGLSSIAVRSGSYLDAIIIDGVHHGGSGGNLSPTFTFGSGE YISNX1TIRSGDYIDNISFX2TNX3GRRFGPYGGSGGSANTLSNVKVIQINGX4X5GDYLDSLD X6YYX7QY (SEQ ID NO: 1), wherein X1 can be M or V, X2 can be E or Q, X3 can be M, A, K, V, F, L, I, Q, R, or G, X4 can be S or R, X5 can be A or S, X6 can be I or F, and X7 can be E or Q; provided that the polypeptide does not comprise the amino acid sequence of SEQ ID NO: 2; and provided that the polypeptide does not include any amino acid preceding the initial serine (S) recited as the first amino acid in SEQ ID NO: 1; and wherein X3 is Q. SEQ ID NO: 1 reads on the sequence recited in claims 17 and 18. Dependent claims include additional variants of SEQ ID NO: 1 (claims 2 and 7-12). US ‘820 does not teach that the polypeptide is formulated as a nasal spray. Kulkarni teaches nasal spray formulation parameters and their influence on key in vitro tests. In particular, viscosity impacts residence time of the spray in the nasal cavity, and preservatives are important to maintain non-sterile products. Therefore, it is important to choose the appropriate excipients and maintain their optimum levels in a given formulation. Therefore, it would be prima facie obvious to one of ordinary skill in the art to incorporate the teachings of Kulkarni into US ‘820, thereby arriving at the instant invention. One skilled in the art would have a reasonable expectation of success as Kulkarni teaches means to formulate effective nasal sprays. Thus, the claims are obvious in view of US ‘820. Claims 12-14 and 17-20 are provisionally rejected on the ground of nonstatutory double patenting as being unpatentable over claims 1 and 3 of copending Application No. 18/030,174 (‘174; claim set filed 4/4/2023) in view of O’Keefe et al. (WO 2016/130628 A1, published 8/18/2016) and Kulkarni et al. (Formulation and characterization of nasal sprays, as appeared in Inhalation, June 2012). In Sun Pharmaceutical Industries Ltd. v. Eli Lilly and Co., 95 USPQ2d 1797 (Fed. Cir. 2010), the Court determined that Claims of a later patent were held invalid for obviousness-type double patenting when the earlier patent claimed a compound and disclosed its utility in specification, and later patent claimed a method of using compound for use described in specification of earlier patent. Claim 1 of copending Application No. ‘174 recites a method of treating or preventing a Rhabdoviridae virus infection in a mammal comprising administering griffithsin, or a fragment or mutant thereof, to the mammal. Dependent claims include the griffithsin polypeptide sequence and variants thereof (claim 3) that read on the polypeptides recited in instant claims 17 and 18. Copending Application No. ‘174 does not teach that the polypeptide is formulated as a nasal spray. O’Keefe teaches griffithsin polypeptides and methods of inhibiting viral infection. Kulkarni teaches nasal spray formulation parameters and their influence on key in vitro tests. In particular, viscosity impacts residence time of the spray in the nasal cavity, and preservatives are important to maintain non-sterile products. Therefore, it is important to choose the appropriate excipients and maintain their optimum levels in a given formulation. Therefore, it would be prima facie obvious to one of ordinary skill in the art to incorporate the teachings of O’Keefe and Kulkarni into copending Application No. ‘174, thereby arriving at the instant invention. One skilled in the art would have a reasonable expectation of success as O’Keefe teaches that griffithsin polypeptides can be used to prevent and treat a multitude of viral infections and Kulkarni teaches means to formulate effective nasal sprays. Thus, the claims are obvious in view of copending Application No. ‘174. This is a provisional nonstatutory double patenting rejection. Conclusion No claim is allowed. Any inquiry concerning this communication or earlier communications from the examiner should be directed to Sara E Konopelski Snavely whose telephone number is (571)272-1841. The examiner can normally be reached Monday - Friday 9-6pm EST. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Melissa L Fisher can be reached at 571-270-7430. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /SARA E KONOPELSKI SNAVELY/Examiner, Art Unit 1658 /FRED H REYNOLDS/Primary Examiner, Art Unit 1658
Read full office action

Prosecution Timeline

Nov 18, 2022
Application Filed
Nov 18, 2025
Non-Final Rejection — §103, §112, §DP (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12577278
KRAS G12V Mutant Binds to JAK1, Inhibitors, Pharmaceutical Compositions, and Methods Related Thereto
2y 5m to grant Granted Mar 17, 2026
Patent 12486303
NOVEL USE OF PEPTIDE FOR INHIBITING FUNCTIONS AND EXPRESSIONS OF MULTIPLE DISEASE BIOMARKERS
2y 5m to grant Granted Dec 02, 2025
Patent 12441769
POLYPEPTIDE, PHOTORESIST COMPOSITION INCLUDING THE SAME, AND METHOD OF FORMING PATTERN USING THE SAME
2y 5m to grant Granted Oct 14, 2025
Study what changed to get past this examiner. Based on 3 most recent grants.

AI Strategy Recommendation

Get an AI-powered prosecution strategy using examiner precedents, rejection analysis, and claim mapping.
Powered by AI — typically takes 5-10 seconds

Prosecution Projections

1-2
Expected OA Rounds
33%
Grant Probability
63%
With Interview (+30.0%)
3y 3m
Median Time to Grant
Low
PTA Risk
Based on 18 resolved cases by this examiner. Grant probability derived from career allow rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month