Prosecution Insights
Last updated: October 02, 2026
Application No. 18/005,086

POLYNUCLEOTIDE ENCODING AN AMINO ACID SEQUENCE, ENCODING AN OXIDOREDUCTASE

Final Rejection §102
Filed
Jan 11, 2023
Priority
Jul 15, 2020 — EU 20185930.3 +1 more
Examiner
ROBINSON, HOPE A
Art Unit
1652
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
Evonik Operations GmbH
OA Round
2 (Final)
68%
Grant Probability
Favorable
3-4
OA Rounds
0m
Est. Remaining
99%
With Interview

Examiner Intelligence

Grants 68% — above average
68%
Career Allowance Rate
715 granted / 1056 resolved
+7.7% vs TC avg
Strong +43% interview lift
Without
With
+43.1%
Interview Lift
resolved cases with interview
Typical timeline
3y 3m
Avg Prosecution
59 currently pending
Career history
1123
Total Applications
across all art units

Statute-Specific Performance

§101
6.7%
-33.3% vs TC avg
§103
19.8%
-20.2% vs TC avg
§102
17.0%
-23.0% vs TC avg
§112
50.0%
+10.0% vs TC avg
Black line = Tech Center average estimate • Based on career data from 1056 resolved cases

Office Action

§102
DETAILED ACTION Notice of Pre-AIA or AIA Status 1. The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . 2. The Amendment filed on May 26, 2026, has been received and entered. Claim Disposition 3. Claims 2-3 has been canceled. Claims 1 and 4-18 are pending. Claims 1, 4, 6-8, 10-11, 13-15 and 18 are under examination. Claims 5, 9, 12 and 16-17 are withdrawn from further consideration pursuant to 37 CFR 1.12(b), as being drawn to a non-elected invention, there being no allowable generic or linking claim. The claims are only being examined to the extent that they pertain to the elected subject matter and species. Claim objection 4. Claims 1, 4, 6-8, 10-11,13-15 and 18 are objected to for the following informalities: For clarity and precision of claim language it is suggested that claim 1 is amended to recite “mutation” in lieu of “exchange”. The dependent claims hereto is also included (see claim 4 with similar language). For clarity it is suggested that claims 4, 6-8, 10-11, 13-15 and 18 are amended to recite, “of” instead of “according to”. For clarity it is suggested that claim 6 is amended to read, “…..wherein the polynucleotide…….and wherein protein sequences……”. For clarity and precision of claim language it is suggested that claim 11 is amended to read, “…claim 10, [[which is suitable]] for replication…..”. Appropriate correction is required. Claim Rejections - 35 USC § 102 The following is a quotation of the appropriate paragraphs of 35 U.S.C. 102 that form the basis for the rejections under this section made in this Office action: A person shall be entitled to a patent unless – (a)(1) the claimed invention was patented, described in a printed publication, or in public use, on sale, or otherwise available to the public before the effective filing date of the claimed invention. 5. Claim(s) 1 and 4 is/are rejected under 35 U.S.C. 102 (a)(1) as being anticipated by Hawumba et al. (Curr. Microbiol., 55(6), pages 480-484, 2007). The claimed invention is directed to a polynucleotide encoding an amino acid sequence, encoding an oxidoreductase that is greater than 90% identical to the amino acid sequence of SEQ ID NO: 1 with mutations in recited 13 positions. The reference discloses a 4-HPA hydroxylase from Geobacillus sp. Note that the alignment below from Hawumba et al. has complimentary amino acids in the positions thus an amino acid exchange. Therefore, the limitations of the claims are met by the reference. RESULT 1 AY549312 LOCUS AY549312 1485 bp DNA linear BCT 29-OCT-2007 DEFINITION Geobacillus sp. PA-9 4-hydroxyphenylacetic acid 3-hydroxylase (pheH) gene, complete cds. ACCESSION AY549312 VERSION AY549312.1 KEYWORDS . SOURCE Geobacillus sp. PA-9 ORGANISM Geobacillus sp. PA-9 Bacteria; Bacillati; Bacillota; Bacilli; Bacillales; Anoxybacillaceae; Geobacillus. REFERENCE 1 (bases 1 to 1485) AUTHORS Hawumba,J.F., Brozel,V.S. and Theron,J. TITLE Cloning and characterization of a 4-hydroxyphenylacetate 3-hydroxylase from the thermophile Geobacillus sp. PA-9 JOURNAL Curr. Microbiol. 55 (6), 480-484 (2007) PUBMED 17805928 REFERENCE 2 (bases 1 to 1485) AUTHORS Hawumba,J.F., Theron,J. and Brozel,V.S. TITLE Direct Submission JOURNAL Submitted (17-FEB-2004) Biochemistry Department, Makerere University, Kampala 0256, Uganda FEATURES Location/Qualifiers source 1..1485 /organism="Geobacillus sp. PA-9" /mol_type="genomic DNA" /strain="PA-9" /isolation_source="hot spring" /db_xref="taxon:278858" /geo_loc_name="Uganda: Buranga" gene 1..1485 /gene="pheH" CDS 1..1485 /gene="pheH" /function="catalyzes the conversion of 4-hydroxyphenylacetic acid to 3,4-dihydroxyphenyl acetic acid" /note="PheH" /codon_start=1 /transl_table=11 /product="4-hydroxyphenylacetic acid 3-hydroxylase" /protein_id="AAT28189.1" /translation="MKMPAKTGKEYMERLKQAKSSVYIHGEKVEDVTVHPAFRNVVRS MAALYDRQYEKPEKMLYRSPTTGQPVGMTFIQPTTIDELIARREATQEWARMSAGMMG RSPDYLNAEVMAMGIANDLFAEDDPMFAENAKNYYEYAREHDISLTHTLIHPQMNRAK ALHEQNDADVPLHLVERRKDGIIVSGIRLLATQGGITDEILVFPSTVKKATSGEDPYA LAFAIPNNTPGVKFICREAFDYGRSAWDHPLASRFEEGDAIVSFENVFVPWERVFVCG NSSICNRTFRETNAVVHMSHQVVAKNIVKTEFLLGVTLCLIEAIGIGEFQHVKDKGAE IMLVLETMKSHLYRAEHNAKRDRWGTMTPDFAALDAARNWYPRIYPRLAEIIRILGAS GLMAIPTEADFQHEEIGDIVRRAMQGATVDGYERVQLFRLAWDLTMSAFGARQTHYEY YFFGDPVRMGMAYFDGYEKEPYKQFVREFLRGAKSVFIPADNKH Alignment Scores: Length: 1485 Score: 2544.00 Matches: 481 Percent Similarity: 100.0% Conservative: 13 Best Local Similarity: 97.4% Mismatches: 0 Query Match: 100.0% Indels: 0 Gaps: 0 18005086_1_X_SUBS (1-494) x AY549312 (1-1485) Qy 1 MetLysMetProAlaLysThrGlyLysGluTyrMetGluArgLeuLysGlnAlaLysSer 20 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 ATGAAAATGCCGGCCAAAACAGGAAAGGAGTATATGGAGCGGCTCAAGCAGGCGAAAAGC 60 Qy 21 SerValTyrIleHisGlyGluLysValGluAspValThrValHisProAlaPheArgAsn 40 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 AGCGTGTACATCCACGGGGAAAAAGTGGAGGATGTCACCGTTCATCCCGCGTTCCGCAAC 120 Qy 41 ValValArgSerMetAlaAlaLeuTyrAspArgGlnTyrGluLysProGluLysMetLeu 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 GTCGTCCGCTCGATGGCGGCGCTTTACGACCGGCAATACGAAAAGCCGGAGAAGATGTTG 180 Qy 61 TyrArgSerProThrThrGlyGlnProValGlyMetThrPheIleGlnProThrThrIle 80 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 TACCGGTCGCCGACAACCGGGCAGCCGGTCGGGATGACGTTCATTCAGCCAACTACGATT 240 Qy 81 AspGluLeuIleAlaArgArgGluAlaThrGlnGluTrpAlaArgMetSerAlaGlyMet 100 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 GACGAGCTCATCGCCCGCCGCGAGGCGACGCAAGAGTGGGCGCGGATGTCGGCCGGAATG 300 Qy 101 MetGlyArgSerProAspTyrLeuAsnAlaGluValMetAlaMetGlyIleAlaAsnAsp 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 ATGGGGCGCTCGCCTGATTATTTGAATGCCGAAGTCATGGCGATGGGCATCGCCAACGAT 360 Qy 121 LeuPheAlaGluAspAspProMetPheAlaGluAsnAlaLysAsnTyrTyrGluTyrAla 140 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 TTGTTTGCCGAAGACGATCCGATGTTTGCCGAAAATGCGAAAAACTATTATGAATACGCG 420 Qy 141 ArgGluHisAspIleSerLeuThrHisThrLeuIleHisProGlnMetAsnArgAlaLys 160 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 421 CGGGAACACGACATCAGCTTGACGCATACGCTCATCCATCCGCAAATGAACCGCGCCAAG 480 Qy 161 AlaLeuHisGluGlnAsnAspAlaAspValProLeuHisLeuValGluArgArgLysAsp 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 481 GCGCTGCACGAACAAAACGATGCCGATGTGCCGCTTCATTTGGTGGAACGGCGCAAAGAC 540 Qy 181 GlyIleIleValSerGlyIleArgLeuLeuAlaThrGlnGlyGlyIleThrAspGluIle 200 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 541 GGGATCATCGTCAGCGGCATCCGCCTATTGGCGACGCAAGGCGGCATCACCGATGAAATT 600 Qy 201 Leu***************************************AspProTyrAlaLeuAla 220 |||:::::::::::::::::::::::::::::::::::::::|||||||||||||||||| Db 601 TTAGTGTTTCCCTCGACCGTGAAAAAAGCGACATCCGGCGAAGACCCATATGCGCTTGCC 660 Qy 221 PheAlaIleProAsnAsnThrProGlyValLysPheIleCysArgGluAlaPheAspTyr 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 661 TTTGCCATTCCGAACAATACGCCAGGCGTGAAGTTCATTTGCCGCGAGGCGTTTGACTAC 720 Qy 241 GlyArgSerAlaTrpAspHisProLeuAlaSerArgPheGluGluGlyAspAlaIleVal 260 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 721 GGGCGGAGCGCGTGGGATCATCCGCTGGCATCGCGTTTTGAGGAAGGCGATGCGATCGTT 780 Qy 261 SerPheGluAsnValPheValProTrpGluArgValPheValCysGlyAsnSerSerIle 280 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 781 TCGTTTGAAAATGTGTTTGTGCCGTGGGAGCGCGTGTTTGTGTGCGGCAATTCATCGATT 840 Qy 281 CysAsnArgThrPheArgGluThrAsnAlaValValHisMetSerHisGlnValValAla 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 841 TGCAACCGGACGTTCCGGGAAACGAACGCGGTTGTTCATATGTCCCATCAAGTCGTGGCG 900 Qy 301 LysAsnIleValLysThrGluPheLeuLeuGlyValThrLeuCysLeuIleGluAlaIle 320 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 901 AAAAACATCGTCAAAACGGAGTTTTTGCTTGGCGTCACCCTTTGCCTCATCGAAGCGATC 960 Qy 321 GlyIleGlyGluPheGlnHisValLysAspLysGlyAlaGluIleMetLeuValLeuGlu 340 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 961 GGCATCGGCGAGTTCCAGCATGTGAAAGACAAAGGGGCGGAAATCATGCTCGTCCTCGAG 1020 Qy 341 ThrMetLysSerHisLeuTyrArgAlaGluHisAsnAlaLysArgAspArgTrpGlyThr 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1021 ACGATGAAAAGCCATTTGTACCGGGCCGAGCACAATGCGAAGCGAGACCGTTGGGGAACG 1080 Qy 361 MetThrProAspPheAlaAlaLeuAspAlaAlaArgAsnTrpTyrProArgIleTyrPro 380 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1081 ATGACGCCCGATTTTGCCGCGCTCGATGCCGCGCGCAACTGGTATCCGCGCATTTATCCG 1140 Qy 381 ArgLeuAlaGluIleIleArgIleLeuGlyAlaSerGlyLeuMetAlaIleProThrGlu 400 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1141 CGCCTGGCGGAGATCATCCGCATTTTAGGGGCATCGGGGTTGATGGCGATTCCGACGGAG 1200 Qy 401 AlaAspPheGlnHisGluGluIleGlyAspIleValArgArgAlaMetGlnGlyAlaThr 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1201 GCGGATTTTCAGCACGAGGAAATTGGCGACATCGTTCGCCGGGCGATGCAAGGGGCGACG 1260 Qy 421 ValAspGlyTyrGluArgValGlnLeuPheArgLeuAlaTrpAspLeuThrMetSerAla 440 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1261 GTGGACGGCTATGAGCGCGTCCAGCTGTTCCGGCTCGCCTGGGATCTCACGATGAGCGCG 1320 Qy 441 PheGlyAlaArgGlnThrHisTyrGluTyrTyrPhePheGlyAspProValArgMetGly 460 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1321 TTCGGCGCCCGGCAGACGCATTACGAATATTACTTTTTCGGCGACCCCGTTCGGATGGGG 1380 Qy 461 MetAlaTyrPheAspGlyTyrGluLysGluProTyrLysGlnPheValArgGluPheLeu 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1381 ATGGCGTATTTCGATGGCTACGAAAAAGAGCCGTATAAACAGTTCGTGCGCGAATTTTTG 1440 Qy 481 ArgGlyAlaLysSerValPheIleProAlaAspAsnLysHis 494 |||||||||||||||||||||||||||||||||||||||||| Db 1441 CGCGGCGCCAAAAGCGTGTTCATTCCGGCTGACAACAAGCAT 1482 Response to Arguments 6. Applicant’s comments have been considered in full. Withdrawn objections/rejections will not be discussed herein as applicant’s comments are moot. Note that the rejection under 102 remains but has been altered based on amendments made to the claims for the reasons stated above and here. Applicant traverses the rejection and state that the claims have been amended. The rejection is newly applied to the clarified claim language. Conclusion 7. No claims are presently allowable. 8. Applicant’s amendment necessitated the new/modified ground(s) of rejection presented in this Office action. Accordingly, THIS ACTION IS MADE FINAL. See MPEP § 706.07(a). Applicant is reminded of the extension of time policy as set forth in 37 CFR 1.136(a). A shortened statutory period for reply to this final action is set to expire THREE MONTHS from the mailing date of this action. In the event a first reply is filed within TWO MONTHS of the mailing date of this final action and the advisory action is not mailed until after the end of the THREE-MONTH shortened statutory period, then the shortened statutory period will expire on the date the advisory action is mailed, and any extension fee pursuant to 37 CFR 1.136(a) will be calculated from the mailing date of the advisory action. In no event, however, will the statutory period for reply expire later than SIX MONTHS from the date of this final action. Any inquiry concerning this communication or earlier communications from the examiner should be directed to HOPE A ROBINSON whose telephone number is (571) 272-0957. The examiner can normally be reached 9-5pm on Monday to Friday. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Robert Mondesi can be reached on (408) 918-7584. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /HOPE A ROBINSON/Primary Examiner, Art Unit 1652
Read full office action

Prosecution Timeline

Jan 11, 2023
Application Filed
Feb 18, 2026
Examiner Interview (Telephonic)
Feb 24, 2026
Non-Final Rejection mailed — §102
May 26, 2026
Response Filed
Aug 03, 2026
Final Rejection mailed — §102 (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12723241
CHIMERIC THERMOSTABLE AMINOACYL-TRNA SYNTHETASE FOR ENHANCED UNNATURAL AMINO ACID INCORPORATION
4y 4m to grant Granted Sep 01, 2026
Patent 12715898
MOLECULAR PEPTIDE MUTANT
3y 2m to grant Granted Aug 25, 2026
Patent 12703859
NOVEL BRANCHED-CHAIN AMINO ACID AMINOTRANSFERASE VARIANT AND METHOD FOR PRODUCING ISOLEUCINE USING THE SAME
3y 2m to grant Granted Aug 11, 2026
Patent 12679862
Hemp Seed Protein Pickering Particles as well as Preparation Method and Application Thereof
2y 10m to grant Granted Jul 14, 2026
Patent 12644108
METHOD OF PRODUCING COLLAGENASE
3y 3m to grant Granted Jun 02, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

Strategy Recommendation AI-generated — please review before filing

Get a prosecution strategy drawn from examiner precedents, rejection analysis, and claim mapping.
Typically takes 5-10 seconds — AI-generated, attorney review required before filing

Prosecution Projections

3-4
Expected OA Rounds
68%
Grant Probability
99%
With Interview (+43.1%)
3y 3m (~0m remaining)
Median Time to Grant
Moderate
PTA Risk
Based on 1056 resolved cases by this examiner. Grant probability derived from career allowance rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month