Prosecution Insights
Last updated: April 19, 2026
Application No. 18/011,856

HIGH AFFINITY ANTIBODIES TARGETING TAU PHOSPHORYLATED AT SERINE 413

Non-Final OA §112§DP
Filed
Dec 21, 2022
Examiner
WANG, CHANG YU
Art Unit
1675
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
Merck Sharp Dohme LLC
OA Round
1 (Non-Final)
34%
Grant Probability
At Risk
1-2
OA Rounds
4y 1m
To Grant
86%
With Interview

Examiner Intelligence

Grants only 34% of cases
34%
Career Allow Rate
287 granted / 850 resolved
-26.2% vs TC avg
Strong +52% interview lift
Without
With
+52.5%
Interview Lift
resolved cases with interview
Typical timeline
4y 1m
Avg Prosecution
93 currently pending
Career history
943
Total Applications
across all art units

Statute-Specific Performance

§101
4.2%
-35.8% vs TC avg
§103
26.5%
-13.5% vs TC avg
§102
18.8%
-21.2% vs TC avg
§112
32.5%
-7.5% vs TC avg
Black line = Tech Center average estimate • Based on career data from 850 resolved cases

Office Action

§112 §DP
Notice of Pre-AIA or AIA Status The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . Nucleotide and/or Amino Acid Sequence Disclosures REQUIREMENTS FOR PATENT APPLICATIONS CONTAINING NUCLEOTIDE AND/OR AMINO ACID SEQUENCE DISCLOSURES Items 1) and 2) provide general guidance related to requirements for sequence disclosures. 37 CFR 1.821(c) requires that patent applications which contain disclosures of nucleotide and/or amino acid sequences that fall within the definitions of 37 CFR 1.821(a) must contain a "Sequence Listing," as a separate part of the disclosure, which presents the nucleotide and/or amino acid sequences and associated information using the symbols and format in accordance with the requirements of 37 CFR 1.821 - 1.825. This "Sequence Listing" part of the disclosure may be submitted: In accordance with 37 CFR 1.821(c)(1) via the USPTO patent electronic filing system (see Section I.1 of the Legal Framework for Patent Electronic System (https://www.uspto.gov/PatentLegalFramework), hereinafter "Legal Framework") as an ASCII text file, together with an incorporation-by-reference of the material in the ASCII text file in a separate paragraph of the specification as required by 37 CFR 1.823(b)(1) identifying: the name of the ASCII text file; ii) the date of creation; and iii) the size of the ASCII text file in bytes; In accordance with 37 CFR 1.821(c)(1) on read-only optical disc(s) as permitted by 37 CFR 1.52(e)(1)(ii), labeled according to 37 CFR 1.52(e)(5), with an incorporation-by-reference of the material in the ASCII text file according to 37 CFR 1.52(e)(8) and 37 CFR 1.823(b)(1) in a separate paragraph of the specification identifying: the name of the ASCII text file; the date of creation; and the size of the ASCII text file in bytes; In accordance with 37 CFR 1.821(c)(2) via the USPTO patent electronic filing system as a PDF file (not recommended); or In accordance with 37 CFR 1.821(c)(3) on physical sheets of paper (not recommended). When a “Sequence Listing” has been submitted as a PDF file as in 1(c) above (37 CFR 1.821(c)(2)) or on physical sheets of paper as in 1(d) above (37 CFR 1.821(c)(3)), 37 CFR 1.821(e)(1) requires a computer readable form (CRF) of the “Sequence Listing” in accordance with the requirements of 37 CFR 1.824. If the "Sequence Listing" required by 37 CFR 1.821(c) is filed via the USPTO patent electronic filing system as a PDF, then 37 CFR 1.821(e)(1)(ii) or 1.821(e)(2)(ii) requires submission of a statement that the "Sequence Listing" content of the PDF copy and the CRF copy (the ASCII text file copy) are identical. If the "Sequence Listing" required by 37 CFR 1.821(c) is filed on paper or read-only optical disc, then 37 CFR 1.821(e)(1)(ii) or 1.821(e)(2)(ii) requires submission of a statement that the "Sequence Listing" content of the paper or read-only optical disc copy and the CRF are identical. Specific deficiencies and the required response to this Office Action are as follows: Specific deficiency – Nucleotide and/or amino acid sequences appearing in the drawings (Figures 1A-1B) are not identified by sequence identifiers in accordance with 37 CFR 1.821(d). Sequence identifiers for nucleotide and/or amino acid sequences must appear either in the drawings or in the Brief Description of the Drawings. Required response – Applicant must provide: Replacement and annotated drawings in accordance with 37 CFR 1.121(d) inserting the required sequence identifiers; AND/OR A substitute specification in compliance with 37 CFR 1.52, 1.121(b)(3) and 1.125 inserting the required sequence identifiers into the Brief Description of the Drawings, consisting of: A copy of the previously-submitted specification, with deletions shown with strikethrough or brackets and insertions shown with underlining (marked-up version); A copy of the amended specification without markings (clean version); and A statement that the substitute specification contains no new matter. DETAILED ACTION Status of Application/Election/Restrictions Applicant’s election without traverse of Group I (claims 34-39 and 51-52), SEQ ID NO:63 for constant region and SEQ ID NO:74 for heavy chain in the reply filed on September 24, 205 is acknowledged. Claims 1-33 are canceled. Claims 34-58 are pending in this application. Claims 40-50 and 53-58 are withdrawn from further consideration pursuant to 37 CFR 1.142(b) as being drawn to nonelected inventions, there being no allowable generic or linking claim. Upon reconsideration, the species election of different sequences of SEQ ID NOs: 72, 74 and 76 for a heavy chain and different sequences of SEQ ID NOs: 60, 63 and 68 for a heavy chain constant region is withdrawn. The subject matter to the extent of SEQ ID NOs: 72 and 76, and SEQ ID NOs: 60 and 68 is included and under examination in this office action. Election was made without traverse in the reply filed on September 24, 205. Claims 34-39 and 51-52 are under examination in this office action. Drawings The drawings are objected to as failing to comply with 37 CFR 1.84(p)(5) because they do not include the following reference sign(s) mentioned in the description: no sequence identification has been provided for the nucleic acid sequences presented in Figures 1A-1B of the instant specification. Corrected drawing sheets in compliance with 37 CFR 1.121(d) are required in reply to the Office action to avoid abandonment of the application. Any amended replacement drawing sheet should include all of the figures appearing on the immediate prior version of the sheet, even if only one figure is being amended. Each drawing sheet submitted after the filing date of an application must be labeled in the top margin as either “Replacement Sheet” or “New Sheet” pursuant to 37 CFR 1.121(d). If the changes are not accepted by the examiner, the applicant will be notified and informed of any required corrective action in the next Office action. The objection to the drawings will not be held in abeyance. Claim Objections Claims 34-39 and 51-52 are objected to because of the following informalities: The recitations “tau-pS413”, “VH”, “VH-CDR1”, “VH-CDR2”, “VH-CDR3”, “VL”, “VL-CDR1”, “VL-CDR2” and “VL-CDR3” are not unique abbreviations in the art. Applicants are required to spell out “tau-pS413”, “VH”, “VH-CDR1”, “VH-CDR2”, “VH-CDR3”, “VL”, “VL-CDR1”, “VL-CDR2” and “VL-CDR3” at the first usage. Appropriate correction is required. Claim Rejections - 35 USC § 112 The following is a quotation of 35 U.S.C. 112(b): (b) CONCLUSION.—The specification shall conclude with one or more claims particularly pointing out and distinctly claiming the subject matter which the inventor or a joint inventor regards as the invention. The following is a quotation of 35 U.S.C. 112 (pre-AIA ), second paragraph: The specification shall conclude with one or more claims particularly pointing out and distinctly claiming the subject matter which the applicant regards as his invention. Claims 34-39 and 51-52 are rejected under 35 U.S.C. 112(b) or 35 U.S.C. 112 (pre-AIA ), second paragraph, as being indefinite for failing to particularly point out and distinctly claim the subject matter which the inventor or a joint inventor, or for pre-AIA the applicant regards as the invention. Claims 34-39 and 51-52 are indefinite because: i. The term “tau-pS413” is recited in claims 34 and 51 without a reference to a precise amino acid sequence identified by a proper SEQ ID NO: or providing a full name for abbreviated names. Without identification of property or combination of properties which are unique to and, therefore, definitive of the instant recitations, the metes and bounds of the claims remain undetermined. Further, the use of laboratory designations only to identify a particular molecule renders the claims indefinite because different laboratories may use the same laboratory designations to define completely distinct molecules. The rejection can be obviated by amending the claims to specifically and uniquely identify “tau-pS413”, for example, by SEQ ID NO: and function of “tau-pS413”. ii. Claim 51 recites the limitation "the lysine residue" in line 3 of the claim. There is insufficient antecedent basis for this limitation in the claim. iii. The rest of claims are indefinite as depending from an indefinite claim. Double Patenting The nonstatutory double patenting rejection is based on a judicially created doctrine grounded in public policy (a policy reflected in the statute) so as to prevent the unjustified or improper timewise extension of the “right to exclude” granted by a patent and to prevent possible harassment by multiple assignees. A nonstatutory double patenting rejection is appropriate where the conflicting claims are not identical, but at least one examined application claim is not patentably distinct from the reference claim(s) because the examined application claim is either anticipated by, or would have been obvious over, the reference claim(s). See, e.g., In re Berg, 140 F.3d 1428, 46 USPQ2d 1226 (Fed. Cir. 1998); In re Goodman, 11 F.3d 1046, 29 USPQ2d 2010 (Fed. Cir. 1993); In re Longi, 759 F.2d 887, 225 USPQ 645 (Fed. Cir. 1985); In re Van Ornum, 686 F.2d 937, 214 USPQ 761 (CCPA 1982); In re Vogel, 422 F.2d 438, 164 USPQ 619 (CCPA 1970); In re Thorington, 418 F.2d 528, 163 USPQ 644 (CCPA 1969). A timely filed terminal disclaimer in compliance with 37 CFR 1.321(c) or 1.321(d) may be used to overcome an actual or provisional rejection based on nonstatutory double patenting provided the reference application or patent either is shown to be commonly owned with the examined application, or claims an invention made as a result of activities undertaken within the scope of a joint research agreement. See MPEP § 717.02 for applications subject to examination under the first inventor to file provisions of the AIA as explained in MPEP § 2159. See MPEP § 2146 et seq. for applications not subject to examination under the first inventor to file provisions of the AIA . A terminal disclaimer must be signed in compliance with 37 CFR 1.321(b). The filing of a terminal disclaimer by itself is not a complete reply to a nonstatutory double patenting (NSDP) rejection. A complete reply requires that the terminal disclaimer be accompanied by a reply requesting reconsideration of the prior Office action. Even where the NSDP rejection is provisional the reply must be complete. See MPEP § 804, subsection I.B.1. For a reply to a non-final Office action, see 37 CFR 1.111(a). For a reply to final Office action, see 37 CFR 1.113(c). A request for reconsideration while not provided for in 37 CFR 1.113(c) may be filed after final for consideration. See MPEP §§ 706.07(e) and 714.13. The USPTO Internet website contains terminal disclaimer forms which may be used. Please visit www.uspto.gov/patent/patents-forms. The actual filing date of the application in which the form is filed determines what form (e.g., PTO/SB/25, PTO/SB/26, PTO/AIA /25, or PTO/AIA /26) should be used. A web-based eTerminal Disclaimer may be filled out completely online using web-screens. An eTerminal Disclaimer that meets all requirements is auto-processed and approved immediately upon submission. For more information about eTerminal Disclaimers, refer to www.uspto.gov/patents/apply/applying-online/eterminal-disclaimer. Claims 34-39 and 51-52 are rejected on the ground of nonstatutory double patenting as being unpatentable over claims 1-33 of U.S. Patent No. 11702467. Although the claims at issue are not identical, they are not patentably distinct from each other because the anti-pSer413 Tau antibody recited in the claims of US11702467 (the ‘467 patent) anticipates the claimed anti-pSer413 Tau antibody recited in instant claims. Claims 1-33 of the ‘467 patent claims an antibody or antigen binding fragment thereof that binds to tau-pS413, comprising VH-CDRs1-3 and VL-CDRs1-3, wherein the VH-CDRs1-3 comprise SEQ ID NOs:53-55 respectively and the VL-CDRs1-3 comprise SEQ ID NOs: 33-35 respectively (recited in (q) of claim 1, claims 5 and 21),or the VHCDR1-3 of VH comprising SEQ ID NO:56 and VLCDR1-3 of VL comprising SEQ ID NO:36 (recited in (rr) of claim 1, claims 5 and 22) or wherein the antibody or antigen-binding fragment comprises a VH having at least 90% identical to SEQ ID NO:56 and a VL having at least 90% identical to SEQ ID NO:36 (recited in (q) of claim 2) or a VH having the amino acid sequence of SEQ ID NO:56 and a VL having the amino acid sequence of SEQ ID NO:36 (recited in (q) of claim 3, claim 6), or wherein the antibody comprises a heavy chain constant region having the amino acid sequence of SEQ ID NO: 60, 63 or 68 and a light chain constant region having the amino acid sequence of SEQ ID NO:58 (recited in claim 4), or wherein the antibody comprises a light chain (LC) and a heavy chain, wherein the LC and HC comprise the amino acid sequences of SEQ ID NOs:71 and 72 respectively or the sequences of SEQ ID NOs:73 and 74 respectively or the sequences of SEQ ID NOs: 75 and 76 respectively (claims 7 and 23 and 30) and methods of treating tauopathy, decreasing the amount of tau-pS413 and DNA encoding and methods of making the claimed antibody. The sequences of SEQ ID NOs: 33-35 and SEQ ID NO:53-55 recited in the ‘247 patent are identical to instant SEQ ID NOs: 33-35 and 53-55 for LCDRs1-3 and HCDRs1-3 of the claimed anti-tau-pS413 antibody respectively (see the sequence alignment below). The sequences of SEQ ID NOs: 36 and 56 recited in the ‘247 patent are identical to instant SEQ ID NOs: 36 and 56 for VL and VH of the claimed anti-tau-pS413 antibody respectively (see the sequence alignment below). The sequences of SEQ ID NOs: 71 and 72 recited in the ‘247 patent are identical to instant SEQ ID NOs: 73 and 72 for LC and HC of the claimed anti-tau-pS413 antibody respectively, and the sequence of SEQ ID NO: 58 for a LC constant region and SEQ ID NO: 60, 63 or 68 for a HC constant region of an anti-tau-pS413 antibody recited in the ‘247 patent are identical to instant SEQ ID NO:58, 60, 63 and 68 respectively (see the sequence alignment below). Thus, the anti-tau-pS413 antibody comprising SEQ ID NOs:33-35 and 53-55 for LCDRs1-3 and HCDRs1-3, SEQ ID NOs: 36 and 56 for VL and VL and SEQ ID NOs: 72 and 71 for HC and LC and having SEQ ID NO:58 for a LC constant region and SEQ ID NO:60, 63 or 68 recited in the claims of the ‘247 patent meets the limitations recited instant claims and anticipate instant claims. Therefore, Claims 34-39 and 51-52 of instant Application are not patentably distinct from claims 1-33 of the ‘247 patent because claims 34-39 and 51-52 of instant Application anticipated by claims 1-33 of the ‘247 patent. SEQ ID NO:33-SEQ ID NO:34-SEQ ID NO:35 US-17-355-529-36 Sequence 36, US/17355529 Patent No. 11702467 GENERAL INFORMATION APPLICANT: Merck Sharp & Dohme Corp. APPLICANT: Baker, Jeanne E. APPLICANT: Parmentier Batteur, Sophie APPLICANT: Cheng, Alan C. APPLICANT: Chen, Ming-Tang APPLICANT: Hsieh, Chung-Ming APPLICANT: Mieczkowski, Carl APPLICANT: Suon, Sokreine TITLE OF INVENTION: HIGH AFFINITY ANTIBODIES TARGETING TAU PHOSPHORYLATED AT SERINE TITLE OF INVENTION: 413 FILE REFERENCE: 24996-US-NP CURRENT APPLICATION NUMBER: US/17/355,529 CURRENT FILING DATE: 2021-06-23 PRIOR APPLICATION NUMBER: 63/044,291 PRIOR FILING DATE: 2020-06-25 NUMBER OF SEQ ID NOS: 109 SEQ ID NO 36 LENGTH: 112 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: VL46_G34A_S28K_S32R_H98Y, VL Query Match 84.8%; Score 138.3; Length 112; Best Local Similarity 40.5%; Matches 32; Conservative 0; Mismatches 0; Indels 47; Gaps 2; Qy 1 RSSQKIVHRNANTYLE---------------TVSNRFS---------------------- 23 |||||||||||||||| ||||||| Db 24 RSSQKIVHRNANTYLEWYLQKPGQSPQLLIYTVSNRFSGVPDRFSGSGSGTDFTLKISRV 83 Qy 24 ----------FQGSYLPLT 32 ||||||||| Db 84 EAEDLGVYYCFQGSYLPLT 102 SEQ ID NO:73 US-17-355-529-71 (NOTE: this sequence has 2 duplicates in the database searched) Sequence 71, US/17355529 Patent No. 11702467 GENERAL INFORMATION APPLICANT: Merck Sharp & Dohme Corp. APPLICANT: Baker, Jeanne E. APPLICANT: Parmentier Batteur, Sophie APPLICANT: Cheng, Alan C. APPLICANT: Chen, Ming-Tang APPLICANT: Hsieh, Chung-Ming APPLICANT: Mieczkowski, Carl APPLICANT: Suon, Sokreine TITLE OF INVENTION: HIGH AFFINITY ANTIBODIES TARGETING TAU PHOSPHORYLATED AT SERINE TITLE OF INVENTION: 413 FILE REFERENCE: 24996-US-NP CURRENT APPLICATION NUMBER: US/17/355,529 CURRENT FILING DATE: 2021-06-23 PRIOR APPLICATION NUMBER: 63/044,291 PRIOR FILING DATE: 2020-06-25 NUMBER OF SEQ ID NOS: 109 SEQ ID NO 71 LENGTH: 219 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: V8-AFM-hIgG1 LALA, light chain Query Match 100.0%; Score 1137; Length 219; Best Local Similarity 100.0%; Matches 219; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 DIVMTQSPLSLPVTLGEPASISCRSSQKIVHRNANTYLEWYLQKPGQSPQLLIYTVSNRF 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 DIVMTQSPLSLPVTLGEPASISCRSSQKIVHRNANTYLEWYLQKPGQSPQLLIYTVSNRF 60 Qy 61 SGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSYLPLTFGGGTKVEIKRTVAAPSV 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 SGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSYLPLTFGGGTKVEIKRTVAAPSV 120 Qy 121 FIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSL 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 FIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSL 180 Qy 181 SSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 219 ||||||||||||||||||||||||||||||||||||||| Db 181 SSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 219 SEQ ID NO:36 US-17-355-529-36 Sequence 36, US/17355529 Patent No. 11702467 GENERAL INFORMATION APPLICANT: Merck Sharp & Dohme Corp. APPLICANT: Baker, Jeanne E. APPLICANT: Parmentier Batteur, Sophie APPLICANT: Cheng, Alan C. APPLICANT: Chen, Ming-Tang APPLICANT: Hsieh, Chung-Ming APPLICANT: Mieczkowski, Carl APPLICANT: Suon, Sokreine TITLE OF INVENTION: HIGH AFFINITY ANTIBODIES TARGETING TAU PHOSPHORYLATED AT SERINE TITLE OF INVENTION: 413 FILE REFERENCE: 24996-US-NP CURRENT APPLICATION NUMBER: US/17/355,529 CURRENT FILING DATE: 2021-06-23 PRIOR APPLICATION NUMBER: 63/044,291 PRIOR FILING DATE: 2020-06-25 NUMBER OF SEQ ID NOS: 109 SEQ ID NO 36 LENGTH: 112 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: VL46_G34A_S28K_S32R_H98Y, VL Query Match 100.0%; Score 584; Length 112; Best Local Similarity 100.0%; Matches 112; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 DIVMTQSPLSLPVTLGEPASISCRSSQKIVHRNANTYLEWYLQKPGQSPQLLIYTVSNRF 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 DIVMTQSPLSLPVTLGEPASISCRSSQKIVHRNANTYLEWYLQKPGQSPQLLIYTVSNRF 60 Qy 61 SGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSYLPLTFGGGTKVEIK 112 |||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 SGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSYLPLTFGGGTKVEIK 112 SEQ ID NO:53-SEQ ID NO:54-SEQ ID NO:55 US-17-355-529-56 Sequence 56, US/17355529 Patent No. 11702467 GENERAL INFORMATION APPLICANT: Merck Sharp & Dohme Corp. APPLICANT: Baker, Jeanne E. APPLICANT: Parmentier Batteur, Sophie APPLICANT: Cheng, Alan C. APPLICANT: Chen, Ming-Tang APPLICANT: Hsieh, Chung-Ming APPLICANT: Mieczkowski, Carl APPLICANT: Suon, Sokreine TITLE OF INVENTION: HIGH AFFINITY ANTIBODIES TARGETING TAU PHOSPHORYLATED AT SERINE TITLE OF INVENTION: 413 FILE REFERENCE: 24996-US-NP CURRENT APPLICATION NUMBER: US/17/355,529 CURRENT FILING DATE: 2021-06-23 PRIOR APPLICATION NUMBER: 63/044,291 PRIOR FILING DATE: 2020-06-25 NUMBER OF SEQ ID NOS: 109 SEQ ID NO 56 LENGTH: 121 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: VH11_K54E_A59V_D68G, VH Query Match 86.8%; Score 161.4; Length 121; Best Local Similarity 42.5%; Matches 34; Conservative 0; Mismatches 0; Indels 46; Gaps 2; Qy 1 SFALN--------------HIRSETNNYVTFYAASVKG---------------------- 24 ||||| ||||||||||||||||||| Db 31 SFALNWVRQAPGKGLEWVGHIRSETNNYVTFYAASVKGRFTVSRDDSQNTAYLQMNSLKT 90 Qy 25 ----------RGPRDSWFGY 34 |||||||||| Db 91 EDTATYYCVRRGPRDSWFGY 110 SEQ ID NO:72 US-17-355-529-72 Sequence 72, US/17355529 Patent No. 11702467 GENERAL INFORMATION APPLICANT: Merck Sharp & Dohme Corp. APPLICANT: Baker, Jeanne E. APPLICANT: Parmentier Batteur, Sophie APPLICANT: Cheng, Alan C. APPLICANT: Chen, Ming-Tang APPLICANT: Hsieh, Chung-Ming APPLICANT: Mieczkowski, Carl APPLICANT: Suon, Sokreine TITLE OF INVENTION: HIGH AFFINITY ANTIBODIES TARGETING TAU PHOSPHORYLATED AT SERINE TITLE OF INVENTION: 413 FILE REFERENCE: 24996-US-NP CURRENT APPLICATION NUMBER: US/17/355,529 CURRENT FILING DATE: 2021-06-23 PRIOR APPLICATION NUMBER: 63/044,291 PRIOR FILING DATE: 2020-06-25 NUMBER OF SEQ ID NOS: 109 SEQ ID NO 72 LENGTH: 451 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: V8-AFM-hIgG1 LALA, heavy chain Query Match 100.0%; Score 2411; Length 451; Best Local Similarity 100.0%; Matches 451; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 EVQLVESGGGLVQPGGSLRLSCAASGFTFSSFALNWVRQAPGKGLEWVGHIRSETNNYVT 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 EVQLVESGGGLVQPGGSLRLSCAASGFTFSSFALNWVRQAPGKGLEWVGHIRSETNNYVT 60 Qy 61 FYAASVKGRFTVSRDDSQNTAYLQMNSLKTEDTATYYCVRRGPRDSWFGYWGQGTLVTVS 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 FYAASVKGRFTVSRDDSQNTAYLQMNSLKTEDTATYYCVRRGPRDSWFGYWGQGTLVTVS 120 Qy 121 SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS 180 Qy 181 SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEAAG 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEAAG 240 Qy 241 GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY 300 Qy 301 NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD 360 Qy 361 ELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 ELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR 420 Qy 421 WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 451 ||||||||||||||||||||||||||||||| Db 421 WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 451 SEQ ID NO:74 US-17-355-529-74 Sequence 74, US/17355529 Patent No. 11702467 GENERAL INFORMATION APPLICANT: Merck Sharp & Dohme Corp. APPLICANT: Baker, Jeanne E. APPLICANT: Parmentier Batteur, Sophie APPLICANT: Cheng, Alan C. APPLICANT: Chen, Ming-Tang APPLICANT: Hsieh, Chung-Ming APPLICANT: Mieczkowski, Carl APPLICANT: Suon, Sokreine TITLE OF INVENTION: HIGH AFFINITY ANTIBODIES TARGETING TAU PHOSPHORYLATED AT SERINE TITLE OF INVENTION: 413 FILE REFERENCE: 24996-US-NP CURRENT APPLICATION NUMBER: US/17/355,529 CURRENT FILING DATE: 2021-06-23 PRIOR APPLICATION NUMBER: 63/044,291 PRIOR FILING DATE: 2020-06-25 NUMBER OF SEQ ID NOS: 109 SEQ ID NO 74 LENGTH: 451 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: V8-AFM-hIgG1 LALA YTE, heavy chain Query Match 100.0%; Score 2414; Length 451; Best Local Similarity 100.0%; Matches 451; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 EVQLVESGGGLVQPGGSLRLSCAASGFTFSSFALNWVRQAPGKGLEWVGHIRSETNNYVT 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 EVQLVESGGGLVQPGGSLRLSCAASGFTFSSFALNWVRQAPGKGLEWVGHIRSETNNYVT 60 Qy 61 FYAASVKGRFTVSRDDSQNTAYLQMNSLKTEDTATYYCVRRGPRDSWFGYWGQGTLVTVS 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 FYAASVKGRFTVSRDDSQNTAYLQMNSLKTEDTATYYCVRRGPRDSWFGYWGQGTLVTVS 120 Qy 121 SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS 180 Qy 181 SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEAAG 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEAAG 240 Qy 241 GPSVFLFPPKPKDTLYITREPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 GPSVFLFPPKPKDTLYITREPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY 300 Qy 301 NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD 360 Qy 361 ELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 ELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR 420 Qy 421 WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 451 ||||||||||||||||||||||||||||||| Db 421 WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 451 SEQ ID NO:76 US-17-355-529-76 Sequence 76, US/17355529 Patent No. 11702467 GENERAL INFORMATION APPLICANT: Merck Sharp & Dohme Corp. APPLICANT: Baker, Jeanne E. APPLICANT: Parmentier Batteur, Sophie APPLICANT: Cheng, Alan C. APPLICANT: Chen, Ming-Tang APPLICANT: Hsieh, Chung-Ming APPLICANT: Mieczkowski, Carl APPLICANT: Suon, Sokreine TITLE OF INVENTION: HIGH AFFINITY ANTIBODIES TARGETING TAU PHOSPHORYLATED AT SERINE TITLE OF INVENTION: 413 FILE REFERENCE: 24996-US-NP CURRENT APPLICATION NUMBER: US/17/355,529 CURRENT FILING DATE: 2021-06-23 PRIOR APPLICATION NUMBER: 63/044,291 PRIOR FILING DATE: 2020-06-25 NUMBER OF SEQ ID NOS: 109 SEQ ID NO 76 LENGTH: 448 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: V8-AFM-hIgG4, light chain Query Match 100.0%; Score 2390; Length 448; Best Local Similarity 100.0%; Matches 448; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 EVQLVESGGGLVQPGGSLRLSCAASGFTFSSFALNWVRQAPGKGLEWVGHIRSETNNYVT 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 EVQLVESGGGLVQPGGSLRLSCAASGFTFSSFALNWVRQAPGKGLEWVGHIRSETNNYVT 60 Qy 61 FYAASVKGRFTVSRDDSQNTAYLQMNSLKTEDTATYYCVRRGPRDSWFGYWGQGTLVTVS 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 FYAASVKGRFTVSRDDSQNTAYLQMNSLKTEDTATYYCVRRGPRDSWFGYWGQGTLVTVS 120 Qy 121 SASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 SASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS 180 Qy 181 SGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPS 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 SGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPS 240 Qy 241 VFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNST 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 VFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNST 300 Qy 301 YRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMT 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 YRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMT 360 Qy 361 KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQE 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQE 420 Qy 421 GNVFSCSVMHEALHNHYTQKSLSLSLGK 448 |||||||||||||||||||||||||||| Db 421 GNVFSCSVMHEALHNHYTQKSLSLSLGK 448 SEQ ID NO:56 US-17-355-529-56 Sequence 56, US/17355529 Patent No. 11702467 GENERAL INFORMATION APPLICANT: Merck Sharp & Dohme Corp. APPLICANT: Baker, Jeanne E. APPLICANT: Parmentier Batteur, Sophie APPLICANT: Cheng, Alan C. APPLICANT: Chen, Ming-Tang APPLICANT: Hsieh, Chung-Ming APPLICANT: Mieczkowski, Carl APPLICANT: Suon, Sokreine TITLE OF INVENTION: HIGH AFFINITY ANTIBODIES TARGETING TAU PHOSPHORYLATED AT SERINE TITLE OF INVENTION: 413 FILE REFERENCE: 24996-US-NP CURRENT APPLICATION NUMBER: US/17/355,529 CURRENT FILING DATE: 2021-06-23 PRIOR APPLICATION NUMBER: 63/044,291 PRIOR FILING DATE: 2020-06-25 NUMBER OF SEQ ID NOS: 109 SEQ ID NO 56 LENGTH: 121 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: VH11_K54E_A59V_D68G, VH Query Match 100.0%; Score 644; Length 121; Best Local Similarity 100.0%; Matches 121; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 EVQLVESGGGLVQPGGSLRLSCAASGFTFSSFALNWVRQAPGKGLEWVGHIRSETNNYVT 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 EVQLVESGGGLVQPGGSLRLSCAASGFTFSSFALNWVRQAPGKGLEWVGHIRSETNNYVT 60 Qy 61 FYAASVKGRFTVSRDDSQNTAYLQMNSLKTEDTATYYCVRRGPRDSWFGYWGQGTLVTVS 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 FYAASVKGRFTVSRDDSQNTAYLQMNSLKTEDTATYYCVRRGPRDSWFGYWGQGTLVTVS 120 Qy 121 S 121 | Db 121 S 121 Conclusion NO CLAIM IS ALLOWED. The prior art made of record and not relied upon is considered pertinent to applicant's disclosure. US10556950 teaches a humanized anti-tau antibody comprising a heavy chain (HC) and a light chain (LC), wherein HC comprises the amino acid sequence of SEQ ID NO:145, which is 99.4% identical to instant SEQ ID NO:72 and wherein the HC comprises HCDR1 of instant SEQ ID NO:53 and HCDR3 of instant SEQ ID NO: 55 but does not comprises HCDR2 of instant SEQ ID NO:54, and wherein the LC comprises the amino acid sequence of SEQ ID NO:166, which is 98.6 identical to instant SEQ ID NO:73 and wherein the LC which comprises LCDR2 of instant SEQ ID NO:34 but does not comprise LCDR1 of instant SEQ ID NO:33 and LCDR3 of instant SEQ ID NO:35 (see the sequence alignment below). SEQ ID NO:53-SEQ ID NO:54-SEQ ID NO:55 US-15-906-773A-134 (NOTE: this sequence has 2 duplicates in the database searched) Sequence 134, US/15906773A Patent No. 10556950 GENERAL INFORMATION APPLICANT: EGUCHI, Hiroshi APPLICANT: MURAKAMI, Takashi APPLICANT: NAMIKI, Naoko APPLICANT: TANOKURA, Akira APPLICANT: BAKER, Jeanne E. APPLICANT: PARMENTIER BATTEUR, Sophie APPLICANT: JABLONSKI, Angela Marie APPLICANT: MALASHOCK, Daniel Stephen APPLICANT: MIECZKOWSKI, Carl APPLICANT: RAGHUNATHAN, Gopalan (Raghu) TITLE OF INVENTION: HUMANIZED ANTIBODY FOR TREATING OR PREVENTING COGNITIVE TITLE OF INVENTION: DISORDERS FILE REFERENCE: 063785-06-5002-WO01 and 5002-US01 CURRENT APPLICATION NUMBER: US/15/906,773A CURRENT FILING DATE: 2018-02-27 PRIOR APPLICATION NUMBER: JP 2017-035594 PRIOR FILING DATE: 2017-02-27 NUMBER OF SEQ ID NOS: 185 SEQ ID NO 134 LENGTH: 451 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: Humanized variant heavy chain, H2 Query Match 82.5%; Score 153.4; Length 451; Best Local Similarity 40.0%; Matches 32; Conservative 1; Mismatches 1; Indels 46; Gaps 2; Qy 1 SFALN--------------HIRSETNNYVTFYAASVKG---------------------- 24 ||||| ||||:|||| ||||||||| Db 31 SFALNWVRQAPGKGLEWVGHIRSKTNNYATFYAASVKGRFTVSRDDSKNTAYLQMNSLKT 90 Qy 25 ----------RGPRDSWFGY 34 |||||||||| Db 91 EDTATYYCVRRGPRDSWFGY 110 SEQ ID NO:72 US-15-906-773A-145 (NOTE: this sequence has 2 duplicates in the database searched) Sequence 145, US/15906773A Patent No. 10556950 GENERAL INFORMATION APPLICANT: EGUCHI, Hiroshi APPLICANT: MURAKAMI, Takashi APPLICANT: NAMIKI, Naoko APPLICANT: TANOKURA, Akira APPLICANT: BAKER, Jeanne E. APPLICANT: PARMENTIER BATTEUR, Sophie APPLICANT: JABLONSKI, Angela Marie APPLICANT: MALASHOCK, Daniel Stephen APPLICANT: MIECZKOWSKI, Carl APPLICANT: RAGHUNATHAN, Gopalan (Raghu) TITLE OF INVENTION: HUMANIZED ANTIBODY FOR TREATING OR PREVENTING COGNITIVE TITLE OF INVENTION: DISORDERS FILE REFERENCE: 063785-06-5002-WO01 and 5002-US01 CURRENT APPLICATION NUMBER: US/15/906,773A CURRENT FILING DATE: 2018-02-27 PRIOR APPLICATION NUMBER: JP 2017-035594 PRIOR FILING DATE: 2017-02-27 NUMBER OF SEQ ID NOS: 185 SEQ ID NO 145 LENGTH: 451 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: H11 Human_IgG1_L234A_L235A Query Match 99.4%; Score 2396; Length 451; Best Local Similarity 99.3%; Matches 448; Conservative 1; Mismatches 2; Indels 0; Gaps 0; Qy 1 EVQLVESGGGLVQPGGSLRLSCAASGFTFSSFALNWVRQAPGKGLEWVGHIRSETNNYVT 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||:|||| | Db 1 EVQLVESGGGLVQPGGSLRLSCAASGFTFSSFALNWVRQAPGKGLEWVGHIRSKTNNYAT 60 Qy 61 FYAASVKGRFTVSRDDSQNTAYLQMNSLKTEDTATYYCVRRGPRDSWFGYWGQGTLVTVS 120 ||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 FYAASVKDRFTVSRDDSQNTAYLQMNSLKTEDTATYYCVRRGPRDSWFGYWGQGTLVTVS 120 Qy 121 SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS 180 Qy 181 SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEAAG 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEAAG 240 Qy 241 GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY 300 Qy 301 NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD 360 Qy 361 ELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 ELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR 420 Qy 421 WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 451 ||||||||||||||||||||||||||||||| Db 421 WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 451 SEQ ID NO:33-SEQ ID NO:34-SEQ ID NO:35 US-15-906-773A-105 (NOTE: this sequence has 2 duplicates in the database searched) Sequence 105, US/15906773A Patent No. 10556950 GENERAL INFORMATION APPLICANT: EGUCHI, Hiroshi APPLICANT: MURAKAMI, Takashi APPLICANT: NAMIKI, Naoko APPLICANT: TANOKURA, Akira APPLICANT: BAKER, Jeanne E. APPLICANT: PARMENTIER BATTEUR, Sophie APPLICANT: JABLONSKI, Angela Marie APPLICANT: MALASHOCK, Daniel Stephen APPLICANT: MIECZKOWSKI, Carl APPLICANT: RAGHUNATHAN, Gopalan (Raghu) TITLE OF INVENTION: HUMANIZED ANTIBODY FOR TREATING OR PREVENTING COGNITIVE TITLE OF INVENTION: DISORDERS FILE REFERENCE: 063785-06-5002-WO01 and 5002-US01 CURRENT APPLICATION NUMBER: US/15/906,773A CURRENT FILING DATE: 2018-02-27 PRIOR APPLICATION NUMBER: JP 2017-035594 PRIOR FILING DATE: 2017-02-27 NUMBER OF SEQ ID NOS: 185 SEQ ID NO 105 LENGTH: 112 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: Ta1505-VL46_G34A, VL Query Match 75.0%; Score 122.3; Length 112; Best Local Similarity 36.7%; Matches 29; Conservative 1; Mismatches 2; Indels 47; Gaps 2; Qy 1 RSSQKIVHRNANTYLE---------------TVSNRFS---------------------- 23 |||| ||| ||||||| ||||||| Db 24 RSSQSIVHSNANTYLEWYLQKPGQSPQLLIYTVSNRFSGVPDRFSGSGSGTDFTLKISRV 83 Qy 24 ----------FQGSYLPLT 32 ||||:|||| Db 84 EAEDLGVYYCFQGSHLPLT 102 SEQ ID NO:73 US-15-906-773A-166 (NOTE: this sequence has 2 duplicates in the database searched) Sequence 166, US/15906773A Patent No. 10556950 GENERAL INFORMATION APPLICANT: EGUCHI, Hiroshi APPLICANT: MURAKAMI, Takashi APPLICANT: NAMIKI, Naoko APPLICANT: TANOKURA, Akira APPLICANT: BAKER, Jeanne E. APPLICANT: PARMENTIER BATTEUR, Sophie APPLICANT: JABLONSKI, Angela Marie APPLICANT: MALASHOCK, Daniel Stephen APPLICANT: MIECZKOWSKI, Carl APPLICANT: RAGHUNATHAN, Gopalan (Raghu) TITLE OF INVENTION: HUMANIZED ANTIBODY FOR TREATING OR PREVENTING COGNITIVE TITLE OF INVENTION: DISORDERS FILE REFERENCE: 063785-06-5002-WO01 and 5002-US01 CURRENT APPLICATION NUMBER: US/15/906,773A CURRENT FILING DATE: 2018-02-27 PRIOR APPLICATION NUMBER: JP 2017-035594 PRIOR FILING DATE: 2017-02-27 NUMBER OF SEQ ID NOS: 185 SEQ ID NO 166 LENGTH: 219 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: VL46_G34A kappa Query Match 98.6%; Score 1121; Length 219; Best Local Similarity 98.6%; Matches 216; Conservative 1; Mismatches 2; Indels 0; Gaps 0; Qy 1 DIVMTQSPLSLPVTLGEPASISCRSSQKIVHRNANTYLEWYLQKPGQSPQLLIYTVSNRF 60 ||||||||||||||||||||||||||| ||| |||||||||||||||||||||||||||| Db 1 DIVMTQSPLSLPVTLGEPASISCRSSQSIVHSNANTYLEWYLQKPGQSPQLLIYTVSNRF 60 Qy 61 SGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSYLPLTFGGGTKVEIKRTVAAPSV 120 |||||||||||||||||||||||||||||||||||||:|||||||||||||||||||||| Db 61 SGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHLPLTFGGGTKVEIKRTVAAPSV 120 Qy 121 FIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSL 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 FIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSL 180 Qy 181 SSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 219 ||||||||||||||||||||||||||||||||||||||| Db 181 SSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 219 US10894829 teaches a humanized anti-tau antibody comprising a heavy chain (HC) and a light chain (LC), wherein HC comprises the amino acid sequence of SEQ ID NO:145, which is 99.4% identical to instant SEQ ID NO:72 and wherein the HC comprises HCDR1 of instant SEQ ID NO:53 and HCDR3 of instant SEQ ID NO: 55 but does not comprises HCDR2 of instant SEQ ID NO:54, and wherein the LC comprises the amino acid sequence of SEQ ID NO:166, which is 98.6% identical to instant SEQ ID NO:73 and wherein the LC which comprises LCDR2 of instant SEQ ID NO:34 but does not comprise LCDR1 of instant SEQ ID NO:33 and LCDR3 of instant SEQ ID NO:35 (see the sequence alignment below). SEQ ID NO:72 Sequence 145, US/16746725A Patent No. 10894829 GENERAL INFORMATION APPLICANT: TEIJIN PHARMA LIMITED APPLICANT: MERCK SHARP & DOHME CORP. TITLE OF INVENTION: HUMANIZED ANTIBODY FOR TREATING OR PREVENTING COGNITIVE TITLE OF INVENTION: DISORDERS, PROCESS FOR PRODUCING THE SAME, AND AGENT FOR TITLE OF INVENTION: TREATING OR PREVENTING COGNITIVE DISORDERS USING THE SAME FILE REFERENCE: 14463-026-999 CURRENT APPLICATION NUMBER: US/16/746,725A CURRENT FILING DATE: 2020-01-17 PRIOR APPLICATION NUMBER: US 15/906,773 PRIOR FILING DATE: 2018-02-27 PRIOR APPLICATION NUMBER: JP 2017-035594 PRIOR FILING DATE: 2017-02-27 NUMBER OF SEQ ID NOS: 185 SEQ ID NO 145 LENGTH: 451 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: H11 Human_IgG1_L234A_L235A Query Match 99.4%; Score 2396; Length 451; Best Local Similarity 99.3%; Matches 448; Conservative 1; Mismatches 2; Indels 0; Gaps 0; Qy 1 EVQLVESGGGLVQPGGSLRLSCAASGFTFSSFALNWVRQAPGKGLEWVGHIRSETNNYVT 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||:|||| | Db 1 EVQLVESGGGLVQPGGSLRLSCAASGFTFSSFALNWVRQAPGKGLEWVGHIRSKTNNYAT 60 Qy 61 FYAASVKGRFTVSRDDSQNTAYLQMNSLKTEDTATYYCVRRGPRDSWFGYWGQGTLVTVS 120 ||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 FYAASVKDRFTVSRDDSQNTAYLQMNSLKTEDTATYYCVRRGPRDSWFGYWGQGTLVTVS 120 Qy 121 SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS 180 Qy 181 SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEAAG 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEAAG 240 Qy 241 GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY 300 Qy 301 NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD 360 Qy 361 ELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 ELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR 420 Qy 421 WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 451 ||||||||||||||||||||||||||||||| Db 421 WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 451 SEQ ID NO:73 Sequence 166, US/16746725A Patent No. 10894829 GENERAL INFORMATION APPLICANT: TEIJIN PHARMA LIMITED APPLICANT: MERCK SHARP & DOHME CORP. TITLE OF INVENTION: HUMANIZED ANTIBODY FOR TREATING OR PREVENTING COGNITIVE TITLE OF INVENTION: DISORDERS, PROCESS FOR PRODUCING THE SAME, AND AGENT FOR TITLE OF INVENTION: TREATING OR PREVENTING COGNITIVE DISORDERS USING THE SAME FILE REFERENCE: 14463-026-999 CURRENT APPLICATION NUMBER: US/16/746,725A CURRENT FILING DATE: 2020-01-17 PRIOR APPLICATION NUMBER: US 15/906,773 PRIOR FILING DATE: 2018-02-27 PRIOR APPLICATION NUMBER: JP 2017-035594 PRIOR FILING DATE: 2017-02-27 NUMBER OF SEQ ID NOS: 185 SEQ ID NO 166 LENGTH: 219 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: VL46_G34A kappa Query Match 98.6%; Score 1121; Length 219; Best Local Similarity 98.6%; Matches 216; Conservative 1; Mismatches 2; Indels 0; Gaps 0; Qy 1 DIVMTQSPLSLPVTLGEPASISCRSSQKIVHRNANTYLEWYLQKPGQSPQLLIYTVSNRF 60 ||||||||||||||||||||||||||| ||| |||||||||||||||||||||||||||| Db 1 DIVMTQSPLSLPVTLGEPASISCRSSQSIVHSNANTYLEWYLQKPGQSPQLLIYTVSNRF 60 Qy 61 SGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSYLPLTFGGGTKVEIKRTVAAPSV 120 |||||||||||||||||||||||||||||||||||||:|||||||||||||||||||||| Db 61 SGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHLPLTFGGGTKVEIKRTVAAPSV 120 Qy 121 FIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSL 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 FIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSL 180 Qy 181 SSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 219 ||||||||||||||||||||||||||||||||||||||| Db 181 SSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 219 US11739143 teaches a humanized anti-tau antibody comprising a heavy chain (HC) and a light chain (LC), wherein HC comprises the amino acid sequence of SEQ ID NO:145, which is 99.4% identical to instant SEQ ID NO:72 and wherein the HC comprises HCDR1 of instant SEQ ID NO:53 and HCDR3 of instant SEQ ID NO: 55 but does not comprises HCDR2 of instant SEQ ID NO:54, and wherein the LC comprises the amino acid sequence of SEQ ID NO:166, which is 98.6 identical to instant SEQ ID NO:73 and wherein the LC which comprises LCDR2 of instant SEQ ID NO:34 but does not comprise LCDR1 of instant SEQ ID NO:33 and LCDR3 of instant SEQ ID NO:35 (see the sequence alignment below). SEQ ID NO:72 Sequence 145, US/17122325A Patent No. 11739143 GENERAL INFORMATION APPLICANT: TEIJIN PHARMA LIMITED APPLICANT: MERCK SHARP & DOHME CORP. TITLE OF INVENTION: HUMANIZED ANTIBODY FOR TREATING OR PREVENTING COGNITIVE TITLE OF INVENTION: DISORDERS, PROCESS FOR PRODUCING THE SAME, AND AGENT FOR TITLE OF INVENTION: TREATING OR PREVENTING COGNITIVE DISORDERS USING THE SAME FILE REFERENCE: 14463-027-999 CURRENT APPLICATION NUMBER: US/17/122,325A CURRENT FILING DATE: 2020-12-15 PRIOR APPLICATION NUMBER: US 16/746,725 PRIOR FILING DATE: 2020-01-17 PRIOR APPLICATION NUMBER: US 15/906,773 PRIOR FILING DATE: 2018-02-27 PRIOR APPLICATION NUMBER: JP 2017-035594 PRIOR FILING DATE: 2017-02-27 NUMBER OF SEQ ID NOS: 185 SEQ ID NO 145 LENGTH: 451 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: H11 Human_IgG1_L234A_L235A Query Match 99.4%; Score 2396; Length 451; Best Local Similarity 99.3%; Matches 448; Conservative 1; Mismatches 2; Indels 0; Gaps 0; Qy 1 EVQLVESGGGLVQPGGSLRLSCAASGFTFSSFALNWVRQAPGKGLEWVGHIRSETNNYVT 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||:|||| | Db 1 EVQLVESGGGLVQPGGSLRLSCAASGFTFSSFALNWVRQAPGKGLEWVGHIRSKTNNYAT 60 Qy 61 FYAASVKGRFTVSRDDSQNTAYLQMNSLKTEDTATYYCVRRGPRDSWFGYWGQGTLVTVS 120 ||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 FYAASVKDRFTVSRDDSQNTAYLQMNSLKTEDTATYYCVRRGPRDSWFGYWGQGTLVTVS 120 Qy 121 SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS 180 Qy 181 SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEAAG 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEAAG 240 Qy 241 GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY 300 Qy 301 NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD 360 Qy 361 ELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 ELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR 420 Qy 421 WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 451 ||||||||||||||||||||||||||||||| Db 421 WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 451 SEQ ID NO:73 Sequence 166, US/17122325A Patent No. 11739143 GENERAL INFORMATION APPLICANT: TEIJIN PHARMA LIMITED APPLICANT: MERCK SHARP & DOHME CORP. TITLE OF INVENTION: HUMANIZED ANTIBODY FOR TREATING OR PREVENTING COGNITIVE TITLE OF INVENTION: DISORDERS, PROCESS FOR PRODUCING THE SAME, AND AGENT FOR TITLE OF INVENTION: TREATING OR PREVENTING COGNITIVE DISORDERS USING THE SAME FILE REFERENCE: 14463-027-999 CURRENT APPLICATION NUMBER: US/17/122,325A CURRENT FILING DATE: 2020-12-15 PRIOR APPLICATION NUMBER: US 16/746,725 PRIOR FILING DATE: 2020-01-17 PRIOR APPLICATION NUMBER: US 15/906,773 PRIOR FILING DATE: 2018-02-27 PRIOR APPLICATION NUMBER: JP 2017-035594 PRIOR FILING DATE: 2017-02-27 NUMBER OF SEQ ID NOS: 185 SEQ ID NO 166 LENGTH: 219 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: VL46_G34A kappa Query Match 98.6%; Score 1121; Length 219; Best Local Similarity 98.6%; Matches 216; Conservative 1; Mismatches 2; Indels 0; Gaps 0; Qy 1 DIVMTQSPLSLPVTLGEPASISCRSSQKIVHRNANTYLEWYLQKPGQSPQLLIYTVSNRF 60 ||||||||||||||||||||||||||| ||| |||||||||||||||||||||||||||| Db 1 DIVMTQSPLSLPVTLGEPASISCRSSQSIVHSNANTYLEWYLQKPGQSPQLLIYTVSNRF 60 Qy 61 SGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSYLPLTFGGGTKVEIKRTVAAPSV 120 |||||||||||||||||||||||||||||||||||||:|||||||||||||||||||||| Db 61 SGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHLPLTFGGGTKVEIKRTVAAPSV 120 Qy 121 FIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSL 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 FIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSL 180 Qy 181 SSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 219 ||||||||||||||||||||||||||||||||||||||| Db 181 SSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 219 WO2018154390 teaches an anti-pSer413 tau antibody mAb-pPT2 comprising a heavy chain (HC) and a light chain (LC), wherein HC comprises the amino acid sequence of SEQ ID NO:145, which is 99.4% identical to instant SEQ ID NO:72 and wherein the HC comprises HCDR1 of instant SEQ ID NO:53 and HCDR3 of instant SEQ ID NO: 55 but does not comprises HCDR2 of instant SEQ ID NO:54, and wherein the LC comprises the amino acid sequence of SEQ ID NO:166, which is 98.6 identical to instant SEQ ID NO:73 and wherein the LC which comprises LCDR2 of instant SEQ ID NO:34 but does not comprise LCDR1 of instant SEQ ID NO:33 and LCDR3 of instant SEQ ID NO:35 (see the sequence alignment below). SEQ ID NO:72 BFQ05739 (NOTE: this sequence has 1 duplicate in the database searched) ID BFQ05739 standard; protein; 451 AA. XX AC BFQ05739; XX DT 18-OCT-2018 (first entry) XX DE Anti-pSer413 tau antibody mAb-aPT2 heavy chain, SEQ ID 145. XX KW Immunoglobulin G1; Tau protein; alzheimers disease; antibody production; KW antibody therapy; calcification; degeneration; dementia; KW frontotemporal dementia; fusion protein; heavy chain; metabolic-gen.; KW monoclonal antibody; neuroprotective; nootropic; parkinsonism; KW progressive supranuclear palsy; prophylactic to disease; therapeutic. XX OS Homo sapiens. OS Unidentified. XX FH Key Location/Qualifiers FT Region 30..35 FT /label= CDR1 FT Region 50..68 FT /label= CDR2 FT Region 101..110 FT /label= CDR3 XX CC PN WO2018154390-A1. XX CC PD 30-AUG-2018. XX CC PF 27-FEB-2018; 2018WO-IB000249. XX PR 27-FEB-2017; 2017JP-00035594. XX CC PA (TEIJ ) TEIJIN PHARMA LTD. CC PA (MERI ) MERCK SHARP & DOHME CORP. XX CC PI Eguchi H, Murakami T, Namiki N, Tanokura A, Baker JE; CC PI Parmentier Batteur S, Jablonski AM, Malashock DS, Mieczkowski C; CC PI Raghunathan GR; XX DR WPI; 2018-67626E/60. XX CC PT New anti-pSer413 tau antibody used for treating tauopathy e.g. CC PT Alzheimer's disease and improving cognitive function in human, comprises CC PT heavy variable domain and light variable domain comprising specific amino CC PT acid sequences. XX CC PS Claim 8; SEQ ID NO 145; 143pp; English. XX CC The present invention relates to a novel humanized anti-pSer413 tau CC antibody useful for treating tauopathy e.g., Alzheimer's disease and CC improving cognitive function in human. The invention further relates to: CC (1) a nucleic acid composition; (2) an expression vector; (3) a host cell CC ; (4) a method for producing anti-pSer413 t antibody; and (5) a method CC for treating tauopathy in a subject. The antibody of the invention is CC also used for preventing tauopathy includes corticobasal degeneration, CC progressive supranuclear palsy, Pick's disease, argyrophilic grain CC dementia, multiple system tauopathy with presenile dementia, CC frontotemporal dementia and parkinsonism linked to chromosome 17, CC dementia with neurofibrillary tangles, diffuse neurofibrillary tangle CC with calcification. The present sequence represents an anti-pSer413 CC antibody heavy chain comprising IgG1 backbone sequence, used in the CC invention for preparing the humanized anti-pSer413 tau antibody for CC treating tauopathy. XX SQ Sequence 451 AA; Query Match 99.4%; Score 2396; Length 451; Best Local Similarity 99.3%; Matches 448; Conservative 1; Mismatches 2; Indels 0; Gaps 0; Qy 1 EVQLVESGGGLVQPGGSLRLSCAASGFTFSSFALNWVRQAPGKGLEWVGHIRSETNNYVT 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||:|||| | Db 1 EVQLVESGGGLVQPGGSLRLSCAASGFTFSSFALNWVRQAPGKGLEWVGHIRSKTNNYAT 60 Qy 61 FYAASVKGRFTVSRDDSQNTAYLQMNSLKTEDTATYYCVRRGPRDSWFGYWGQGTLVTVS 120 ||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 FYAASVKDRFTVSRDDSQNTAYLQMNSLKTEDTATYYCVRRGPRDSWFGYWGQGTLVTVS 120 Qy 121 SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS 180 Qy 181 SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEAAG 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEAAG 240 Qy 241 GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY 300 Qy 301 NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD 360 Qy 361 ELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 ELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR 420 Qy 421 WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 451 ||||||||||||||||||||||||||||||| Db 421 WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 451 SEQ ID NO:73 BFQ05760 (NOTE: this sequence has 2 duplicates in the database searched) ID BFQ05760 standard; protein; 219 AA. XX AC BFQ05760; XX DT 18-OCT-2018 (first entry) XX DE Anti-pSer413 tau VL46_G34A kappa light chian, SEQ 166. XX KW Tau protein; alzheimers disease; antibody; antibody production; KW antibody therapy; calcification; degeneration; dementia; KW frontotemporal dementia; light chian; metabolic-gen.; mutein; KW neuroprotective; nootropic; parkinsonism; progressive supranuclear palsy; KW prophylactic to disease; therapeutic. XX OS Unidentified. XX FH Key Location/Qualifiers FT Region 24..39 FT /label= CDR1 FT Region 55..62 FT /label= CDR2 FT Region 94..102 FT /label= CDR3 XX CC PN WO2018154390-A1. XX CC PD 30-AUG-2018. XX CC PF 27-FEB-2018; 2018WO-IB000249. XX PR 27-FEB-2017; 2017JP-00035594. XX CC PA (TEIJ ) TEIJIN PHARMA LTD. CC PA (MERI ) MERCK SHARP & DOHME CORP. XX CC PI Eguchi H, Murakami T, Namiki N, Tanokura A, Baker JE; CC PI Parmentier Batteur S, Jablonski AM, Malashock DS, Mieczkowski C; CC PI Raghunathan GR; XX DR WPI; 2018-67626E/60. XX CC PT New anti-pSer413 tau antibody used for treating tauopathy e.g. CC PT Alzheimer's disease and improving cognitive function in human, comprises CC PT heavy variable domain and light variable domain comprising specific amino CC PT acid sequences. XX CC PS Claim 9; SEQ ID NO 166; 143pp; English. XX CC The present invention relates to a novel humanized anti-pSer413 tau CC antibody useful for treating tauopathy e.g., Alzheimer's disease and CC improving cognitive function in human. The invention further relates to: CC (1) a nucleic acid composition; (2) an expression vector; (3) a host cell CC ; (4) a method for producing anti-pSer413 t antibody; and (5) a method CC for treating tauopathy in a subject. The antibody of the invention is CC also used for preventing tauopathy includes corticobasal degeneration, CC progressive supranuclear palsy, Pick's disease, argyrophilic grain CC dementia, multiple system tauopathy with presenile dementia, CC frontotemporal dementia and parkinsonism linked to chromosome 17, CC dementia with neurofibrillary tangles, diffuse neurofibrillary tangle CC with calcification. The present sequence represents an anti-pSer413 CC antibody light chain, used in the invention for preparing the humanized CC anti-pSer413 tau antibody for treating tauopathy. XX SQ Sequence 219 AA; Query Match 98.6%; Score 1121; Length 219; Best Local Similarity 98.6%; Matches 216; Conservative 1; Mismatches 2; Indels 0; Gaps 0; Qy 1 DIVMTQSPLSLPVTLGEPASISCRSSQKIVHRNANTYLEWYLQKPGQSPQLLIYTVSNRF 60 ||||||||||||||||||||||||||| ||| |||||||||||||||||||||||||||| Db 1 DIVMTQSPLSLPVTLGEPASISCRSSQSIVHSNANTYLEWYLQKPGQSPQLLIYTVSNRF 60 Qy 61 SGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSYLPLTFGGGTKVEIKRTVAAPSV 120 |||||||||||||||||||||||||||||||||||||:|||||||||||||||||||||| Db 61 SGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHLPLTFGGGTKVEIKRTVAAPSV 120 Qy 121 FIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSL 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 FIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSL 180 Qy 181 SSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 219 ||||||||||||||||||||||||||||||||||||||| Db 181 SSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 219 SEQ ID NO:56 BFQ05728 (NOTE: this sequence has 2 duplicates in the database searched) ID BFQ05728 standard; protein; 451 AA. XX AC BFQ05728; XX DT 18-OCT-2018 (first entry) XX DE Humanized anti-tau antibody heavy chain variant 10 (H2), SEQ ID 134. XX KW Tau protein; alzheimers disease; antibody production; antibody therapy; KW calcification; degeneration; dementia; frontotemporal dementia; KW heavy chain; humanized antibody; metabolic-gen.; neuroprotective; KW nootropic; parkinsonism; progressive supranuclear palsy; KW prophylactic to disease; therapeutic. XX OS Homo sapiens. OS Mus musculus. OS Chimeric. XX CC PN WO2018154390-A1. XX CC PD 30-AUG-2018. XX CC PF 27-FEB-2018; 2018WO-IB000249. XX PR 27-FEB-2017; 2017JP-00035594. XX CC PA (TEIJ ) TEIJIN PHARMA LTD. CC PA (MERI ) MERCK SHARP & DOHME CORP. XX CC PI Eguchi H, Murakami T, Namiki N, Tanokura A, Baker JE; CC PI Parmentier Batteur S, Jablonski AM, Malashock DS, Mieczkowski C; CC PI Raghunathan GR; XX DR WPI; 2018-67626E/60. XX CC PT New anti-pSer413 tau antibody used for treating tauopathy e.g. CC PT Alzheimer's disease and improving cognitive function in human, comprises CC PT heavy variable domain and light variable domain comprising specific amino CC PT acid sequences. XX CC PS Example 6; SEQ ID NO 134; 143pp; English. XX CC The present invention relates to a novel humanized anti-pSer413 tau CC antibody useful for treating tauopathy e.g., Alzheimer's disease and CC improving cognitive function in human. The invention further relates to: CC (1) a nucleic acid composition; (2) an expression vector; (3) a host cell CC ; (4) a method for producing anti-pSer413 t antibody; and (5) a method CC for treating tauopathy in a subject. The antibody of the invention is CC also used for preventing tauopathy includes corticobasal degeneration, CC progressive supranuclear palsy, Pick's disease, argyrophilic grain CC dementia, multiple system tauopathy with presenile dementia, CC frontotemporal dementia and parkinsonism linked to chromosome 17, CC dementia with neurofibrillary tangles, diffuse neurofibrillary tangle CC with calcification. The present sequence represents a humanized anti-tau CC antibody heavy chain variant, used in the invention for treating CC tauopathy. XX SQ Sequence 451 AA; Query Match 98.1%; Score 632; Length 451; Best Local Similarity 97.5%; Matches 118; Conservative 2; Mismatches 1; Indels 0; Gaps 0; Qy 1 EVQLVESGGGLVQPGGSLRLSCAASGFTFSSFALNWVRQAPGKGLEWVGHIRSETNNYVT 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||:|||| | Db 1 EVQLVESGGGLVQPGGSLRLSCAASGFTFSSFALNWVRQAPGKGLEWVGHIRSKTNNYAT 60 Qy 61 FYAASVKGRFTVSRDDSQNTAYLQMNSLKTEDTATYYCVRRGPRDSWFGYWGQGTLVTVS 120 |||||||||||||||||:|||||||||||||||||||||||||||||||||||||||||| Db 61 FYAASVKGRFTVSRDDSKNTAYLQMNSLKTEDTATYYCVRRGPRDSWFGYWGQGTLVTVS 120 Qy 121 S 121 | Db 121 S 121 WO2018154392 teaches an anti-tau antibody comprising a heavy chain (HC) and a light chain (LC), wherein HC comprises the amino acid sequence of SEQ ID NO:145, which is 99.4% identical to instant SEQ ID NO:72 and wherein the HC comprises HCDR1 of instant SEQ ID NO:53 and HCDR3 of instant SEQ ID NO: 55 but does not comprises HCDR2 of instant SEQ ID NO:54, and wherein the LC comprises the amino acid sequence of SEQ ID NO:166, which is 98.6 identical to instant SEQ ID NO:73 and wherein the LC which comprises LCDR2 of instant SEQ ID NO:34 but does not comprise LCDR1 of instant SEQ ID NO:33 and LCDR3 of instant SEQ ID NO:35 (see the sequence alignment below). SEQ ID NO:72 ID BFQ05927 standard; protein; 451 AA. XX AC BFQ05927; XX DT 18-OCT-2018 (first entry) XX DE Anti-pSer413 tau antibody mAb-aPT2 heavy chain, SEQ ID 145. XX KW Immunoglobulin G1; Tau protein; alzheimers disease; antibody; KW antibody production; antibody therapy; calcification; degeneration; KW dementia; frontotemporal dementia; fusion protein; heavy chain; KW metabolic-gen.; neuroprotective; nootropic; parkinsonism; KW progressive supranuclear palsy; prophylactic to disease; therapeutic. XX OS Homo sapiens. OS Unidentified. XX FH Key Location/Qualifiers FT Region 30..35 FT /label= CDR1 FT Region 50..68 FT /label= CDR2 FT Region 101..110 FT /label= CDR3 XX CC PN WO2018154392-A1. XX CC PD 30-AUG-2018. XX CC PF 25-FEB-2018; 2018WO-IB000267. XX PR 27-FEB-2017; 2017JP-00035594. XX CC PA (TEIJ ) TEIJIN PHARMA LTD. CC PA (MERI ) MERCK SHARP & DOHME CORP. XX CC PI Eguchi H, Murakami T, Namiki N, Tanokura A, Baker JE; CC PI Parmentier BS, Jablonski AM, Malashock DS, Mieczkowski C; CC PI Raghunathan GR; XX DR WPI; 2018-67626C/61. XX CC PT New humanized antibody that causes antigen-antibody reaction with tau- CC PT protein or peptide phosphorylated on amino acid residue corresponding to CC PT serine of specific amino acid sequence used to treat or prevent dementia CC PT e.g. Alzheimer's disease. XX CC PS Claim 8; SEQ ID NO 145; 138pp; English. XX CC The present invention relates to a novel humanized anti-pSer413 tau CC antibody useful for treating tauopathy e.g., Alzheimer's disease and CC improving cognitive function in human. The invention further relates to: CC (1) a nucleic acid composition; (2) an expression vector; (3) a host cell CC ; (4) a method for producing anti-pSer413 t antibody; and (5) a method CC for treating tauopathy in a subject. The antibody of the invention is CC also used for preventing tauopathy includes corticobasal degeneration, CC progressive supranuclear palsy, Pick's disease, argyrophilic grain CC dementia, multiple system tauopathy with presenile dementia, CC frontotemporal dementia and parkinsonism linked to chromosome 17, CC dementia with neurofibrillary tangles, diffuse neurofibrillary tangle CC with calcification. The present sequence represents an anti-pSer413 CC antibody heavy chain comprising IgG1 backbone sequence, used in the CC invention for preparing the humanized anti-pSer413 tau antibody for CC treating tauopathy. XX SQ Sequence 451 AA; Query Match 99.4%; Score 2396; Length 451; Best Local Similarity 99.3%; Matches 448; Conservative 1; Mismatches 2; Indels 0; Gaps 0; Qy 1 EVQLVESGGGLVQPGGSLRLSCAASGFTFSSFALNWVRQAPGKGLEWVGHIRSETNNYVT 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||:|||| | Db 1 EVQLVESGGGLVQPGGSLRLSCAASGFTFSSFALNWVRQAPGKGLEWVGHIRSKTNNYAT 60 Qy 61 FYAASVKGRFTVSRDDSQNTAYLQMNSLKTEDTATYYCVRRGPRDSWFGYWGQGTLVTVS 120 ||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 FYAASVKDRFTVSRDDSQNTAYLQMNSLKTEDTATYYCVRRGPRDSWFGYWGQGTLVTVS 120 Qy 121 SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS 180 Qy 181 SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEAAG 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEAAG 240 Qy 241 GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY 300 Qy 301 NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD 360 Qy 361 ELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 ELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR 420 Qy 421 WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 451 ||||||||||||||||||||||||||||||| Db 421 WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 451 SEQ ID NO:73 ID BFQ05948 standard; protein; 219 AA. XX AC BFQ05948; XX DT 18-OCT-2018 (first entry) XX DE Anti-pSer413 tau VL46_G34A kappa light chian, SEQ 166. XX KW Tau protein; alzheimers disease; antibody; antibody production; KW antibody therapy; calcification; degeneration; dementia; KW frontotemporal dementia; light chian; metabolic-gen.; neuroprotective; KW nootropic; parkinsonism; progressive supranuclear palsy; KW prophylactic to disease; therapeutic. XX OS Unidentified. XX FH Key Location/Qualifiers FT Region 24..39 FT /label= CDR1 FT Region 55..62 FT /label= CDR2 FT Region 94..102 FT /label= CDR3 XX CC PN WO2018154392-A1. XX CC PD 30-AUG-2018. XX CC PF 25-FEB-2018; 2018WO-IB000267. XX PR 27-FEB-2017; 2017JP-00035594. XX CC PA (TEIJ ) TEIJIN PHARMA LTD. CC PA (MERI ) MERCK SHARP & DOHME CORP. XX CC PI Eguchi H, Murakami T, Namiki N, Tanokura A, Baker JE; CC PI Parmentier BS, Jablonski AM, Malashock DS, Mieczkowski C; CC PI Raghunathan GR; XX DR WPI; 2018-67626C/61. XX CC PT New humanized antibody that causes antigen-antibody reaction with tau- CC PT protein or peptide phosphorylated on amino acid residue corresponding to CC PT serine of specific amino acid sequence used to treat or prevent dementia CC PT e.g. Alzheimer's disease. XX CC PS Claim 9; SEQ ID NO 166; 138pp; English. XX CC The present invention relates to a novel humanized anti-pSer413 tau CC antibody useful for treating tauopathy e.g., Alzheimer's disease and CC improving cognitive function in human. The invention further relates to: CC (1) a nucleic acid composition; (2) an expression vector; (3) a host cell CC ; (4) a method for producing anti-pSer413 t antibody; and (5) a method CC for treating tauopathy in a subject. The antibody of the invention is CC also used for preventing tauopathy includes corticobasal degeneration, CC progressive supranuclear palsy, Pick's disease, argyrophilic grain CC dementia, multiple system tauopathy with presenile dementia, CC frontotemporal dementia and parkinsonism linked to chromosome 17, CC dementia with neurofibrillary tangles, diffuse neurofibrillary tangle CC with calcification. The present sequence represents an anti-pSer413 CC antibody light chain, used in the invention for preparing the humanized CC anti-pSer413 tau antibody for treating tauopathy. XX SQ Sequence 219 AA; Query Match 98.6%; Score 1121; Length 219; Best Local Similarity 98.6%; Matches 216; Conservative 1; Mismatches 2; Indels 0; Gaps 0; Qy 1 DIVMTQSPLSLPVTLGEPASISCRSSQKIVHRNANTYLEWYLQKPGQSPQLLIYTVSNRF 60 ||||||||||||||||||||||||||| ||| |||||||||||||||||||||||||||| Db 1 DIVMTQSPLSLPVTLGEPASISCRSSQSIVHSNANTYLEWYLQKPGQSPQLLIYTVSNRF 60 Qy 61 SGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSYLPLTFGGGTKVEIKRTVAAPSV 120 |||||||||||||||||||||||||||||||||||||:|||||||||||||||||||||| Db 61 SGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHLPLTFGGGTKVEIKRTVAAPSV 120 Qy 121 FIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSL 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 FIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSL 180 Qy 181 SSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 219 ||||||||||||||||||||||||||||||||||||||| Db 181 SSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 219 WO2020223279 teaches an anti-tau antibody comprising a heavy chain (HC) and a light chain (LC), wherein HC comprises the amino acid sequence of SEQ ID NO: 13489, which is 99.0% identical to instant SEQ ID NO:72 and wherein the HC comprises HCDR1 of instant SEQ ID NO:53 and HCDR3 of instant SEQ ID NO: 55 but does not comprises HCDR2 of instant SEQ ID NO:54, and wherein the LC comprises the amino acid sequence of SEQ ID NO: 13500, which is 98.6 identical to instant SEQ ID NO:73 and wherein the LC which comprises LCDR2 of instant SEQ ID NO:34 but does not comprise LCDR1 of instant SEQ ID NO:33 and LCDR3 of instant SEQ ID NO:35 (see the sequence alignment below). SEQ ID NO:72 ID BIM12081 standard; protein; 451 AA. XX AC BIM12081; XX DT 10-DEC-2020 (first entry) XX DE Tau associated disease antibody amino acid, SEQ ID 13489. XX KW antibody; antibody therapy; prophylactic to disease; therapeutic; KW vectorized antibody. XX OS Synthetic. XX CC PN WO2020223279-A1. XX CC PD 05-NOV-2020. XX CC PF 29-APR-2020; 2020WO-US030360. XX PR 29-APR-2019; 2019US-0839891P. PR 12-JUN-2019; 2019US-0860295P. PR 28-OCT-2019; 2019US-0926706P. PR 30-MAR-2020; 2020US-0002008P. PR 30-MAR-2020; 2020US-0002011P. XX CC PA (VOYA-) VOYAGER THERAPEUTICS INC. XX CC PI Hou J, Shu Y, Carter T, Sah DW, Yen P, Ward DT, Crimins JL; XX DR WPI; 2020-A7091D/097. XX CC PT Adeno-associated viral (AAV) particle for treating influenza, comprises CC PT capsid and viral genome comprising inverted terminal repeat (ITR) CC PT sequence region, promoter sequence region, polyA sequence region, and CC PT payload region. XX CC PS Claim 31; SEQ ID NO 13489; 824pp; English. XX CC The present invention relates to vectorized antibodies (vAB), and more CC specifically, to an adeno-associated viral (AAV) particle for treating a CC disease or disorder. The AAV particle comprises a capsid and a viral CC genome comprising a 5' inverted terminal repeat (ITR) sequence region, at CC least one promoter sequence region, a polyA sequence region, a 3'-ITR CC sequence region, and at least one payload region comprising a 1st nucleic CC acid sequence encoding an antibody, an antibody fragment or an antibody CC variant. The AAV particle is useful for producing an antibody in a CC subject; for expressing an antibody in a cell or tissue; and for CC preparing pharmaceutical composition for preventing or treating disease CC or disorder selected from diseases caused by John Cunningham virus (JCV), CC influenza, hepatitis A, hepatitis B, hepatitis D, hepatitis E, CC respiratory syncytial virus (RSV), herpes simplex virus 1, herpes simplex CC virus 2, human cytomegalovirus, Epstein-Barr virus, varicella zoster CC virus, coronavirus, Poxvirus, Enterovirus 71, rubella virus, human CC papillomavirus, Pseudomonas aeruginosa, Streptococcus bacteria, CC Staphylococcus bacteria, Clostridium tetani, Bordetella, Mycobacterium, CC Francisella tularensis, Toxoplasma gondii, Candida yeast, ricin, Bacillus CC anthracis, shiga toxin, shiga-like toxin, botulinum toxins, chikungunya CC virus, dengue virus, Trypanosoma cruzi, rabies virus, Plasmodium CC falciparum, ebola virus, Marburg virus, West Nile virus, Yellow Fever CC virus, Japanese encephalitis virus, St. Louis encephalitis virus, CC rotavirus, Norwalk virus, Campylobacter jejuni, Clostridium difficile, CC Entamoeba histolytica, Helicobacter pylori, and enterotoxin B, CC Parkinson's disease, dementia with Lewy Bodies, multiple system atrophy, CC decreased muscle mass, decreased muscle strength, decreased muscle CC function, spinal muscular atrophy, Alzheimer's disease, Huntington's CC disease, multiple sclerosis, amyotrophic lateral sclerosis, stroke, CC migraine, pain, neuropathies, psychiatric disorders, cancer, ocular CC diseases, systemic diseases of the blood, systemic diseases of the heart, CC systemic diseases of the bone, immune system, autoimmune disease, CC inflammation disorders and inflammation. XX SQ Sequence 451 AA; Query Match 99.0%; Score 2386; Length 451; Best Local Similarity 98.9%; Matches 446; Conservative 1; Mismatches 4; Indels 0; Gaps 0; Qy 1 EVQLVESGGGLVQPGGSLRLSCAASGFTFSSFALNWVRQAPGKGLEWVGHIRSETNNYVT 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||:|||| | Db 1 EVQLVESGGGLVQPGGSLRLSCAASGFTFSSFALNWVRQAPGKGLEWVGHIRSKTNNYAT 60 Qy 61 FYAASVKGRFTVSRDDSQNTAYLQMNSLKTEDTATYYCVRRGPRDSWFGYWGQGTLVTVS 120 ||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 FYAASVKDRFTVSRDDSQNTAYLQMNSLKTEDTATYYCVRRGPRDSWFGYWGQGTLVTVS 120 Qy 121 SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS 180 Qy 181 SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEAAG 240 ||||||||||||||||||||||||||||||||||||||||||||||||||||||||| | Db 181 SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLG 240 Qy 241 GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY 300 Qy 301 NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD 360 Qy 361 ELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 ELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR 420 Qy 421 WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 451 ||||||||||||||||||||||||||||||| Db 421 WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 451 SEQ ID NO:73 ID BIM12092 standard; protein; 219 AA. XX AC BIM12092; XX DT 10-DEC-2020 (first entry) XX DE Tau associated disease antibody amino acid, SEQ ID 13500. XX KW antibody; antibody therapy; prophylactic to disease; therapeutic; KW vectorized antibody. XX OS Synthetic. XX CC PN WO2020223279-A1. XX CC PD 05-NOV-2020. XX CC PF 29-APR-2020; 2020WO-US030360. XX PR 29-APR-2019; 2019US-0839891P. PR 12-JUN-2019; 2019US-0860295P. PR 28-OCT-2019; 2019US-0926706P. PR 30-MAR-2020; 2020US-0002008P. PR 30-MAR-2020; 2020US-0002011P. XX CC PA (VOYA-) VOYAGER THERAPEUTICS INC. XX CC PI Hou J, Shu Y, Carter T, Sah DW, Yen P, Ward DT, Crimins JL; XX DR WPI; 2020-A7091D/097. XX CC PT Adeno-associated viral (AAV) particle for treating influenza, comprises CC PT capsid and viral genome comprising inverted terminal repeat (ITR) CC PT sequence region, promoter sequence region, polyA sequence region, and CC PT payload region. XX CC PS Claim 31; SEQ ID NO 13500; 824pp; English. XX CC The present invention relates to vectorized antibodies (vAB), and more CC specifically, to an adeno-associated viral (AAV) particle for treating a CC disease or disorder. The AAV particle comprises a capsid and a viral CC genome comprising a 5' inverted terminal repeat (ITR) sequence region, at CC least one promoter sequence region, a polyA sequence region, a 3'-ITR CC sequence region, and at least one payload region comprising a 1st nucleic CC acid sequence encoding an antibody, an antibody fragment or an antibody CC variant. The AAV particle is useful for producing an antibody in a CC subject; for expressing an antibody in a cell or tissue; and for CC preparing pharmaceutical composition for preventing or treating disease CC or disorder selected from diseases caused by John Cunningham virus (JCV), CC influenza, hepatitis A, hepatitis B, hepatitis D, hepatitis E, CC respiratory syncytial virus (RSV), herpes simplex virus 1, herpes simplex CC virus 2, human cytomegalovirus, Epstein-Barr virus, varicella zoster CC virus, coronavirus, Poxvirus, Enterovirus 71, rubella virus, human CC papillomavirus, Pseudomonas aeruginosa, Streptococcus bacteria, CC Staphylococcus bacteria, Clostridium tetani, Bordetella, Mycobacterium, CC Francisella tularensis, Toxoplasma gondii, Candida yeast, ricin, Bacillus CC anthracis, shiga toxin, shiga-like toxin, botulinum toxins, chikungunya CC virus, dengue virus, Trypanosoma cruzi, rabies virus, Plasmodium CC falciparum, ebola virus, Marburg virus, West Nile virus, Yellow Fever CC virus, Japanese encephalitis virus, St. Louis encephalitis virus, CC rotavirus, Norwalk virus, Campylobacter jejuni, Clostridium difficile, CC Entamoeba histolytica, Helicobacter pylori, and enterotoxin B, CC Parkinson's disease, dementia with Lewy Bodies, multiple system atrophy, CC decreased muscle mass, decreased muscle strength, decreased muscle CC function, spinal muscular atrophy, Alzheimer's disease, Huntington's CC disease, multiple sclerosis, amyotrophic lateral sclerosis, stroke, CC migraine, pain, neuropathies, psychiatric disorders, cancer, ocular CC diseases, systemic diseases of the blood, systemic diseases of the heart, CC systemic diseases of the bone, immune system, autoimmune disease, CC inflammation disorders and inflammation. XX SQ Sequence 219 AA; Query Match 98.6%; Score 1121; Length 219; Best Local Similarity 98.6%; Matches 216; Conservative 1; Mismatches 2; Indels 0; Gaps 0; Qy 1 DIVMTQSPLSLPVTLGEPASISCRSSQKIVHRNANTYLEWYLQKPGQSPQLLIYTVSNRF 60 ||||||||||||||||||||||||||| ||| |||||||||||||||||||||||||||| Db 1 DIVMTQSPLSLPVTLGEPASISCRSSQSIVHSNANTYLEWYLQKPGQSPQLLIYTVSNRF 60 Qy 61 SGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSYLPLTFGGGTKVEIKRTVAAPSV 120 |||||||||||||||||||||||||||||||||||||:|||||||||||||||||||||| Db 61 SGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHLPLTFGGGTKVEIKRTVAAPSV 120 Qy 121 FIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSL 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 FIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSL 180 Qy 181 SSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 219 ||||||||||||||||||||||||||||||||||||||| Db 181 SSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 219 Any inquiry concerning this communication or earlier communications from the examiner should be directed to CHANG-YU WANG whose telephone number is (571)272-4521. The examiner can normally be reached on Monday-Thursday, 7:00am-5:00pm EST. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Jeffrey Stucker can be reached on 571-272-0911. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of an application may be obtained from the Patent Application Information Retrieval (PAIR) system. Status information for published applications may be obtained from either Private PAIR or Public PAIR. Status information for unpublished applications is available through Private PAIR only. For more information about the PAIR system, see https://ppair-my.uspto.gov/pair/PrivatePair. Should you have questions on access to the Private PAIR system, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative or access to the automated information system, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. Chang-Yu Wang January 6, 2026 /CHANG-YU WANG/Primary Examiner, Art Unit 1675
Read full office action

Prosecution Timeline

Dec 21, 2022
Application Filed
Jan 06, 2026
Non-Final Rejection — §112, §DP (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12599670
METHODS OF PROMOTING NERVOUS SYSTEM REGENERATION
2y 5m to grant Granted Apr 14, 2026
Patent 12589118
USE OF CEREBROLYSIN
2y 5m to grant Granted Mar 31, 2026
Patent 12576130
DOMINANT NEGATIVE SARM1 MOLECULES AS A THERAPEUTIC STRATEGY FOR NEURODEGENERATIVE DISEASES OR DISORDERS
2y 5m to grant Granted Mar 17, 2026
Patent 12559549
ANTIBODY BINDING TO SUPER-REPRESSOR IkB (srIkB) OR ANTIGEN BINDING FRAGMENT THEREOF
2y 5m to grant Granted Feb 24, 2026
Patent 12545725
ANTI-PACAP ANTIBODIES, NUCLEIC ACIDS AND METHODS OF MAKING THEREOF
2y 5m to grant Granted Feb 10, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

AI Strategy Recommendation

Get an AI-powered prosecution strategy using examiner precedents, rejection analysis, and claim mapping.
Powered by AI — typically takes 5-10 seconds

Prosecution Projections

1-2
Expected OA Rounds
34%
Grant Probability
86%
With Interview (+52.5%)
4y 1m
Median Time to Grant
Low
PTA Risk
Based on 850 resolved cases by this examiner. Grant probability derived from career allow rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month