Prosecution Insights
Last updated: October 04, 2026
Application No. 18/020,502

BECLIN 2 AND USES THEREOF FOR TREATING CANCER AND NEURODEGENERATIVE DISEASES

Final Rejection §112
Filed
Feb 09, 2023
Priority
Aug 24, 2020 — provisional 63/069,413 +1 more
Examiner
WANG, CHANG YU
Art Unit
1675
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
The Methodist Hospital System
OA Round
3 (Final)
34%
Grant Probability
At Risk
4-5
OA Rounds
2m
Est. Remaining
87%
With Interview

Examiner Intelligence

Grants only 34% of cases
34%
Career Allowance Rate
292 granted / 872 resolved
-26.5% vs TC avg
Strong +54% interview lift
Without
With
+53.5%
Interview Lift
resolved cases with interview
Typical timeline
3y 10m
Avg Prosecution
52 currently pending
Career history
951
Total Applications
across all art units

Statute-Specific Performance

§101
4.7%
-35.3% vs TC avg
§103
27.2%
-12.8% vs TC avg
§102
15.0%
-25.0% vs TC avg
§112
35.5%
-4.5% vs TC avg
Black line = Tech Center average estimate • Based on career data from 872 resolved cases

Office Action

§112
1. The action of July 30, 2026 is incomplete and is thus vacated. The instant office action replaces the vacated action. Notice of Pre-AIA or AIA Status 2. The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . DETAILED ACTION RESPONSE TO AMENDMENT Status of Application/Amendments/claims 3. Applicant’s amendment filed May 19 2026 is acknowledged. Claims 2, 5-8, 11-16, 19-23, 27-29, 31-60, 64-65, 67, 69-73 and 76-79 are cancelled. Claims 1, 3-4, 9-10, and 30 are amended. Claims 80-85 are newly amended. Claims 1, 3-4, 9-10, 17-18, 24-26, 30, 61-63, 66, 68, 74-75 and new claims 80-85 are pending in this office action. Claims 17-18, 24-26, 30, 61-63, 66, 68 and 74-75 are withdrawn without traverse (filed 11/21/2025) from further consideration pursuant to 37 CFR 1.142(b) as being drawn to nonelected inventions, there being no allowable generic or linking claim. Election was made without traverse in the reply filed on November 21, 2025. 4. Claims 1, 3-4, 9-10 and 80-85 are under examination with respect to Tau and antibody or functional fragment thereof in this office action. 5. Applicant’s arguments filed on May 19 2026 have been fully considered but they are not deemed to be persuasive for the reasons set forth below. Drawings 6. The objection to Figures 26F, 33A and 40 is withdrawn in response to Applicant’s amendment to the specification. Claim Rejections/Objections Withdrawn 7. The objection to claims 3, 6, 8, 17-18, 20-22, 24-26, 30, 48-50, 54-55, 58-59, 61-63, 66, 68 and 74-75 is withdrawn in response to Applicant’s amendment to the claims and cancelation of claims 8, 20-22, 48-50, 54-55, 58-59. The rejection of claims 6 and 8 are rejected on the basis that it contains an improper Markush grouping of alternatives is moot because the claims are canceled. The rejection of claims 2-3 and 6 under 35 U.S.C. 112(a) or 35 U.S.C. 112 (pre-AIA ), first paragraph, as failing to comply with the written description requirement is moot because the claims are canceled. The rejection of claims 1-4 under 35 U.S.C. 102(a)(1) as being anticipated by Majdoul et al. (US11371061) is withdrawn in response to Applicant’s amendment to the claims and cancelation of claim 2. The rejection of claims 6 and 9-10 under 35 U.S.C. 103 as being unpatentable over Majdoul et al. (US11371061) in view of Sigurdsson (US10132818) is withdrawn in response to Applicant’s amendment to the claims and cancelation of claim 6. Claim Rejections/Objections Maintained In view of the amendment filed on May 19 2026, the following rejections are maintained. Claim Rejections - 35 USC § 112 8. The following is a quotation of the first paragraph of 35 U.S.C. 112(a): (a) IN GENERAL.—The specification shall contain a written description of the invention, and of the manner and process of making and using it, in such full, clear, concise, and exact terms as to enable any person skilled in the art to which it pertains, or with which it is most nearly connected, to make and use the same, and shall set forth the best mode contemplated by the inventor or joint inventor of carrying out the invention. The following is a quotation of the first paragraph of pre-AIA 35 U.S.C. 112: The specification shall contain a written description of the invention, and of the manner and process of making and using it, in such full, clear, concise, and exact terms as to enable any person skilled in the art to which it pertains, or with which it is most nearly connected, to make and use the same, and shall set forth the best mode contemplated by the inventor of carrying out his invention. Claims 1, 3-4, 9-10 and 80-85 are rejected under 35 U.S.C. 112(a) or 35 U.S.C. 112 (pre-AIA ), first paragraph, as failing to comply with the written description requirement. The claim(s) contains subject matter which was not described in the specification in such a way as to reasonably convey to one skilled in the relevant art that the inventor or a joint inventor, or for pre-AIA the inventor(s), at the time the application was filed, had possession of the claimed invention. The rejection is maintained for the reasons of record and the reasons set forth below. Claims 1, 3-4, 9-10 and 80-85 as amended encompass a genus of a recombinant protein or polypeptide comprising i) a genus of modified or unmodified Beclin 2 polypeptide, protein or a fragment thereof that is at least 70% identical to the sequence of instant SEQ ID NO:1 and ii) a genus of targeting moiety binding TAU. Claim 3 as amended encompasses a genus of the claimed recombinant protein or polypeptide comprising a genus of modified or unmodified Beclin2 protein or fragment that is at least 70% identical to SEQ ID NO:1 and comprises a genus of ATG9A-binding domain including at least 70% identical to SEQ ID NO:3. Claim 83 encompasses a genus of recombinant protein or polypeptide having an amino acid sequence at least 70% identical to the sequence of instant SEQ ID NO:5. Claims 9-10 and 80-83 as amended encompass a genus of the claimed recombinant protein or polypeptide comprising a genus of targeting moiety binding to TAU comprising a genus of structurally and functionally undefined antibodies or functional fragments thereof including a Fab, scFv or a VHH antibody. Claims 80-81 encompass a genus of the claimed recombinant protein or polypeptide comprising a genus of anti-Tau antibodies or antibody fragments thereof comprising a genus of VL having a sequence at least 80% identical to SEQ ID NO:7 and/or a genus of VH having a sequence at least 80% identical to SEQ ID NO:8 or a genus of anti-Tau antibodies or antibody fragments thereof comprising a polypeptide sequence at least 80% identical to SEQ ID NO:9. Claims 84-85 as amended encompass a recombinant protein or polypeptide comprising the amino acid sequence of SEQ ID NO:5 or comprising (i) a Beclin2 polypeptide comprising the amino acid sequence of SEQ ID NO:1 or a fragment thereof comprising the amino acid sequence of SEQ ID NO:3, and (ii) a targeting moiety comprising an anti-Tau scFv comprising the sequence of SEQ ID NO:9. Applicant has not disclosed sufficient species for the broad genus of recombinant protein comprising a modified or unmodified Beclin 2 polypeptide, protein or a fragment thereof that is at least 70% identical to instant SEQ ID NO:1 or 3 and ii) a genus of targeting moiety binding TAU or the broad genus of recombinant protein comprising a polypeptide sequence at least 70% identical to SEQ ID NO:5. Applicant also has not disclosed sufficient species for the broad genus of variants that is at least 70% identical to SEQ ID NO:1, the broad genus of ATG9A-binding domain or variant thereof with at least 70% identity to SEQ ID NO:3, the broad genus of targeting moiety binding to TAU, the broad genus of antibody/functional fragment thereof binding to TAU including the broad genus of Fab/scFv/VHH or comprising a genus of VL at least 80% identical to SEQ ID NO:7 and/or a genus of VH at least 80% identical to SEQ ID NO: 8, or a genus of anti-TAU antibody or fragment thereof comprising a sequence at least 80% identical to SEQ ID NO:9. The specification describes a strategic and hypothetic construct comprising a leader sequence for secretion-a scFv light chain sequence-a scFv heavy chain sequence-an antibody constant region sequence-a linker sequence-a Beclin-2 sequence-a 6xHis sequence-a HA tag sequence (SEQ ID NO:5) in Figure 40. The specification provides no information as to whether that the protein encoded by the construct shown in Figure 40 is functional (i.e. targeting and binding to Tau and Beclin-2 acting and functioning in autophagy and ligand-induced endolysosomal trafficking and degradation via interaction with GASP1). Response to Arguments On p. 11-12 of the response, Applicant argues that: i) the rejection has been overcome in view of amendment to the claims by defining “a modified or unmodified Beclin2 polypeptide, protein or a fragment thereof” as “comprising at least 70% identical to the sequence of SEQ ID NO:1” and “a targeting moiety” as “binding to TAU” and anti-Tau ScFv; ii) claims are directed to a composition and do not recite functions and thus it is not required to demonstrate possession of the claimed invention that are not claimed or experimental characterization of a hypothetical construct. Applicant further cites MPEP2163 in support of the arguments. Applicant's arguments have been fully considered but they are not found persuasive. Contrary to Applicant's arguments, the examiner asserts that based on MPEP §2163, MPEP §§2163.01-2163.03, the specification fails to provide sufficient description or information or evidence to demonstrate that Applicant is in possession of the claimed genus of recombinant protein or polypeptide comprising i) a genus of modified or unmodified Beclin 2 polypeptide, protein or a fragment thereof that is at least 70% identical to the sequence of instant SEQ ID NO:1 or 3 and ii) a genus of targeting moiety binding TAU because: i. Based on Applicant’s own admission on p. 83-84 of the instant specification and Figures 37A-B, BECN2 can only interact with APP and APOE4 but NOT Tau or TREM2. The Flag-Beclin 2 or HA-BECN2 fusion protein can only interact with or be coimmunoprecipitated with APP and APOE4 but NOT with Tau or TREM2. Based on Applicant’s own admission on p. 32; p.65-66 of the instant specification, the function and the role of Beclin 2 is involved in autophagy and is required for specific ligand-induced endolysosomal trafficking and degradation of several G protein-coupled receptors (GPCRs) through its interaction with GASP1, which requires specific intracellular protein interaction and trafficking to endosomes and lysosomes in intracellular degradation systems. ii. The claimed recombinant protein or polypeptide comprising a fusion protein comprising a structurally and functionally modified or unmodified Beclin 2 polypeptide, protein or a fragment thereof that is at least 70% identical to instant SEQ ID NO:1 and ii) a structurally and functionally undefined targeting moiety binding to Tau. iii. The specification provides no structural and functional relationship or correlation between the claimed genus of recombinant protein or polypeptide comprising a structurally and functionally modified or unmodified Beclin 2 polypeptide, protein or a fragment thereof that is at least 70% identical to instant SEQ ID NO:1 and ii) a structurally and functionally undefined targeting moiety binding to Tau and the Flag-Beclin 2 or HA-BECN2 that is capable of interacting with or coimmunoprecipitating with APP and APOE4 but NOT with Tau or TREM2. The specification also provides no structural and functional relationship or correlation between the recombinant protein having the sequence of SEQ ID NO:5 shown in Figure 40 or recited in claims 84-85 and the HA/Flag-BECN2 that can interact with or be coimmunoprecipitated with APP and APOE4 but NOT with Tau or TREM2. The specification provides no information or support to demonstrate that Applicant is in possession of the claimed genus of recombinant protein comprising a structurally and functionally modified or unmodified Beclin 2 polypeptide, protein or a fragment thereof that is at least 70% identical to instant SEQ ID NO:1 and ii) a structurally and functionally undefined targeting moiety binding to Tau. There is no structural and functional relationship between the genus of modified or unmodified Beclin 2 polypeptide, protein or a fragment thereof that is at least 70% identical to instant SEQ ID NO:1 or SEQ ID NO:3 and the full length wild type of Beclin 2 or comprising SEQ ID NO:1 or SEQ ID NO:3. It is not known what 30% within SEQ ID NO:1 can or cannot be changed or included in the claimed genus of modified or unmodified Beclin 2 polypeptide, protein or a fragment thereof in order to preserve the activity of full length wild type Beclin2 in interacting with APP and APOE in autophagy or interaction with specific ligand-induced endolysosomal trafficking and degradation of several G protein-coupled receptors (GPCRs) through its interaction with GASP1 in intracellular degradation systems. The specification provides no structural and functional relationship between the genus of targeting moiety binding Tau or comprising not a pair of VH and VL or variants of VH comprising a sequence at least 80% identical to SEQ ID NO:7 and/or variants of VL comprising a sequence at least 80% identical to SEQ ID NO:8 or variants of anti-Tau ScFv antibody or antigen-binding fragment comprising a sequence at least 80% identity to SEQ ID NO:9 and the anti-Tau scFv antibody comprising the sequence of SEQ ID NO:9 or even in autophagy and GPCR trafficking/degradation pathways via interaction with GASP1 in intracellular degradation systems. It is not known what 20% within SEQ ID NO:7, 8 or 9 can or cannot be changed or included in the claimed genus of targeting moiety binding Tau or comprising unpaired VH and VL or variants of VH comprising a sequence at least 80% identical to SEQ ID NO:7 and/or variants of VL comprising a sequence at least 80% identical to SEQ ID NO:8 in order to preserve the activity of the anti-Tau scFv antibody comprising the sequence of SEQ ID NO:9 in intracellular degradation systems. The specification provides no structural and functional relationship or correlation between the genus of recombinant protein having a sequence at least 70% identical to SEQ ID NO:5 and the full length wild type of protein or polypeptide comprising i) a Beclin 2 comprising SEQ ID NO:1 and ii) a targeting moiety comprising an anti-Tau scFv comprising SEQ ID NO: 9 or the recombinant protein having the sequence of SEQ ID NO:5. The specification also provides no structural and functional relationship or correlation between the genus of recombinant protein having a sequence at least 70% identical to SEQ ID NO:5 and the full length wild type Beclin2 acting in autophagy and GPCR trafficking/degradation pathways via interaction with GASP1 in intracellular degradation systems. It is not known what 30% within SEQ ID NO:5 can or cannot be changed or included in the claimed genus of recombinant protein having a sequence at least 70% identical to SEQ ID NO:5 in order to preserve the activity of full length wild type Beclin2 in interacting with APP and APOE or acting in autophagy and GPCR trafficking/degradation pathways via interaction with GASP1 in intracellular degradation systems. Taken together, the specification fails to provide sufficient description or information as to what other common structures and sequences are required by the claimed genus of recombinant protein comprising i) the claimed genus of modified or unmodified Beclin 2 polypeptide, protein or a fragment thereof that is at least 70% identical to instant SEQ ID NO:1 or SEQ ID NO:3 and ii) the claimed genus of targeting moiety binding Tau including variants of VL of SEQ ID NO:7 and/or VH of SEQ Id NO:8, or variants of anti-Tau scFv of SEQ ID NO:9, or the claimed genus of recombinant protein variants comprising a sequence at least 70% identical to SEQ ID NO:5. It is not known what other common structures and sequences can or cannot be included in the claimed genera in order to maintain the activity of Beclin2 acting in autophagy and GPCR trafficking/degradation pathways via interaction with GASP1 in intracellular degradation systems. Since the common characteristics/features of other recombinant proteins, or variants thereof comprising a sequence at least 70% identical to SEQ ID NO:5, other modified or unmodified Beclin 2 polypeptide, protein or a fragment thereof or variants thereof, or other targeting moiety binding Tau including anti-Tau antibodies or variants thereof are unknown, a skilled artisan cannot envision the functional correlations of the genus with the claimed invention in view of Burgess et al. (J of Cell Bio. 1990, 111:2129-2138, cited previously), Bowie et al. (see col 2, p. 1306, Bowie et al. Science, 1990, 247:1306-1310, cited previously), Pawson et al. (see p. 445 the second column, first paragraph, Pawson et al. 2003, Science 300:445-452, cited previously), Alaoui-lsmaili et al. (see p. 502, right col., 2th paragraph; Alaoui-lsmaili et al., Cytokine Growth Factor Rev. 2009; 20:501-507, cited previously) and Guo et al. (see p. 9207, left col., 2th paragraph, Guo et al., PNAS 2004; 101:9205-9210, cited previously). Accordingly, in the absence of sufficient recitation of distinguishing identifying characteristics, the specification does not provide adequate written description of the genus of recombinant protein comprising i) the claimed genus of modified or unmodified Beclin 2 polypeptide, protein or a fragment thereof that is at least 70% identical to instant SEQ ID NO:1 or SEQ ID NO:3 and ii) the claimed genus of targeting moiety binding Tau including variants of VL of SEQ ID NO:7 and/or VH of SEQ Id NO:8, or variants of anti-Tau scFv of SEQ ID NO:9, or the claimed genus of recombinant protein variants comprising a sequence at least 70% identical to SEQ ID NO:5. iv. As stated in M.P.E.P. § 2163(II)(A)(3), a specification may describe an actual reduction to practice by showing that the inventor constructed an embodiment or performed a process that met all the limitations of the claim and determined that the invention would work for its intended purpose. Cooper v. Goldfarb, 154 F.3d 1321,1327, 47 USPQ2d 1896, 1901 (Fed. Cir. 1998). See also UMC Elecs. Co. v. United States, 816 F.2d 647, 652, 2 USPQ2d 1465, 1468 (Fed. Cir. 1987) (“[T]here cannot be a reduction to practice of the invention ... without a physical embodiment which includes all limitations of the claim.”); Estee Lauder Inc. v. L’Oreal, S.A., 129 F.3d 588, 593, 44 USPQ2d 1610, 1614 (Fed. Cir. 1997) (“[A] reduction to practice does not occur until the inventor has determined that the invention will work for its intended purpose.”); Mahurkar v. C.R. Bard, Inc., 79 F.3d 1572, 1578, 38 USPQ2d 1288, 1291 (Fed. Cir. 1996) (determining that the invention will work for its intended purpose may require testing depending on the character of the invention and the problem it solves). Whereas a reduction to practice of an uncomplicated invention such as a simple mechanical or electrical device can be achieved by merely providing a diagram of the device wherein one skilled in the relevant art can predict the likely operability of the device by reviewing the diagram, the operability of the claimed invention cannot be predicted by merely reviewing diagrams or illustrations. To demonstrate the reduction to practice of a recombinant protein or polypeptide comprising i) a modified or unmodified Beclin 2 polypeptide, protein or a fragment thereof that is at least 70% identical to the sequence of instant SEQ ID NO:1 or 3 and ii) a targeting moiety binding TAU requires either a working embodiment, a demonstration of operability in the activity in autophagy or an art accepted model or animal model of the condition to be treated wherein the model or the animal model has been shown to be reliably predictive of acting in autophagy like Beclin2 or binding to Tau and interacting with specific intracellular protein in the GPCR trafficking/degradation pathways in intracellular degradation systems. In the instant case, Applicant has provided none of these. Consequently, Applicant has failed to demonstrate possession of the claimed recombinant protein or polypeptide or even a single species of the genus required thereby as of the earliest effective filing date of the instant application. With respect to the demonstration of a reduction to practice of a generic invention, M.P.E.P. § 2163(II)(A)(3)(ii) states that the written description requirement for a claimed genus may be satisfied through sufficient description of a representative number of species by actual reduction to practice, reduction to drawings, or by disclosure of relevant, identifying characteristics, i.e., structure or other physical and/or chemical properties, by functional characteristics coupled with a known or disclosed correlation between function and structure, or by a combination of such identifying characteristics, sufficient to show the applicant was in possession of the claimed genus, above). See Eli Lilly, 119 F.3d at 1568, 43 USPQ2d at 1406. A “representative number of species” means that the species which are adequately described are representative of the entire genus. Thus, when there is substantial variation within the genus, one must describe a sufficient variety of species to reflect the variation within the genus. See AbbVie Deutschland GmbH & Co., KG v. Janssen Biotech, Inc., 759 F.3d 1285, 1300, 111 USPQ2d 1780, 1790 (Fed. Cir. 2014). The above position is further supported by In re Clarke, 148 USPQ 665, (CCPA 1966), which held that; “ It appears to be well settled that a single species can rarely, if ever, afford support fora generic claim. In re Soil, 25 C.C.P.A. (Patents) 1309, 97 F.2d 623, 38 USPQ 189; In re Wahlforss et al., 28 C.C.P.A. (Patents) 867,117 F.21 270,48 USPQ 397. The decisions do not however fix any definite number of species which will establish completion of a generic invention and it seems evident therefrom that such number will vary, depending on the circumstances of particular cases. Thus, in the case of a small genus such as halogens, consisting of four species, a reduction to practice of three, or perhaps even two, might serve to complete the generic invention, while in the case of a genus comprising hundreds of species, a considerably large number of reductions to practice would probably be necessary.” In the instant case, Applicant has failed to demonstrate a reduction to practice of a representative number species of the genus of recombinant protein or polypeptide comprising i) a modified or unmodified Beclin 2 polypeptide, protein or a fragment thereof that is at least 70% identical to the sequence of instant SEQ ID NO:1 or 3 and ii) a targeting moiety binding TAU“ because there is no structural and functional relationship or correction between the claimed genus of recombinant protein or polypeptide and Beclin 2 acting in autophagy or binding to Tau and interacting with specific intracellular protein in the GPCR trafficking/degradation pathways in intracellular degradation systems, or even a single species within that genus. The experimental results described in the specification consist primarily of the characterization of physiological differences between a mouse lacking a functional Beclin2/BECN2 gene and an otherwise corresponding wild-type mouse. Whereas those results demonstrate that mice lacking a functional Beclin2/BECN2 gene possess increased Tau phosphorylation in Beclin2/BECN2 KO mice, they do not support a conclusion that Applicant was in possession of the claimed genus of recombinant protein or polypeptide comprising i) a modified or unmodified Beclin 2 polypeptide, protein or a fragment thereof that is at least 70% identical to the sequence of instant SEQ ID NO:1 or 3 and ii) a targeting moiety binding TAU“ because there is no structural and functional relationship or correction between the claimed genus of recombinant protein or polypeptide and Beclin 2 acting in autophagy or binding to Tau and interacting with specific intracellular protein in the GPCR trafficking/degradation pathways in intracellular degradation systems, or even a single species within that genus. Based on MPEP § 2161.01 and §2163, “to satisfy the written description requirement, a patent specification must describe the claimed invention in sufficient detail that one skilled in the art can reasonably conclude that the inventor had possession of the claimed invention. See, e.g., Moba, B.V. v. Diamond Automation, Inc., 325 F.3d 1306, 1319, 66 USPQ2d 1429, 1438 (Fed. Cir. 2003); Vas-Cath, Inc. v. Mahurkar, 935 F.2d at 1563, 19 USPQ2d at 1116”. Vas-Cath Inc. v. Mahurkar, 19USPQ2d 1111, clearly states “applicant must convey with reasonable clarity to those skilled in the art that, as of the filing date sought, he or she was in possession of the invention. The invention is, for purposes of the ‘written description’ inquiry, whatever is now claimed.” (See page 1117.) The specification does not “clearly allow persons of ordinary skill in the art to recognize that [he or she] invented what is claimed.” (See Vas-Cath at page 1116). As discussed above, the skilled artisan cannot envision the detailed chemical structure of the encompassed genus of recombinant protein comprising i) the claimed genus of modified or unmodified Beclin 2 polypeptide, protein or a fragment thereof that is at least 70% identical to instant SEQ ID NO:1 or SEQ ID NO:3 and ii) the claimed genus of targeting moiety binding Tau including variants of VL of SEQ ID NO:7 and/or VH of SEQ Id NO:8, or variants of anti-Tau scFv of SEQ ID NO:9 or the claimed genus of recombinant protein variants comprising a sequence at least 70% identical to SEQ ID NO:5, and therefore conception is not achieved until reduction to practice has occurred, regardless of the complexity or simplicity of the method of isolation. Adequate written description requires more than a mere statement that it is part of the invention and reference to a potential method of isolating it. The compound itself is required. See Fiers v. Revel, 25 USPQ2d 1601 at 1606 (CAFC 1993) and Amgen Inc. v. Chugai Pharmaceutical Co. Ltd., 18 USPQ2d 1016. One cannot describe what one has not conceived. See Fiddes v. Baird, 30 USPQ2d 1481 at 1483 and Centocor v. Abbott, 636 F.3d1341 (Fed. Cir. 2011) and AbbVie v. Janssen, 759 F.3d 1285 (Fed. Cir.2014). One cannot describe what one has not conceived. See Fiddes v. Baird, 30 USPQ2d 1481 at 1483. Therefore, the claimed recombinant proteins or polypeptides have not met the written description provision of 35 U.S.C. §112, first paragraph. Applicant is reminded that Vas-Cath makes clear that the written description provision of 35 U.S.C. §112 is severable from its enablement provision (see page 1115). Applicant is directed to the Guidelines for the Examination of Patent Applications Under the 35 U.S.C. 112, ¶ 1 "Written Description" Requirement. See MPEP § 2161.01 and 2163. Accordingly, the rejection of claims 1, 3-4, 9-10 and 80-85 under 35 U.S.C. 112(a) or 35 U.S.C. 112 (pre-AIA ), first paragraph, as failing to comply with the written description requirement is maintained. Conclusion 9. NO CLAIM IS ALLOWED. 10. The prior art made of record and not relied upon is considered pertinent to applicant's disclosure. Majdoul et al. (US11371061) teaches that Beclin 2 is involved in autophagy and function in an additional lysosomal degradation pathway (see col.2, lines 36-39). Majdoul teaches that Beclin2 comprises the amino acid sequence of SEQ ID NO:64, which is 100% identical to instant SEQ ID NO:1 or 3 as recited in claims 1, 3-4, 82 and 85 (see the sequence alignment below; col. 11, line 9; col. 11, line 46-col. 12, line 33). SEQ ID NO:1 US-15-772-902C-64 (NOTE: this sequence has 1 duplicate in the database searched) Sequence 64, US/15772902C Patent No. 11371061 GENERAL INFORMATION APPLICANT: GENETHON et al. TITLE OF INVENTION: COMPOSITIONS AND METHODS FOR IMPROVING VIRAL VECTOR EFFICIENCY FILE REFERENCE: 11450517US CURRENT APPLICATION NUMBER: US/15/772,902C CURRENT FILING DATE: 2018-05-02 NUMBER OF SEQ ID NOS: 102 SEQ ID NO 64 LENGTH: 431 TYPE: PRT ORGANISM: Homo sapiens Query Match 100.0%; Score 2227; Length 431; Best Local Similarity 100.0%; Matches 431; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 MSSIRFLCQRCHQALKLSGSSESRSLPAAPAPTSGQAEPGDTREPGVTTREVTDAEEQQD 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MSSIRFLCQRCHQALKLSGSSESRSLPAAPAPTSGQAEPGDTREPGVTTREVTDAEEQQD 60 Qy 61 GASSRSPPGDGSVSKGHANIFTLLGELGAMHMLSSIQKAAGDIFDIVSGQAVVDHPLCEE 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 GASSRSPPGDGSVSKGHANIFTLLGELGAMHMLSSIQKAAGDIFDIVSGQAVVDHPLCEE 120 Qy 121 CTDSLLEQLDIQLALTEADSQNYQRCLETGELATSEDEAAALRAELRDLELEEARLVQEL 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 CTDSLLEQLDIQLALTEADSQNYQRCLETGELATSEDEAAALRAELRDLELEEARLVQEL 180 Qy 181 EDVDRNNARAAADLQAAQAEAAELDQQERQHYRDYSALKRQQLELLDQLGNVENQLQYAR 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 EDVDRNNARAAADLQAAQAEAAELDQQERQHYRDYSALKRQQLELLDQLGNVENQLQYAR 240 Qy 241 VQRDRLKEINCFTATFEIWVEGPLGVINNFRLGRLPTVRVGWNEINTAWGQAALLLLTLA 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 VQRDRLKEINCFTATFEIWVEGPLGVINNFRLGRLPTVRVGWNEINTAWGQAALLLLTLA 300 Qy 301 NTIGLQFQRYRLIPCGNHSYLKSLTDDRTELPLFCYGGQDVFLNNKYDRAMVAFLDCMQQ 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 NTIGLQFQRYRLIPCGNHSYLKSLTDDRTELPLFCYGGQDVFLNNKYDRAMVAFLDCMQQ 360 Qy 361 FKEEAEKGELGLSLPYGIQVETGLMEDVGGRGECYSIRTHLNTQELWTKALKFMLINFKW 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 FKEEAEKGELGLSLPYGIQVETGLMEDVGGRGECYSIRTHLNTQELWTKALKFMLINFKW 420 Qy 421 SLIWVASRYQK 431 ||||||||||| Db 421 SLIWVASRYQK 431 SEQ ID NO:3 US-15-772-902C-64 (NOTE: this sequence has 1 duplicate in the database searched) Sequence 64, US/15772902C Patent No. 11371061 GENERAL INFORMATION APPLICANT: GENETHON et al. TITLE OF INVENTION: COMPOSITIONS AND METHODS FOR IMPROVING VIRAL VECTOR EFFICIENCY FILE REFERENCE: 11450517US CURRENT APPLICATION NUMBER: US/15/772,902C CURRENT FILING DATE: 2018-05-02 NUMBER OF SEQ ID NOS: 102 SEQ ID NO 64 LENGTH: 431 TYPE: PRT ORGANISM: Homo sapiens Query Match 99.7%; Score 1673; Length 431; Best Local Similarity 100.0%; Matches 322; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 2 QAVVDHPLCEECTDSLLEQLDIQLALTEADSQNYQRCLETGELATSEDEAAALRAELRDL 61 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 110 QAVVDHPLCEECTDSLLEQLDIQLALTEADSQNYQRCLETGELATSEDEAAALRAELRDL 169 Qy 62 ELEEARLVQELEDVDRNNARAAADLQAAQAEAAELDQQERQHYRDYSALKRQQLELLDQL 121 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 170 ELEEARLVQELEDVDRNNARAAADLQAAQAEAAELDQQERQHYRDYSALKRQQLELLDQL 229 Qy 122 GNVENQLQYARVQRDRLKEINCFTATFEIWVEGPLGVINNFRLGRLPTVRVGWNEINTAW 181 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 230 GNVENQLQYARVQRDRLKEINCFTATFEIWVEGPLGVINNFRLGRLPTVRVGWNEINTAW 289 Qy 182 GQAALLLLTLANTIGLQFQRYRLIPCGNHSYLKSLTDDRTELPLFCYGGQDVFLNNKYDR 241 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 290 GQAALLLLTLANTIGLQFQRYRLIPCGNHSYLKSLTDDRTELPLFCYGGQDVFLNNKYDR 349 Qy 242 AMVAFLDCMQQFKEEAEKGELGLSLPYGIQVETGLMEDVGGRGECYSIRTHLNTQELWTK 301 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 350 AMVAFLDCMQQFKEEAEKGELGLSLPYGIQVETGLMEDVGGRGECYSIRTHLNTQELWTK 409 Qy 302 ALKFMLINFKWSLIWVASRYQK 323 |||||||||||||||||||||| Db 410 ALKFMLINFKWSLIWVASRYQK 431 Sigurdsson (US10132818) teaches an anti-Tau scFv antibody, anti-Tau scFv235 antibody comprising the amino acid sequence of SEQ ID NO:18, which is 100% identical to SEQ ID NO:9 and comprises a VL of SEQ ID NO:7 and a VH of SEQ ID NO:8 for binding to and targeting to pathological Tau including phosphorylated Tau (see the sequence alignment below; col. 22, lines 36-col. 25, line 67). SEQ ID NO:9 US-15-324-141-18 (NOTE: this sequence has 2 duplicates in the database searched) Sequence 18, US/15324141 Patent No. 10132818 GENERAL INFORMATION APPLICANT: New York University APPLICANT: Sigurdsson, Einar TITLE OF INVENTION: Tau Imaging Ligands and Their Uses in the Diagnosis and Treatment TITLE OF INVENTION: of Tauopathy FILE REFERENCE: SIG01-09-WO-PCT 1400.0007WO CURRENT APPLICATION NUMBER: US/15/324,141 CURRENT FILING DATE: 2017-01-05 NUMBER OF SEQ ID NOS: 26 SEQ ID NO 18 LENGTH: 250 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: Amino Acid Sequence of scFv235 Query Match 100.0%; Score 1270; Length 250; Best Local Similarity 100.0%; Matches 242; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 ELDVVMTQTPLTLSVTIGQPASISCKSSQSLLYSNGKTYLNWLLQRPGQSPKRLIYLVSK 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 ELDVVMTQTPLTLSVTIGQPASISCKSSQSLLYSNGKTYLNWLLQRPGQSPKRLIYLVSK 60 Qy 61 LDSGVPDRFTGSGSGTDFTLKISRVEAEDLGVYYCVQGTHSPLTFGAGTKLELKSSGGGG 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 LDSGVPDRFTGSGSGTDFTLKISRVEAEDLGVYYCVQGTHSPLTFGAGTKLELKSSGGGG 120 Qy 121 SGGGGGGSSRSSLEVQLQQSGPELVKPGASVKISCKTSEYTFTEYTKHWVKQSHGKSLEW 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 SGGGGGGSSRSSLEVQLQQSGPELVKPGASVKISCKTSEYTFTEYTKHWVKQSHGKSLEW 180 Qy 181 IGSINPNNGDTYYNQKFTDKATLTVDKSSTTASMELRSLTFEDSAVYYCAMGDSAWFAYW 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 IGSINPNNGDTYYNQKFTDKATLTVDKSSTTASMELRSLTFEDSAVYYCAMGDSAWFAYW 240 Qy 241 GQ 242 || Db 241 GQ 242 SEQ ID NO:7 US-15-324-141-18 (NOTE: this sequence has 2 duplicates in the database searched) Sequence 18, US/15324141 Patent No. 10132818 GENERAL INFORMATION APPLICANT: New York University APPLICANT: Sigurdsson, Einar TITLE OF INVENTION: Tau Imaging Ligands and Their Uses in the Diagnosis and Treatment TITLE OF INVENTION: of Tauopathy FILE REFERENCE: SIG01-09-WO-PCT 1400.0007WO CURRENT APPLICATION NUMBER: US/15/324,141 CURRENT FILING DATE: 2017-01-05 NUMBER OF SEQ ID NOS: 26 SEQ ID NO 18 LENGTH: 250 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: Amino Acid Sequence of scFv235 Query Match 100.0%; Score 585; Length 250; Best Local Similarity 100.0%; Matches 114; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 ELDVVMTQTPLTLSVTIGQPASISCKSSQSLLYSNGKTYLNWLLQRPGQSPKRLIYLVSK 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 ELDVVMTQTPLTLSVTIGQPASISCKSSQSLLYSNGKTYLNWLLQRPGQSPKRLIYLVSK 60 Qy 61 LDSGVPDRFTGSGSGTDFTLKISRVEAEDLGVYYCVQGTHSPLTFGAGTKLELK 114 |||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 LDSGVPDRFTGSGSGTDFTLKISRVEAEDLGVYYCVQGTHSPLTFGAGTKLELK 114 SEQ ID NO:8 US-15-324-141-18 (NOTE: this sequence has 2 duplicates in the database searched) Sequence 18, US/15324141 Patent No. 10132818 GENERAL INFORMATION APPLICANT: New York University APPLICANT: Sigurdsson, Einar TITLE OF INVENTION: Tau Imaging Ligands and Their Uses in the Diagnosis and Treatment TITLE OF INVENTION: of Tauopathy FILE REFERENCE: SIG01-09-WO-PCT 1400.0007WO CURRENT APPLICATION NUMBER: US/15/324,141 CURRENT FILING DATE: 2017-01-05 NUMBER OF SEQ ID NOS: 26 SEQ ID NO 18 LENGTH: 250 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: Amino Acid Sequence of scFv235 Query Match 100.0%; Score 592; Length 250; Best Local Similarity 100.0%; Matches 110; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 LEVQLQQSGPELVKPGASVKISCKTSEYTFTEYTKHWVKQSHGKSLEWIGSINPNNGDTY 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 133 LEVQLQQSGPELVKPGASVKISCKTSEYTFTEYTKHWVKQSHGKSLEWIGSINPNNGDTY 192 Qy 61 YNQKFTDKATLTVDKSSTTASMELRSLTFEDSAVYYCAMGDSAWFAYWGQ 110 |||||||||||||||||||||||||||||||||||||||||||||||||| Db 193 YNQKFTDKATLTVDKSSTTASMELRSLTFEDSAVYYCAMGDSAWFAYWGQ 242 US20180318447 teaches a viral vector encoding Beclin2 comprising the amino acid sequence of SEQ ID NO:64, which is 100% identical to instant SEQ ID NO:1, or SEQ ID NO:3 (see the sequence alignment below). SEQ ID NO:1 SEQ ID NO:1 US-15-772-902-64 (NOTE: this sequence has 5 duplicates in the database searched) Sequence 64, US/15772902 Publication No. US20180318447A1 GENERAL INFORMATION APPLICANT: GENETHON et al. TITLE OF INVENTION: COMPOSITIONS AND METHODS FOR IMPROVING VIRAL VECTOR EFFICIENCY FILE REFERENCE: B2148PC00 CURRENT APPLICATION NUMBER: US/15/772,902 CURRENT FILING DATE: 2018-05-02 NUMBER OF SEQ ID NOS: 101 SEQ ID NO 64 LENGTH: 431 TYPE: PRT ORGANISM: Homo sapiens Query Match 100.0%; Score 2227; Length 431; Best Local Similarity 100.0%; Matches 431; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 MSSIRFLCQRCHQALKLSGSSESRSLPAAPAPTSGQAEPGDTREPGVTTREVTDAEEQQD 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MSSIRFLCQRCHQALKLSGSSESRSLPAAPAPTSGQAEPGDTREPGVTTREVTDAEEQQD 60 Qy 61 GASSRSPPGDGSVSKGHANIFTLLGELGAMHMLSSIQKAAGDIFDIVSGQAVVDHPLCEE 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 GASSRSPPGDGSVSKGHANIFTLLGELGAMHMLSSIQKAAGDIFDIVSGQAVVDHPLCEE 120 Qy 121 CTDSLLEQLDIQLALTEADSQNYQRCLETGELATSEDEAAALRAELRDLELEEARLVQEL 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 CTDSLLEQLDIQLALTEADSQNYQRCLETGELATSEDEAAALRAELRDLELEEARLVQEL 180 Qy 181 EDVDRNNARAAADLQAAQAEAAELDQQERQHYRDYSALKRQQLELLDQLGNVENQLQYAR 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 EDVDRNNARAAADLQAAQAEAAELDQQERQHYRDYSALKRQQLELLDQLGNVENQLQYAR 240 Qy 241 VQRDRLKEINCFTATFEIWVEGPLGVINNFRLGRLPTVRVGWNEINTAWGQAALLLLTLA 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 VQRDRLKEINCFTATFEIWVEGPLGVINNFRLGRLPTVRVGWNEINTAWGQAALLLLTLA 300 Qy 301 NTIGLQFQRYRLIPCGNHSYLKSLTDDRTELPLFCYGGQDVFLNNKYDRAMVAFLDCMQQ 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 NTIGLQFQRYRLIPCGNHSYLKSLTDDRTELPLFCYGGQDVFLNNKYDRAMVAFLDCMQQ 360 Qy 361 FKEEAEKGELGLSLPYGIQVETGLMEDVGGRGECYSIRTHLNTQELWTKALKFMLINFKW 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 FKEEAEKGELGLSLPYGIQVETGLMEDVGGRGECYSIRTHLNTQELWTKALKFMLINFKW 420 Qy 421 SLIWVASRYQK 431 ||||||||||| Db 421 SLIWVASRYQK 431 SEQ ID NO:3 US-15-772-902-64 (NOTE: this sequence has 5 duplicates in the database searched) Sequence 64, US/15772902 Publication No. US20180318447A1 GENERAL INFORMATION APPLICANT: GENETHON et al. TITLE OF INVENTION: COMPOSITIONS AND METHODS FOR IMPROVING VIRAL VECTOR EFFICIENCY FILE REFERENCE: B2148PC00 CURRENT APPLICATION NUMBER: US/15/772,902 CURRENT FILING DATE: 2018-05-02 NUMBER OF SEQ ID NOS: 101 SEQ ID NO 64 LENGTH: 431 TYPE: PRT ORGANISM: Homo sapiens Query Match 99.7%; Score 1673; Length 431; Best Local Similarity 100.0%; Matches 322; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 2 QAVVDHPLCEECTDSLLEQLDIQLALTEADSQNYQRCLETGELATSEDEAAALRAELRDL 61 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 110 QAVVDHPLCEECTDSLLEQLDIQLALTEADSQNYQRCLETGELATSEDEAAALRAELRDL 169 Qy 62 ELEEARLVQELEDVDRNNARAAADLQAAQAEAAELDQQERQHYRDYSALKRQQLELLDQL 121 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 170 ELEEARLVQELEDVDRNNARAAADLQAAQAEAAELDQQERQHYRDYSALKRQQLELLDQL 229 Qy 122 GNVENQLQYARVQRDRLKEINCFTATFEIWVEGPLGVINNFRLGRLPTVRVGWNEINTAW 181 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 230 GNVENQLQYARVQRDRLKEINCFTATFEIWVEGPLGVINNFRLGRLPTVRVGWNEINTAW 289 Qy 182 GQAALLLLTLANTIGLQFQRYRLIPCGNHSYLKSLTDDRTELPLFCYGGQDVFLNNKYDR 241 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 290 GQAALLLLTLANTIGLQFQRYRLIPCGNHSYLKSLTDDRTELPLFCYGGQDVFLNNKYDR 349 Qy 242 AMVAFLDCMQQFKEEAEKGELGLSLPYGIQVETGLMEDVGGRGECYSIRTHLNTQELWTK 301 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 350 AMVAFLDCMQQFKEEAEKGELGLSLPYGIQVETGLMEDVGGRGECYSIRTHLNTQELWTK 409 Qy 302 ALKFMLINFKWSLIWVASRYQK 323 |||||||||||||||||||||| Db 410 ALKFMLINFKWSLIWVASRYQK 431 WO2017093330 teaches a novel fusion protein comprising a cell-penetrating peptide moiety and a Beclin-derived peptide moiety comprising the amino acid sequence of SEQ ID NO:64, which is 100% identical to instant SEQ ID NO:1, or SEQ ID NO:3 (see the sequence alignment below). SEQ ID NO:1 BDY51425 (NOTE: this sequence has 2 duplicates in the database searched) ID BDY51425 standard; protein; 431 AA. XX AC BDY51425; XX DT 27-JUL-2017 (first entry) XX DE Human beclin-2 protein, SEQ 64. XX KW beclin-2; microorganism detection; recombinant protein; transduction. XX OS Homo sapiens. XX CC PN WO2017093330-A1. XX CC PD 08-JUN-2017. XX CC PF 30-NOV-2016; 2016WO-EP079304. XX PR 03-DEC-2015; 2015EP-00306924. PR 17-OCT-2016; 2016EP-00194180. XX CC PA (GENE-) GENETHON III. CC PA (UYDE-) UNIV DEVRY VAL DESSONNE. CC PA (INRM ) INSERM INST NAT SANTE & RECH MEDICALE. XX CC PI Fenard D, Majdoul S; XX DR WPI; 2017-38214S/41. XX CC PT New peptide comprising cell-penetrating peptide moiety, and a Beclin- CC PT derived peptide moiety, useful for e.g. promoting transduction of cell by CC PT virus or viral vector. XX CC PS Disclosure; SEQ ID NO 64; 53pp; English. XX CC The present invention relates to a novel fusion peptide comprising a cell CC -penetrating peptide (CPP) moiety, and a Beclin-derived peptide moiety. CC The invention also provides: an in vitro method for promoting the CC transduction of a cell by a virus or viral vector; a complex of a virus CC or viral vector with a peptide; a nucleic acid construct comprising a CC polynucleotide encoding the peptide; a kit comprising the peptide; and an CC in vitro method for increasing the sensitivity of a cell-based assay for CC detecting the presence or absence of a virus in a sample. The present CC sequence represents a human beclin-2 protein, which can be useful for CC preparing the fusion peptide of the invention XX SQ Sequence 431 AA; Query Match 100.0%; Score 2227; Length 431; Best Local Similarity 100.0%; Matches 431; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 MSSIRFLCQRCHQALKLSGSSESRSLPAAPAPTSGQAEPGDTREPGVTTREVTDAEEQQD 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MSSIRFLCQRCHQALKLSGSSESRSLPAAPAPTSGQAEPGDTREPGVTTREVTDAEEQQD 60 Qy 61 GASSRSPPGDGSVSKGHANIFTLLGELGAMHMLSSIQKAAGDIFDIVSGQAVVDHPLCEE 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 GASSRSPPGDGSVSKGHANIFTLLGELGAMHMLSSIQKAAGDIFDIVSGQAVVDHPLCEE 120 Qy 121 CTDSLLEQLDIQLALTEADSQNYQRCLETGELATSEDEAAALRAELRDLELEEARLVQEL 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 CTDSLLEQLDIQLALTEADSQNYQRCLETGELATSEDEAAALRAELRDLELEEARLVQEL 180 Qy 181 EDVDRNNARAAADLQAAQAEAAELDQQERQHYRDYSALKRQQLELLDQLGNVENQLQYAR 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 EDVDRNNARAAADLQAAQAEAAELDQQERQHYRDYSALKRQQLELLDQLGNVENQLQYAR 240 Qy 241 VQRDRLKEINCFTATFEIWVEGPLGVINNFRLGRLPTVRVGWNEINTAWGQAALLLLTLA 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 VQRDRLKEINCFTATFEIWVEGPLGVINNFRLGRLPTVRVGWNEINTAWGQAALLLLTLA 300 Qy 301 NTIGLQFQRYRLIPCGNHSYLKSLTDDRTELPLFCYGGQDVFLNNKYDRAMVAFLDCMQQ 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 NTIGLQFQRYRLIPCGNHSYLKSLTDDRTELPLFCYGGQDVFLNNKYDRAMVAFLDCMQQ 360 Qy 361 FKEEAEKGELGLSLPYGIQVETGLMEDVGGRGECYSIRTHLNTQELWTKALKFMLINFKW 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 FKEEAEKGELGLSLPYGIQVETGLMEDVGGRGECYSIRTHLNTQELWTKALKFMLINFKW 420 Qy 421 SLIWVASRYQK 431 ||||||||||| Db 421 SLIWVASRYQK 431 SEQ ID NO:3 BDY51425 (NOTE: this sequence has 2 duplicates in the database searched) ID BDY51425 standard; protein; 431 AA. XX AC BDY51425; XX DT 27-JUL-2017 (first entry) XX DE Human beclin-2 protein, SEQ 64. XX KW beclin-2; microorganism detection; recombinant protein; transduction. XX OS Homo sapiens. XX CC PN WO2017093330-A1. XX CC PD 08-JUN-2017. XX CC PF 30-NOV-2016; 2016WO-EP079304. XX PR 03-DEC-2015; 2015EP-00306924. PR 17-OCT-2016; 2016EP-00194180. XX CC PA (GENE-) GENETHON III. CC PA (UYDE-) UNIV DEVRY VAL DESSONNE. CC PA (INRM ) INSERM INST NAT SANTE & RECH MEDICALE. XX CC PI Fenard D, Majdoul S; XX DR WPI; 2017-38214S/41. XX CC PT New peptide comprising cell-penetrating peptide moiety, and a Beclin- CC PT derived peptide moiety, useful for e.g. promoting transduction of cell by CC PT virus or viral vector. XX CC PS Disclosure; SEQ ID NO 64; 53pp; English. XX CC The present invention relates to a novel fusion peptide comprising a cell CC -penetrating peptide (CPP) moiety, and a Beclin-derived peptide moiety. CC The invention also provides: an in vitro method for promoting the CC transduction of a cell by a virus or viral vector; a complex of a virus CC or viral vector with a peptide; a nucleic acid construct comprising a CC polynucleotide encoding the peptide; a kit comprising the peptide; and an CC in vitro method for increasing the sensitivity of a cell-based assay for CC detecting the presence or absence of a virus in a sample. The present CC sequence represents a human beclin-2 protein, which can be useful for CC preparing the fusion peptide of the invention XX SQ Sequence 431 AA; Query Match 99.7%; Score 1673; Length 431; Best Local Similarity 100.0%; Matches 322; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 2 QAVVDHPLCEECTDSLLEQLDIQLALTEADSQNYQRCLETGELATSEDEAAALRAELRDL 61 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 110 QAVVDHPLCEECTDSLLEQLDIQLALTEADSQNYQRCLETGELATSEDEAAALRAELRDL 169 Qy 62 ELEEARLVQELEDVDRNNARAAADLQAAQAEAAELDQQERQHYRDYSALKRQQLELLDQL 121 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 170 ELEEARLVQELEDVDRNNARAAADLQAAQAEAAELDQQERQHYRDYSALKRQQLELLDQL 229 Qy 122 GNVENQLQYARVQRDRLKEINCFTATFEIWVEGPLGVINNFRLGRLPTVRVGWNEINTAW 181 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 230 GNVENQLQYARVQRDRLKEINCFTATFEIWVEGPLGVINNFRLGRLPTVRVGWNEINTAW 289 Qy 182 GQAALLLLTLANTIGLQFQRYRLIPCGNHSYLKSLTDDRTELPLFCYGGQDVFLNNKYDR 241 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 290 GQAALLLLTLANTIGLQFQRYRLIPCGNHSYLKSLTDDRTELPLFCYGGQDVFLNNKYDR 349 Qy 242 AMVAFLDCMQQFKEEAEKGELGLSLPYGIQVETGLMEDVGGRGECYSIRTHLNTQELWTK 301 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 350 AMVAFLDCMQQFKEEAEKGELGLSLPYGIQVETGLMEDVGGRGECYSIRTHLNTQELWTK 409 Qy 302 ALKFMLINFKWSLIWVASRYQK 323 |||||||||||||||||||||| Db 410 ALKFMLINFKWSLIWVASRYQK 431 US11446398 teaches a protein comprising the amino acid sequence of SEQ ID NO:8897, which is 100% identical to instant SEQ ID NO:1, or SEQ ID NO:3 (see the sequence alignment below). SEQ ID NO:1 Sequence 8897, US/16092829B Patent No. 11446398 GENERAL INFORMATION APPLICANT: BARRETT, PETER APPLICANT: GLADSTONE, MICHAEL N. APPLICANT: KASSUM, TARIQ A. APPLICANT: SURI, VIPIN APPLICANT: LI, DAN JUN APPLICANT: SUN, DEXUE APPLICANT: DOLINSKI, BRIAN TITLE OF INVENTION: REGULATED BIOCIRCUIT SYSTEMS FILE REFERENCE: 2095.1300US371 CURRENT APPLICATION NUMBER: US/16/092,829B CURRENT FILING DATE: 2018-10-11 PRIOR APPLICATION NUMBER: PCT/US2017/026950 PRIOR FILING DATE: 2017-04-11 PRIOR APPLICATION NUMBER: 62/320,864 PRIOR FILING DATE: 2016-04-11 PRIOR APPLICATION NUMBER: 62/466,596 PRIOR FILING DATE: 2017-03-03 NUMBER OF SEQ ID NOS: 213456 SEQ ID NO 8897 LENGTH: 431 TYPE: PRT ORGANISM: Homo sapiens FEATURE: OTHER INFORMATION: Payload ID: 1803; FEATURE: OTHER INFORMATION: Gene Symbol: BECN2; FEATURE: OTHER INFORMATION: Gene Name: beclin 2; FEATURE: OTHER INFORMATION: Uniprot ID: A8MW95; FEATURE: OTHER INFORMATION: ENSP ID: ENSP00000488361 Query Match 100.0%; Score 2227; Length 431; Best Local Similarity 100.0%; Matches 431; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 MSSIRFLCQRCHQALKLSGSSESRSLPAAPAPTSGQAEPGDTREPGVTTREVTDAEEQQD 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MSSIRFLCQRCHQALKLSGSSESRSLPAAPAPTSGQAEPGDTREPGVTTREVTDAEEQQD 60 Qy 61 GASSRSPPGDGSVSKGHANIFTLLGELGAMHMLSSIQKAAGDIFDIVSGQAVVDHPLCEE 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 GASSRSPPGDGSVSKGHANIFTLLGELGAMHMLSSIQKAAGDIFDIVSGQAVVDHPLCEE 120 Qy 121 CTDSLLEQLDIQLALTEADSQNYQRCLETGELATSEDEAAALRAELRDLELEEARLVQEL 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 CTDSLLEQLDIQLALTEADSQNYQRCLETGELATSEDEAAALRAELRDLELEEARLVQEL 180 Qy 181 EDVDRNNARAAADLQAAQAEAAELDQQERQHYRDYSALKRQQLELLDQLGNVENQLQYAR 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 EDVDRNNARAAADLQAAQAEAAELDQQERQHYRDYSALKRQQLELLDQLGNVENQLQYAR 240 Qy 241 VQRDRLKEINCFTATFEIWVEGPLGVINNFRLGRLPTVRVGWNEINTAWGQAALLLLTLA 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 VQRDRLKEINCFTATFEIWVEGPLGVINNFRLGRLPTVRVGWNEINTAWGQAALLLLTLA 300 Qy 301 NTIGLQFQRYRLIPCGNHSYLKSLTDDRTELPLFCYGGQDVFLNNKYDRAMVAFLDCMQQ 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 NTIGLQFQRYRLIPCGNHSYLKSLTDDRTELPLFCYGGQDVFLNNKYDRAMVAFLDCMQQ 360 Qy 361 FKEEAEKGELGLSLPYGIQVETGLMEDVGGRGECYSIRTHLNTQELWTKALKFMLINFKW 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 FKEEAEKGELGLSLPYGIQVETGLMEDVGGRGECYSIRTHLNTQELWTKALKFMLINFKW 420 Qy 421 SLIWVASRYQK 431 ||||||||||| Db 421 SLIWVASRYQK 431 SEQ ID NO:3 Sequence 8897, US/16092829B Patent No. 11446398 GENERAL INFORMATION APPLICANT: BARRETT, PETER APPLICANT: GLADSTONE, MICHAEL N. APPLICANT: KASSUM, TARIQ A. APPLICANT: SURI, VIPIN APPLICANT: LI, DAN JUN APPLICANT: SUN, DEXUE APPLICANT: DOLINSKI, BRIAN TITLE OF INVENTION: REGULATED BIOCIRCUIT SYSTEMS FILE REFERENCE: 2095.1300US371 CURRENT APPLICATION NUMBER: US/16/092,829B CURRENT FILING DATE: 2018-10-11 PRIOR APPLICATION NUMBER: PCT/US2017/026950 PRIOR FILING DATE: 2017-04-11 PRIOR APPLICATION NUMBER: 62/320,864 PRIOR FILING DATE: 2016-04-11 PRIOR APPLICATION NUMBER: 62/466,596 PRIOR FILING DATE: 2017-03-03 NUMBER OF SEQ ID NOS: 213456 SEQ ID NO 8897 LENGTH: 431 TYPE: PRT ORGANISM: Homo sapiens FEATURE: OTHER INFORMATION: Payload ID: 1803; FEATURE: OTHER INFORMATION: Gene Symbol: BECN2; FEATURE: OTHER INFORMATION: Gene Name: beclin 2; FEATURE: OTHER INFORMATION: Uniprot ID: A8MW95; FEATURE: OTHER INFORMATION: ENSP ID: ENSP00000488361 Query Match 99.7%; Score 1673; Length 431; Best Local Similarity 100.0%; Matches 322; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 2 QAVVDHPLCEECTDSLLEQLDIQLALTEADSQNYQRCLETGELATSEDEAAALRAELRDL 61 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 110 QAVVDHPLCEECTDSLLEQLDIQLALTEADSQNYQRCLETGELATSEDEAAALRAELRDL 169 Qy 62 ELEEARLVQELEDVDRNNARAAADLQAAQAEAAELDQQERQHYRDYSALKRQQLELLDQL 121 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 170 ELEEARLVQELEDVDRNNARAAADLQAAQAEAAELDQQERQHYRDYSALKRQQLELLDQL 229 Qy 122 GNVENQLQYARVQRDRLKEINCFTATFEIWVEGPLGVINNFRLGRLPTVRVGWNEINTAW 181 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 230 GNVENQLQYARVQRDRLKEINCFTATFEIWVEGPLGVINNFRLGRLPTVRVGWNEINTAW 289 Qy 182 GQAALLLLTLANTIGLQFQRYRLIPCGNHSYLKSLTDDRTELPLFCYGGQDVFLNNKYDR 241 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 290 GQAALLLLTLANTIGLQFQRYRLIPCGNHSYLKSLTDDRTELPLFCYGGQDVFLNNKYDR 349 Qy 242 AMVAFLDCMQQFKEEAEKGELGLSLPYGIQVETGLMEDVGGRGECYSIRTHLNTQELWTK 301 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 350 AMVAFLDCMQQFKEEAEKGELGLSLPYGIQVETGLMEDVGGRGECYSIRTHLNTQELWTK 409 Qy 302 ALKFMLINFKWSLIWVASRYQK 323 |||||||||||||||||||||| Db 410 ALKFMLINFKWSLIWVASRYQK 431 US20190192691 teaches a protein comprising the amino acid sequence of SEQ ID NO:8897, which is 100% identical to instant SEQ ID NO:1, or SEQ ID NO:3 (see the sequence alignment below). SEQ ID NO:1 Sequence 8897, US/16092829B Publication No. US20190192691A1 GENERAL INFORMATION APPLICANT: BARRETT, PETER APPLICANT: GLADSTONE, MICHAEL N. APPLICANT: KASSUM, TARIQ A. APPLICANT: SURI, VIPIN APPLICANT: LI, DAN JUN APPLICANT: SUN, DEXUE APPLICANT: DOLINSKI, BRIAN TITLE OF INVENTION: REGULATED BIOCIRCUIT SYSTEMS FILE REFERENCE: 2095.1300US371 CURRENT APPLICATION NUMBER: US/16/092,829B CURRENT FILING DATE: 2018-10-11 PRIOR APPLICATION NUMBER: PCT/US2017/026950 PRIOR FILING DATE: 2017-04-11 PRIOR APPLICATION NUMBER: 62/320,864 PRIOR FILING DATE: 2016-04-11 PRIOR APPLICATION NUMBER: 62/466,596 PRIOR FILING DATE: 2017-03-03 NUMBER OF SEQ ID NOS: 213456 SEQ ID NO 8897 LENGTH: 431 TYPE: PRT ORGANISM: Homo sapiens FEATURE: OTHER INFORMATION: Payload ID: 1803; FEATURE: OTHER INFORMATION: Gene Symbol: BECN2; FEATURE: OTHER INFORMATION: Gene Name: beclin 2; FEATURE: OTHER INFORMATION: Uniprot ID: A8MW95; FEATURE: OTHER INFORMATION: ENSP ID: ENSP00000488361 Query Match 100.0%; Score 2227; Length 431; Best Local Similarity 100.0%; Matches 431; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 MSSIRFLCQRCHQALKLSGSSESRSLPAAPAPTSGQAEPGDTREPGVTTREVTDAEEQQD 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MSSIRFLCQRCHQALKLSGSSESRSLPAAPAPTSGQAEPGDTREPGVTTREVTDAEEQQD 60 Qy 61 GASSRSPPGDGSVSKGHANIFTLLGELGAMHMLSSIQKAAGDIFDIVSGQAVVDHPLCEE 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 GASSRSPPGDGSVSKGHANIFTLLGELGAMHMLSSIQKAAGDIFDIVSGQAVVDHPLCEE 120 Qy 121 CTDSLLEQLDIQLALTEADSQNYQRCLETGELATSEDEAAALRAELRDLELEEARLVQEL 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 CTDSLLEQLDIQLALTEADSQNYQRCLETGELATSEDEAAALRAELRDLELEEARLVQEL 180 Qy 181 EDVDRNNARAAADLQAAQAEAAELDQQERQHYRDYSALKRQQLELLDQLGNVENQLQYAR 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 EDVDRNNARAAADLQAAQAEAAELDQQERQHYRDYSALKRQQLELLDQLGNVENQLQYAR 240 Qy 241 VQRDRLKEINCFTATFEIWVEGPLGVINNFRLGRLPTVRVGWNEINTAWGQAALLLLTLA 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 VQRDRLKEINCFTATFEIWVEGPLGVINNFRLGRLPTVRVGWNEINTAWGQAALLLLTLA 300 Qy 301 NTIGLQFQRYRLIPCGNHSYLKSLTDDRTELPLFCYGGQDVFLNNKYDRAMVAFLDCMQQ 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 NTIGLQFQRYRLIPCGNHSYLKSLTDDRTELPLFCYGGQDVFLNNKYDRAMVAFLDCMQQ 360 Qy 361 FKEEAEKGELGLSLPYGIQVETGLMEDVGGRGECYSIRTHLNTQELWTKALKFMLINFKW 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 FKEEAEKGELGLSLPYGIQVETGLMEDVGGRGECYSIRTHLNTQELWTKALKFMLINFKW 420 Qy 421 SLIWVASRYQK 431 ||||||||||| Db 421 SLIWVASRYQK 431 SEQ ID NO:3 Sequence 8897, US/16092829B Publication No. US20190192691A1 GENERAL INFORMATION APPLICANT: BARRETT, PETER APPLICANT: GLADSTONE, MICHAEL N. APPLICANT: KASSUM, TARIQ A. APPLICANT: SURI, VIPIN APPLICANT: LI, DAN JUN APPLICANT: SUN, DEXUE APPLICANT: DOLINSKI, BRIAN TITLE OF INVENTION: REGULATED BIOCIRCUIT SYSTEMS FILE REFERENCE: 2095.1300US371 CURRENT APPLICATION NUMBER: US/16/092,829B CURRENT FILING DATE: 2018-10-11 PRIOR APPLICATION NUMBER: PCT/US2017/026950 PRIOR FILING DATE: 2017-04-11 PRIOR APPLICATION NUMBER: 62/320,864 PRIOR FILING DATE: 2016-04-11 PRIOR APPLICATION NUMBER: 62/466,596 PRIOR FILING DATE: 2017-03-03 NUMBER OF SEQ ID NOS: 213456 SEQ ID NO 8897 LENGTH: 431 TYPE: PRT ORGANISM: Homo sapiens FEATURE: OTHER INFORMATION: Payload ID: 1803; FEATURE: OTHER INFORMATION: Gene Symbol: BECN2; FEATURE: OTHER INFORMATION: Gene Name: beclin 2; FEATURE: OTHER INFORMATION: Uniprot ID: A8MW95; FEATURE: OTHER INFORMATION: ENSP ID: ENSP00000488361 Query Match 99.7%; Score 1673; Length 431; Best Local Similarity 100.0%; Matches 322; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 2 QAVVDHPLCEECTDSLLEQLDIQLALTEADSQNYQRCLETGELATSEDEAAALRAELRDL 61 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 110 QAVVDHPLCEECTDSLLEQLDIQLALTEADSQNYQRCLETGELATSEDEAAALRAELRDL 169 Qy 62 ELEEARLVQELEDVDRNNARAAADLQAAQAEAAELDQQERQHYRDYSALKRQQLELLDQL 121 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 170 ELEEARLVQELEDVDRNNARAAADLQAAQAEAAELDQQERQHYRDYSALKRQQLELLDQL 229 Qy 122 GNVENQLQYARVQRDRLKEINCFTATFEIWVEGPLGVINNFRLGRLPTVRVGWNEINTAW 181 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 230 GNVENQLQYARVQRDRLKEINCFTATFEIWVEGPLGVINNFRLGRLPTVRVGWNEINTAW 289 Qy 182 GQAALLLLTLANTIGLQFQRYRLIPCGNHSYLKSLTDDRTELPLFCYGGQDVFLNNKYDR 241 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 290 GQAALLLLTLANTIGLQFQRYRLIPCGNHSYLKSLTDDRTELPLFCYGGQDVFLNNKYDR 349 Qy 242 AMVAFLDCMQQFKEEAEKGELGLSLPYGIQVETGLMEDVGGRGECYSIRTHLNTQELWTK 301 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 350 AMVAFLDCMQQFKEEAEKGELGLSLPYGIQVETGLMEDVGGRGECYSIRTHLNTQELWTK 409 Qy 302 ALKFMLINFKWSLIWVASRYQK 323 |||||||||||||||||||||| Db 410 ALKFMLINFKWSLIWVASRYQK 431 US20230026259 teaches a protein comprising the amino acid sequence of SEQ ID NO:8897, which is 100% identical to instant SEQ ID NO:1, or SEQ ID NO:3 (see the sequence alignment below). SEQ ID NO:1 Sequence 8897, US/17436892A Publication No. US20230026259A1 GENERAL INFORMATION APPLICANT: OBSIDIAN THERAPEUTICS, INC. TITLE OF INVENTION: HUMAN CARBONIC ANHYDRASE 2 COMPOSITIONS AND METHODS FOR TUNABLE TITLE OF INVENTION: REGULATION FILE REFERENCE: 108407-1281302 (013US1) CURRENT APPLICATION NUMBER: US/17/436,892A CURRENT FILING DATE: 2021-09-07 PRIOR APPLICATION NUMBER: PCT/US2020/021596 PRIOR FILING DATE: 2020-03-06 PRIOR APPLICATION NUMBER: 62/860,388 PRIOR FILING DATE: 2019-06-12 PRIOR APPLICATION NUMBER: 62/835,552 PRIOR FILING DATE: 2019-04-18 PRIOR APPLICATION NUMBER: 62/835,548 PRIOR FILING DATE: 2019-04-18 PRIOR APPLICATION NUMBER: 62/826,487 PRIOR FILING DATE: 2019-03-29 PRIOR APPLICATION NUMBER: 62/826,443 PRIOR FILING DATE: 2019-03-29 PRIOR APPLICATION NUMBER: 62/815,399 PRIOR FILING DATE: 2019-03-08 PRIOR APPLICATION NUMBER: 62/815,402 PRIOR FILING DATE: 2019-03-08 NUMBER OF SEQ ID NOS: 211141 SEQ ID NO 8897 LENGTH: 431 TYPE: PRT ORGANISM: Homo sapiens FEATURE: OTHER INFORMATION: Payload ID: 1803; FEATURE: OTHER INFORMATION: Gene Symbol: BECN2; FEATURE: OTHER INFORMATION: Gene Name: beclin 2; FEATURE: OTHER INFORMATION: Uniprot ID: A8MW95; FEATURE: OTHER INFORMATION: ENSP ID: ENSP00000488361 Query Match 100.0%; Score 2227; Length 431; Best Local Similarity 100.0%; Matches 431; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 MSSIRFLCQRCHQALKLSGSSESRSLPAAPAPTSGQAEPGDTREPGVTTREVTDAEEQQD 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MSSIRFLCQRCHQALKLSGSSESRSLPAAPAPTSGQAEPGDTREPGVTTREVTDAEEQQD 60 Qy 61 GASSRSPPGDGSVSKGHANIFTLLGELGAMHMLSSIQKAAGDIFDIVSGQAVVDHPLCEE 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 GASSRSPPGDGSVSKGHANIFTLLGELGAMHMLSSIQKAAGDIFDIVSGQAVVDHPLCEE 120 Qy 121 CTDSLLEQLDIQLALTEADSQNYQRCLETGELATSEDEAAALRAELRDLELEEARLVQEL 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 CTDSLLEQLDIQLALTEADSQNYQRCLETGELATSEDEAAALRAELRDLELEEARLVQEL 180 Qy 181 EDVDRNNARAAADLQAAQAEAAELDQQERQHYRDYSALKRQQLELLDQLGNVENQLQYAR 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 EDVDRNNARAAADLQAAQAEAAELDQQERQHYRDYSALKRQQLELLDQLGNVENQLQYAR 240 Qy 241 VQRDRLKEINCFTATFEIWVEGPLGVINNFRLGRLPTVRVGWNEINTAWGQAALLLLTLA 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 VQRDRLKEINCFTATFEIWVEGPLGVINNFRLGRLPTVRVGWNEINTAWGQAALLLLTLA 300 Qy 301 NTIGLQFQRYRLIPCGNHSYLKSLTDDRTELPLFCYGGQDVFLNNKYDRAMVAFLDCMQQ 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 NTIGLQFQRYRLIPCGNHSYLKSLTDDRTELPLFCYGGQDVFLNNKYDRAMVAFLDCMQQ 360 Qy 361 FKEEAEKGELGLSLPYGIQVETGLMEDVGGRGECYSIRTHLNTQELWTKALKFMLINFKW 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 FKEEAEKGELGLSLPYGIQVETGLMEDVGGRGECYSIRTHLNTQELWTKALKFMLINFKW 420 Qy 421 SLIWVASRYQK 431 ||||||||||| Db 421 SLIWVASRYQK 431 SEQ ID NO:3 Sequence 8897, US/17436892A Publication No. US20230026259A1 GENERAL INFORMATION APPLICANT: OBSIDIAN THERAPEUTICS, INC. TITLE OF INVENTION: HUMAN CARBONIC ANHYDRASE 2 COMPOSITIONS AND METHODS FOR TUNABLE TITLE OF INVENTION: REGULATION FILE REFERENCE: 108407-1281302 (013US1) CURRENT APPLICATION NUMBER: US/17/436,892A CURRENT FILING DATE: 2021-09-07 PRIOR APPLICATION NUMBER: PCT/US2020/021596 PRIOR FILING DATE: 2020-03-06 PRIOR APPLICATION NUMBER: 62/860,388 PRIOR FILING DATE: 2019-06-12 PRIOR APPLICATION NUMBER: 62/835,552 PRIOR FILING DATE: 2019-04-18 PRIOR APPLICATION NUMBER: 62/835,548 PRIOR FILING DATE: 2019-04-18 PRIOR APPLICATION NUMBER: 62/826,487 PRIOR FILING DATE: 2019-03-29 PRIOR APPLICATION NUMBER: 62/826,443 PRIOR FILING DATE: 2019-03-29 PRIOR APPLICATION NUMBER: 62/815,399 PRIOR FILING DATE: 2019-03-08 PRIOR APPLICATION NUMBER: 62/815,402 PRIOR FILING DATE: 2019-03-08 NUMBER OF SEQ ID NOS: 211141 SEQ ID NO 8897 LENGTH: 431 TYPE: PRT ORGANISM: Homo sapiens FEATURE: OTHER INFORMATION: Payload ID: 1803; FEATURE: OTHER INFORMATION: Gene Symbol: BECN2; FEATURE: OTHER INFORMATION: Gene Name: beclin 2; FEATURE: OTHER INFORMATION: Uniprot ID: A8MW95; FEATURE: OTHER INFORMATION: ENSP ID: ENSP00000488361 Query Match 99.7%; Score 1673; Length 431; Best Local Similarity 100.0%; Matches 322; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 2 QAVVDHPLCEECTDSLLEQLDIQLALTEADSQNYQRCLETGELATSEDEAAALRAELRDL 61 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 110 QAVVDHPLCEECTDSLLEQLDIQLALTEADSQNYQRCLETGELATSEDEAAALRAELRDL 169 Qy 62 ELEEARLVQELEDVDRNNARAAADLQAAQAEAAELDQQERQHYRDYSALKRQQLELLDQL 121 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 170 ELEEARLVQELEDVDRNNARAAADLQAAQAEAAELDQQERQHYRDYSALKRQQLELLDQL 229 Qy 122 GNVENQLQYARVQRDRLKEINCFTATFEIWVEGPLGVINNFRLGRLPTVRVGWNEINTAW 181 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 230 GNVENQLQYARVQRDRLKEINCFTATFEIWVEGPLGVINNFRLGRLPTVRVGWNEINTAW 289 Qy 182 GQAALLLLTLANTIGLQFQRYRLIPCGNHSYLKSLTDDRTELPLFCYGGQDVFLNNKYDR 241 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 290 GQAALLLLTLANTIGLQFQRYRLIPCGNHSYLKSLTDDRTELPLFCYGGQDVFLNNKYDR 349 Qy 242 AMVAFLDCMQQFKEEAEKGELGLSLPYGIQVETGLMEDVGGRGECYSIRTHLNTQELWTK 301 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 350 AMVAFLDCMQQFKEEAEKGELGLSLPYGIQVETGLMEDVGGRGECYSIRTHLNTQELWTK 409 Qy 302 ALKFMLINFKWSLIWVASRYQK 323 |||||||||||||||||||||| Db 410 ALKFMLINFKWSLIWVASRYQK 431 US20230117384 teaches a viral vector encoding Beclin2 comprising the amino acid sequence of SEQ ID NO:64, which is 100% identical to instant SEQ ID NO:1, or SEQ ID NO:3 (see the sequence alignment below). SEQ ID NO:1 Sequence 64, US/17750705A Publication No. US20230117384A1 GENERAL INFORMATION APPLICANT: GENETHON et al. TITLE OF INVENTION: COMPOSITIONS AND METHODS FOR IMPROVING VIRAL VECTOR EFFICIENCY FILE REFERENCE: 11450517US CURRENT APPLICATION NUMBER: US/17/750,705A CURRENT FILING DATE: 2022-05-23 NUMBER OF SEQ ID NOS: 102 SEQ ID NO 64 LENGTH: 431 TYPE: PRT ORGANISM: Homo sapiens Query Match 100.0%; Score 2227; Length 431; Best Local Similarity 100.0%; Matches 431; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 MSSIRFLCQRCHQALKLSGSSESRSLPAAPAPTSGQAEPGDTREPGVTTREVTDAEEQQD 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MSSIRFLCQRCHQALKLSGSSESRSLPAAPAPTSGQAEPGDTREPGVTTREVTDAEEQQD 60 Qy 61 GASSRSPPGDGSVSKGHANIFTLLGELGAMHMLSSIQKAAGDIFDIVSGQAVVDHPLCEE 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 GASSRSPPGDGSVSKGHANIFTLLGELGAMHMLSSIQKAAGDIFDIVSGQAVVDHPLCEE 120 Qy 121 CTDSLLEQLDIQLALTEADSQNYQRCLETGELATSEDEAAALRAELRDLELEEARLVQEL 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 CTDSLLEQLDIQLALTEADSQNYQRCLETGELATSEDEAAALRAELRDLELEEARLVQEL 180 Qy 181 EDVDRNNARAAADLQAAQAEAAELDQQERQHYRDYSALKRQQLELLDQLGNVENQLQYAR 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 EDVDRNNARAAADLQAAQAEAAELDQQERQHYRDYSALKRQQLELLDQLGNVENQLQYAR 240 Qy 241 VQRDRLKEINCFTATFEIWVEGPLGVINNFRLGRLPTVRVGWNEINTAWGQAALLLLTLA 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 VQRDRLKEINCFTATFEIWVEGPLGVINNFRLGRLPTVRVGWNEINTAWGQAALLLLTLA 300 Qy 301 NTIGLQFQRYRLIPCGNHSYLKSLTDDRTELPLFCYGGQDVFLNNKYDRAMVAFLDCMQQ 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 NTIGLQFQRYRLIPCGNHSYLKSLTDDRTELPLFCYGGQDVFLNNKYDRAMVAFLDCMQQ 360 Qy 361 FKEEAEKGELGLSLPYGIQVETGLMEDVGGRGECYSIRTHLNTQELWTKALKFMLINFKW 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 FKEEAEKGELGLSLPYGIQVETGLMEDVGGRGECYSIRTHLNTQELWTKALKFMLINFKW 420 Qy 421 SLIWVASRYQK 431 ||||||||||| Db 421 SLIWVASRYQK 431 SEQ ID NO:3 Sequence 64, US/17750705A Publication No. US20230117384A1 GENERAL INFORMATION APPLICANT: GENETHON et al. TITLE OF INVENTION: COMPOSITIONS AND METHODS FOR IMPROVING VIRAL VECTOR EFFICIENCY FILE REFERENCE: 11450517US CURRENT APPLICATION NUMBER: US/17/750,705A CURRENT FILING DATE: 2022-05-23 NUMBER OF SEQ ID NOS: 102 SEQ ID NO 64 LENGTH: 431 TYPE: PRT ORGANISM: Homo sapiens Query Match 100.0%; Score 2227; Length 431; Best Local Similarity 100.0%; Matches 431; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 MSSIRFLCQRCHQALKLSGSSESRSLPAAPAPTSGQAEPGDTREPGVTTREVTDAEEQQD 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MSSIRFLCQRCHQALKLSGSSESRSLPAAPAPTSGQAEPGDTREPGVTTREVTDAEEQQD 60 Qy 61 GASSRSPPGDGSVSKGHANIFTLLGELGAMHMLSSIQKAAGDIFDIVSGQAVVDHPLCEE 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 GASSRSPPGDGSVSKGHANIFTLLGELGAMHMLSSIQKAAGDIFDIVSGQAVVDHPLCEE 120 Qy 121 CTDSLLEQLDIQLALTEADSQNYQRCLETGELATSEDEAAALRAELRDLELEEARLVQEL 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 CTDSLLEQLDIQLALTEADSQNYQRCLETGELATSEDEAAALRAELRDLELEEARLVQEL 180 Qy 181 EDVDRNNARAAADLQAAQAEAAELDQQERQHYRDYSALKRQQLELLDQLGNVENQLQYAR 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 EDVDRNNARAAADLQAAQAEAAELDQQERQHYRDYSALKRQQLELLDQLGNVENQLQYAR 240 Qy 241 VQRDRLKEINCFTATFEIWVEGPLGVINNFRLGRLPTVRVGWNEINTAWGQAALLLLTLA 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 VQRDRLKEINCFTATFEIWVEGPLGVINNFRLGRLPTVRVGWNEINTAWGQAALLLLTLA 300 Qy 301 NTIGLQFQRYRLIPCGNHSYLKSLTDDRTELPLFCYGGQDVFLNNKYDRAMVAFLDCMQQ 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 NTIGLQFQRYRLIPCGNHSYLKSLTDDRTELPLFCYGGQDVFLNNKYDRAMVAFLDCMQQ 360 Qy 361 FKEEAEKGELGLSLPYGIQVETGLMEDVGGRGECYSIRTHLNTQELWTKALKFMLINFKW 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 FKEEAEKGELGLSLPYGIQVETGLMEDVGGRGECYSIRTHLNTQELWTKALKFMLINFKW 420 Qy 421 SLIWVASRYQK 431 ||||||||||| Db 421 SLIWVASRYQK 431 US20240398993 teaches a viral vector encoding Beclin2 comprising the amino acid sequence of SEQ ID NO:12401, which is 100% identical to instant SEQ ID NO:1, or SEQ ID NO:3 (see the sequence alignment below). SEQ ID NO:1 Sequence 12401, US/18261554A Publication No. US20240398993A1 GENERAL INFORMATION APPLICANT: OUTPACE BIO, INC. TITLE OF INVENTION: SMALL MOLECULE-REGULATED GENE EXPRESSION SYSTEM FILE REFERENCE: OTPC-022/04US 347008-2170 CURRENT APPLICATION NUMBER: US/18/261,554A CURRENT FILING DATE: 2023-07-14 PRIOR APPLICATION NUMBER: PCT/US2022/012688 PRIOR FILING DATE: 2022-01-17 PRIOR APPLICATION NUMBER: US 63/164,866 PRIOR FILING DATE: 2021-03-23 PRIOR APPLICATION NUMBER: US 63/143,735 PRIOR FILING DATE: 2021-01-29 PRIOR APPLICATION NUMBER: US 63/143,026 PRIOR FILING DATE: 2021-01-28 PRIOR APPLICATION NUMBER: US 63/137,803 PRIOR FILING DATE: 2021-01-15 NUMBER OF SEQ ID NOS: 101300 SEQ ID NO 12401 LENGTH: 431 TYPE: PRT ORGANISM: Homo sapiens Query Match 100.0%; Score 2227; Length 431; Best Local Similarity 100.0%; Matches 431; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 MSSIRFLCQRCHQALKLSGSSESRSLPAAPAPTSGQAEPGDTREPGVTTREVTDAEEQQD 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MSSIRFLCQRCHQALKLSGSSESRSLPAAPAPTSGQAEPGDTREPGVTTREVTDAEEQQD 60 Qy 61 GASSRSPPGDGSVSKGHANIFTLLGELGAMHMLSSIQKAAGDIFDIVSGQAVVDHPLCEE 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 GASSRSPPGDGSVSKGHANIFTLLGELGAMHMLSSIQKAAGDIFDIVSGQAVVDHPLCEE 120 Qy 121 CTDSLLEQLDIQLALTEADSQNYQRCLETGELATSEDEAAALRAELRDLELEEARLVQEL 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 CTDSLLEQLDIQLALTEADSQNYQRCLETGELATSEDEAAALRAELRDLELEEARLVQEL 180 Qy 181 EDVDRNNARAAADLQAAQAEAAELDQQERQHYRDYSALKRQQLELLDQLGNVENQLQYAR 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 EDVDRNNARAAADLQAAQAEAAELDQQERQHYRDYSALKRQQLELLDQLGNVENQLQYAR 240 Qy 241 VQRDRLKEINCFTATFEIWVEGPLGVINNFRLGRLPTVRVGWNEINTAWGQAALLLLTLA 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 VQRDRLKEINCFTATFEIWVEGPLGVINNFRLGRLPTVRVGWNEINTAWGQAALLLLTLA 300 Qy 301 NTIGLQFQRYRLIPCGNHSYLKSLTDDRTELPLFCYGGQDVFLNNKYDRAMVAFLDCMQQ 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 NTIGLQFQRYRLIPCGNHSYLKSLTDDRTELPLFCYGGQDVFLNNKYDRAMVAFLDCMQQ 360 Qy 361 FKEEAEKGELGLSLPYGIQVETGLMEDVGGRGECYSIRTHLNTQELWTKALKFMLINFKW 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 FKEEAEKGELGLSLPYGIQVETGLMEDVGGRGECYSIRTHLNTQELWTKALKFMLINFKW 420 Qy 421 SLIWVASRYQK 431 ||||||||||| Db 421 SLIWVASRYQK 431 SEQ ID NO:3 Sequence 12401, US/18261554A Publication No. US20240398993A1 GENERAL INFORMATION APPLICANT: OUTPACE BIO, INC. TITLE OF INVENTION: SMALL MOLECULE-REGULATED GENE EXPRESSION SYSTEM FILE REFERENCE: OTPC-022/04US 347008-2170 CURRENT APPLICATION NUMBER: US/18/261,554A CURRENT FILING DATE: 2023-07-14 PRIOR APPLICATION NUMBER: PCT/US2022/012688 PRIOR FILING DATE: 2022-01-17 PRIOR APPLICATION NUMBER: US 63/164,866 PRIOR FILING DATE: 2021-03-23 PRIOR APPLICATION NUMBER: US 63/143,735 PRIOR FILING DATE: 2021-01-29 PRIOR APPLICATION NUMBER: US 63/143,026 PRIOR FILING DATE: 2021-01-28 PRIOR APPLICATION NUMBER: US 63/137,803 PRIOR FILING DATE: 2021-01-15 NUMBER OF SEQ ID NOS: 101300 SEQ ID NO 12401 LENGTH: 431 TYPE: PRT ORGANISM: Homo sapiens Query Match 99.7%; Score 1673; Length 431; Best Local Similarity 100.0%; Matches 322; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 2 QAVVDHPLCEECTDSLLEQLDIQLALTEADSQNYQRCLETGELATSEDEAAALRAELRDL 61 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 110 QAVVDHPLCEECTDSLLEQLDIQLALTEADSQNYQRCLETGELATSEDEAAALRAELRDL 169 Qy 62 ELEEARLVQELEDVDRNNARAAADLQAAQAEAAELDQQERQHYRDYSALKRQQLELLDQL 121 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 170 ELEEARLVQELEDVDRNNARAAADLQAAQAEAAELDQQERQHYRDYSALKRQQLELLDQL 229 Qy 122 GNVENQLQYARVQRDRLKEINCFTATFEIWVEGPLGVINNFRLGRLPTVRVGWNEINTAW 181 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 230 GNVENQLQYARVQRDRLKEINCFTATFEIWVEGPLGVINNFRLGRLPTVRVGWNEINTAW 289 Qy 182 GQAALLLLTLANTIGLQFQRYRLIPCGNHSYLKSLTDDRTELPLFCYGGQDVFLNNKYDR 241 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 290 GQAALLLLTLANTIGLQFQRYRLIPCGNHSYLKSLTDDRTELPLFCYGGQDVFLNNKYDR 349 Qy 242 AMVAFLDCMQQFKEEAEKGELGLSLPYGIQVETGLMEDVGGRGECYSIRTHLNTQELWTK 301 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 350 AMVAFLDCMQQFKEEAEKGELGLSLPYGIQVETGLMEDVGGRGECYSIRTHLNTQELWTK 409 Qy 302 ALKFMLINFKWSLIWVASRYQK 323 |||||||||||||||||||||| Db 410 ALKFMLINFKWSLIWVASRYQK 431 WO2008085601 teaches a human asthma disease treatment associated protein comprising the amino acid sequence of SEQ ID NO:1472, which is 100% identical to instant SEQ ID NO:1, or SEQ ID NO:3 (see the sequence alignment below). SEQ ID NO:1 ASQ28566 ID ASQ28566 standard; protein; 566 AA. XX AC ASQ28566; XX DT 18-SEP-2008 (first entry) XX DE Human asthma disease treatment associated protein, SEQ ID 1472. XX KW mapping; drug screening; therapeutic; microarray; diagnostic test; KW prophylactic to disease; prophylaxis; prognosis; screening; KW snp detection; cosmetics; asthma; antiallergic; antiasthmatic; KW antiinflammatory; respiratory-gen. XX OS Homo sapiens. XX CC PN WO2008085601-A2. XX CC PD 17-JUL-2008. XX CC PF 02-NOV-2007; 2007WO-US083522. XX PR 02-NOV-2006; 2006US-0856003P. XX CC PA (GENI-) GENIZON BIOSCIENCES INC. XX CC PI Raelson JV, Bradley WE, Little RD, Paquin B, Nguyen-Huu Q; CC PI Keith T, Croteau P, Belouchi A, Allard R, Debrus S, Van Eerdewegh P; CC PI Segal J, Fournier H; XX DR WPI; 2008-J05763/51. DR N-PSDB; ASQ28565. XX CC PT Constructing an asthma disease GeneMap in a human population, comprises CC PT screening for the expression level of or presence or absence of at least CC PT one allele of at least one gene. XX CC PS Claim 89; SEQ ID NO 1472; 515pp; English. XX CC The present invention relates to a method for constructing an asthma CC disease genemap in a human population. The method comprises screening for CC the expression level of or presence or absence of at least one allele of CC at least one gene. The invention provides: (1) a method for constructing CC a genemap in the human population; (2) a method for genetic mapping for CC detecting the association of at least one marker for asthma disease; (3) CC a set of genetic markers comprising at least two SNPs; (4) a set of CC nucleic acid probes that specifically detect the SNPs; (5) a solid CC support or collection of solid supports comprising the nucleic acid CC probes; (6) a method for predicting the efficacy of a drug for treating CC asthma disease in a human patient; (7) a method for inducing the asthma CC disease-like state in a resident tissue or cell; (8) a method for CC screening drug candidates for treating asthma disease; (9) a method for CC inducing a resident tissue cell to mimic asthma disease; (10) a method CC for treatment of asthma disease; (11) a drug screening assay; (12) a CC method for identifying a gene that regulates drug response in asthma CC disease; (13) an expression profile indicative of the presence of asthma CC disease in a patient; (14) a microarray comprising probes; (15) a method CC for diagnosing susceptibility to asthma disease in an individual; (16) a CC kit for diagnosing susceptibility to asthma disease in the individual CC comprising primers for nucleic acid amplification; (17) a method for CC preventing the occurrence of asthma disease in an individual; (20) a CC method for monitoring the effectiveness of treatment on the regulation of CC expression of one or more genes at the RNA or protein level, or its CC enzymatic activity by measuring RNA, protein or enzymatic activity in a CC sample of peripheral blood or cells; (21) a method for diagnosing asthma CC disease, the predisposition to asthma disease, or the progression of CC asthma disease; (22) a method for determining the phenotype of a cell; CC (23) a kit for assessing a patient's risk of having or developing asthma CC disease; (24) a method for assessing the patient's risk of having or CC developing asthma disease; (25) a nucleic acid array comprising a solid CC support comprising nucleic acid probes; (26) a method for assaying the CC presence of the nucleic acid or polypeptide associated with resistance or CC susceptibility to asthma disease in the sample for use in diagnostics, CC prognostics, prevention, treatment, or study of asthma disease; and (27) CC a cosmetic composition for inhibiting asthma disease in the patient, CC comprises a compound that modulates asthma disease. The present sequence CC is the human asthma disease treatment associated protein, which was CC specifically claimed in the invention. XX SQ Sequence 566 AA; Query Match 99.2%; Score 2210; Length 566; Best Local Similarity 100.0%; Matches 428; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 MSSIRFLCQRCHQALKLSGSSESRSLPAAPAPTSGQAEPGDTREPGVTTREVTDAEEQQD 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MSSIRFLCQRCHQALKLSGSSESRSLPAAPAPTSGQAEPGDTREPGVTTREVTDAEEQQD 60 Qy 61 GASSRSPPGDGSVSKGHANIFTLLGELGAMHMLSSIQKAAGDIFDIVSGQAVVDHPLCEE 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 GASSRSPPGDGSVSKGHANIFTLLGELGAMHMLSSIQKAAGDIFDIVSGQAVVDHPLCEE 120 Qy 121 CTDSLLEQLDIQLALTEADSQNYQRCLETGELATSEDEAAALRAELRDLELEEARLVQEL 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 CTDSLLEQLDIQLALTEADSQNYQRCLETGELATSEDEAAALRAELRDLELEEARLVQEL 180 Qy 181 EDVDRNNARAAADLQAAQAEAAELDQQERQHYRDYSALKRQQLELLDQLGNVENQLQYAR 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 EDVDRNNARAAADLQAAQAEAAELDQQERQHYRDYSALKRQQLELLDQLGNVENQLQYAR 240 Qy 241 VQRDRLKEINCFTATFEIWVEGPLGVINNFRLGRLPTVRVGWNEINTAWGQAALLLLTLA 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 VQRDRLKEINCFTATFEIWVEGPLGVINNFRLGRLPTVRVGWNEINTAWGQAALLLLTLA 300 Qy 301 NTIGLQFQRYRLIPCGNHSYLKSLTDDRTELPLFCYGGQDVFLNNKYDRAMVAFLDCMQQ 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 NTIGLQFQRYRLIPCGNHSYLKSLTDDRTELPLFCYGGQDVFLNNKYDRAMVAFLDCMQQ 360 Qy 361 FKEEAEKGELGLSLPYGIQVETGLMEDVGGRGECYSIRTHLNTQELWTKALKFMLINFKW 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 FKEEAEKGELGLSLPYGIQVETGLMEDVGGRGECYSIRTHLNTQELWTKALKFMLINFKW 420 Qy 421 SLIWVASR 428 |||||||| Db 421 SLIWVASR 428 SEQ ID NO:3 ASQ28566 ID ASQ28566 standard; protein; 566 AA. XX AC ASQ28566; XX DT 18-SEP-2008 (first entry) XX DE Human asthma disease treatment associated protein, SEQ ID 1472. XX KW mapping; drug screening; therapeutic; microarray; diagnostic test; KW prophylactic to disease; prophylaxis; prognosis; screening; KW snp detection; cosmetics; asthma; antiallergic; antiasthmatic; KW antiinflammatory; respiratory-gen. XX OS Homo sapiens. XX CC PN WO2008085601-A2. XX CC PD 17-JUL-2008. XX CC PF 02-NOV-2007; 2007WO-US083522. XX PR 02-NOV-2006; 2006US-0856003P. XX CC PA (GENI-) GENIZON BIOSCIENCES INC. XX CC PI Raelson JV, Bradley WE, Little RD, Paquin B, Nguyen-Huu Q; CC PI Keith T, Croteau P, Belouchi A, Allard R, Debrus S, Van Eerdewegh P; CC PI Segal J, Fournier H; XX DR WPI; 2008-J05763/51. DR N-PSDB; ASQ28565. XX CC PT Constructing an asthma disease GeneMap in a human population, comprises CC PT screening for the expression level of or presence or absence of at least CC PT one allele of at least one gene. XX CC PS Claim 89; SEQ ID NO 1472; 515pp; English. XX CC The present invention relates to a method for constructing an asthma CC disease genemap in a human population. The method comprises screening for CC the expression level of or presence or absence of at least one allele of CC at least one gene. The invention provides: (1) a method for constructing CC a genemap in the human population; (2) a method for genetic mapping for CC detecting the association of at least one marker for asthma disease; (3) CC a set of genetic markers comprising at least two SNPs; (4) a set of CC nucleic acid probes that specifically detect the SNPs; (5) a solid CC support or collection of solid supports comprising the nucleic acid CC probes; (6) a method for predicting the efficacy of a drug for treating CC asthma disease in a human patient; (7) a method for inducing the asthma CC disease-like state in a resident tissue or cell; (8) a method for CC screening drug candidates for treating asthma disease; (9) a method for CC inducing a resident tissue cell to mimic asthma disease; (10) a method CC for treatment of asthma disease; (11) a drug screening assay; (12) a CC method for identifying a gene that regulates drug response in asthma CC disease; (13) an expression profile indicative of the presence of asthma CC disease in a patient; (14) a microarray comprising probes; (15) a method CC for diagnosing susceptibility to asthma disease in an individual; (16) a CC kit for diagnosing susceptibility to asthma disease in the individual CC comprising primers for nucleic acid amplification; (17) a method for CC preventing the occurrence of asthma disease in an individual; (20) a CC method for monitoring the effectiveness of treatment on the regulation of CC expression of one or more genes at the RNA or protein level, or its CC enzymatic activity by measuring RNA, protein or enzymatic activity in a CC sample of peripheral blood or cells; (21) a method for diagnosing asthma CC disease, the predisposition to asthma disease, or the progression of CC asthma disease; (22) a method for determining the phenotype of a cell; CC (23) a kit for assessing a patient's risk of having or developing asthma CC disease; (24) a method for assessing the patient's risk of having or CC developing asthma disease; (25) a nucleic acid array comprising a solid CC support comprising nucleic acid probes; (26) a method for assaying the CC presence of the nucleic acid or polypeptide associated with resistance or CC susceptibility to asthma disease in the sample for use in diagnostics, CC prognostics, prevention, treatment, or study of asthma disease; and (27) CC a cosmetic composition for inhibiting asthma disease in the patient, CC comprises a compound that modulates asthma disease. The present sequence CC is the human asthma disease treatment associated protein, which was CC specifically claimed in the invention. XX SQ Sequence 566 AA; Query Match 98.7%; Score 1656; Length 566; Best Local Similarity 100.0%; Matches 319; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 2 QAVVDHPLCEECTDSLLEQLDIQLALTEADSQNYQRCLETGELATSEDEAAALRAELRDL 61 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 110 QAVVDHPLCEECTDSLLEQLDIQLALTEADSQNYQRCLETGELATSEDEAAALRAELRDL 169 Qy 62 ELEEARLVQELEDVDRNNARAAADLQAAQAEAAELDQQERQHYRDYSALKRQQLELLDQL 121 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 170 ELEEARLVQELEDVDRNNARAAADLQAAQAEAAELDQQERQHYRDYSALKRQQLELLDQL 229 Qy 122 GNVENQLQYARVQRDRLKEINCFTATFEIWVEGPLGVINNFRLGRLPTVRVGWNEINTAW 181 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 230 GNVENQLQYARVQRDRLKEINCFTATFEIWVEGPLGVINNFRLGRLPTVRVGWNEINTAW 289 Qy 182 GQAALLLLTLANTIGLQFQRYRLIPCGNHSYLKSLTDDRTELPLFCYGGQDVFLNNKYDR 241 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 290 GQAALLLLTLANTIGLQFQRYRLIPCGNHSYLKSLTDDRTELPLFCYGGQDVFLNNKYDR 349 Qy 242 AMVAFLDCMQQFKEEAEKGELGLSLPYGIQVETGLMEDVGGRGECYSIRTHLNTQELWTK 301 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 350 AMVAFLDCMQQFKEEAEKGELGLSLPYGIQVETGLMEDVGGRGECYSIRTHLNTQELWTK 409 Qy 302 ALKFMLINFKWSLIWVASR 320 ||||||||||||||||||| Db 410 ALKFMLINFKWSLIWVASR 428 11. THIS ACTION IS MADE FINAL. Applicant is reminded of the extension of time policy as set forth in 37 CFR 1.136(a). A shortened statutory period for reply to this final action is set to expire THREE MONTHS from the mailing date of this action. In the event a first reply is filed within TWO MONTHS of the mailing date of this final action and the advisory action is not mailed until after the end of the THREE-MONTH shortened statutory period, then the shortened statutory period will expire on the date the advisory action is mailed, and any nonprovisional extension fee (37 CFR 1.17(a)) pursuant to 37 CFR 1.136(a) will be calculated from the mailing date of the advisory action. In no event, however, will the statutory period for reply expire later than SIX MONTHS from the mailing date of this final action. 12. Any inquiry concerning this communication or earlier communications from the examiner should be directed to CHANG-YU WANG whose telephone number is (571)272-4521. The examiner can normally be reached Monday-Thursday, 7:00am-5:00pm EST. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Jeffrey Stucker can be reached at 571-272-0911. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. Chang-Yu Wang July 30, 2026 /CHANG-YU WANG/Primary Examiner, Art Unit 1675
Read full office action

Prosecution Timeline

Feb 09, 2023
Application Filed
Jan 22, 2026
Non-Final Rejection mailed — §112
May 19, 2026
Response Filed
Jul 30, 2026
Final Rejection mailed — §112
Aug 04, 2026
Final Rejection mailed — §112 (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12662528
NOVEL ANTI-NOGO-A ANTIBODIES
4y 2m to grant Granted Jun 23, 2026
Patent 12662678
HUMAN ALZHEIMER'S DISEASE AND TRAUMATIC BRAIN INJURY ASSOCIATED TAU VARIANTS AS BIOMARKERS AND METHODS OF USE THEREOF
3y 6m to grant Granted Jun 23, 2026
Patent 12655201
ISOLATED ANTIGEN BINDING PROTEIN AND USE THEREOF
3y 6m to grant Granted Jun 16, 2026
Patent 12653872
MIMOTOPES OF ALPHA-SYNUCLEIN AND VACCINES THEREOF FOR THE TREATMENT OF SYNUCLEINOPATHY
3y 6m to grant Granted Jun 16, 2026
Patent 12624396
METHODS FOR DETERMINING THE PRESENCE OR RISK OF DEVELOPING FACIOSCAPULOHUMERAL DYSTROPHY (FSHD)
5y 5m to grant Granted May 12, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

Strategy Recommendation AI-generated — please review before filing

Get a prosecution strategy drawn from examiner precedents, rejection analysis, and claim mapping.
Typically takes 5-10 seconds — AI-generated, attorney review required before filing

Prosecution Projections

4-5
Expected OA Rounds
34%
Grant Probability
87%
With Interview (+53.5%)
3y 10m (~2m remaining)
Median Time to Grant
High
PTA Risk
Based on 872 resolved cases by this examiner. Grant probability derived from career allowance rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month