Prosecution Insights
Last updated: October 02, 2026
Application No. 18/021,693

SHANK3 GENE THERAPY APPROACHES

Final Rejection §102§112§DP
Filed
Feb 16, 2023
Priority
Aug 17, 2020 — provisional 63/066,570 +1 more
Examiner
LEE, JAE W
Art Unit
1656
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
Massachusetts Institute of Technology
OA Round
2 (Final)
66%
Grant Probability
Favorable
3-4
OA Rounds
0m
Est. Remaining
99%
With Interview

Examiner Intelligence

Grants 66% — above average
66%
Career Allowance Rate
277 granted / 421 resolved
+5.8% vs TC avg
Strong +39% interview lift
Without
With
+38.6%
Interview Lift
resolved cases with interview
Typical timeline
3y 4m
Avg Prosecution
39 currently pending
Career history
453
Total Applications
across all art units

Statute-Specific Performance

§101
3.8%
-36.2% vs TC avg
§103
33.2%
-6.8% vs TC avg
§102
22.3%
-17.7% vs TC avg
§112
30.9%
-9.1% vs TC avg
Black line = Tech Center average estimate • Based on career data from 421 resolved cases

Office Action

§102 §112 §DP
Notice of Pre-AIA or AIA Status The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . DETAILED ACTION Application status In response to the previous Office action, a non-Final rejection (mailed on 05/01/2026), Applicants filed a response and amendment received on 08/03/2026. Said amendment canceled Claims 5, 7-8, 10-15, 17-18, 21-22, 24-26, 30-42, 44-47, 49-50, 52-79, amended Claims 1, 3, 6, 16, 19, 23, 51, 80-84 and 91-92, and added Claims 93-98. Thus, Claims 1-4, 6, 9, 16, 19-20, 23, 27-28 and 80-98 are at issue and present for examination. It is noted by the Examiner that Claims 29, 48 and 51 are withdrawn from further consideration by the Examiner, 37 CFR 1.142(b) as being drawn to a non-elected invention in the previous Office actions, a non-Final rejection (mailed on 05/01/2026). Information Disclosure Statement The information disclosure statement (IDS) submitted 08/03/2026 is acknowledged. The submission is in compliance with the provisions of 37 CFR 1.97. Accordingly, the information disclosure statement is being considered by the examiner. Claim Objections - MAINTAINED necessitated by Applicants’ amendment to claims All of the previous objections of Claim 16, 23, 80-84 and 91 are withdrawn by virtue of Applicants’ amendment. Claim 96 is objected to for the recitation of “which comprises nucleotide sequence of” which can be substantially improved with respect to form. The Examiner suggests replacing the noted phrase with ---, wherein the polynucleotide comprises the nucleotide sequence as set forth in---. Appropriate correction is required. Claim Rejections - 35 U.S.C. § 112 – MAINTAINED – necessitated by Applicants’ amendment to claims The following is a quotation of 35 U.S.C. 112(b): (B) CONCLUSION.—The specification shall conclude with one or more claims particularly pointing out and distinctly claiming the subject matter which the inventor or a joint inventor regards as the invention. All of the previous rejections of Claims 6, 19 and 92 under 35 U.S.C. § 112, second paragraph, as being indefinite for failing to particularly point out and distinctly claim the subject matter which applicant regards as the invention are withdrawn by virtue of Applicants’ amendment. Claims 1-4, 6, 9, 16, 19-20, 23, 27-28 and 80-98 are rejected under 35 U.S.C. § 112, second paragraph, as being indefinite for failing to particularly point out and distinctly claim the subject matter which applicant regards as the invention. Claim 1 (s-4, 6, 9, 16, 19-20, 23, 27-28 and 80-98 dependent therefrom) recites the phrase, “wherein sequence identity is calculated using the Needleman-Wunsch algorithm” which is unclear and indefinite. The reason is that the claims and the specification do not identify the parameters required to produce a unique, reproducible percent-identity value, which include: [1] the substitution/scoring matrix (e.g., BLOSUM62, BLOSUM50, PAM250, or another matrix); [2] the gap-opening penalty; [3] The gap-extension penalty; [4] whether end gaps are penalized; [5] how identity is computed from the resulting alignment, i.e., identities over aligned length, over the shorter sequence, over the query length, treatment of terminal unaligned residues, etc.). Consequently, a person of ordinary skill in the art cannot determine, with reasonable certainty, which amino acid sequences satisfy the 90% limitation and which do not. Applicants may overcome this rejection by (i) deleting the noted phrase, or (ii) replacing it with a fully specified method and parameter set that is supported by the specification (please note that any amendment must be supported under 35 USC 112(a)). Claim Rejections - 35 USC § 102 - WITHDRAWN The following is a quotation of the appropriate paragraphs of 35 U.S.C. 102 that form the basis for the rejections under this section made in this Office action: A person shall be entitled to a patent unless – (a)(1) the claimed invention was patented, described in a printed publication, or in public use, on sale, or otherwise available to the public before the effective filing date of the claimed invention. The previous rejection of Claims 1, 3-4 and 80 under 35 U.S.C. 102(a)(1) as being anticipated by Uchino et al. (Accession No. AB841411, publicly available since 2013, see sequence search available in SCV, which has been copied/pasted below for Applicants’ convenience: result 1 from 20251007_124819_us-18-021-693-17.rge) is withdrawn because Uchino et al. teach a mouse shank3c gene having 55.5% sequence identity Applicants’ SEQ ID NO: 17 (see below boldfaced percent identity). 20251007_124819_us-18-021-693-17.rge RESULT 1 AB841411 LOCUS AB841411 4157 bp mRNA linear ROD 01-AUG-2013 DEFINITION Mus musculus SHANK3c-3 mRNA for SH3 and multiple ankyrin repeat domains protein 3 variant c-3, complete cds, strain: Crl:CD-1 (ICR). ACCESSION AB841411 VERSION AB841411.1 KEYWORDS . SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 AUTHORS Uchino,S. and Waga,C. TITLE Identification of novel Shank3c transcripts JOURNAL Unpublished REFERENCE 2 (bases 1 to 4157) AUTHORS Uchino,S. and Waga,C. TITLE Direct Submission JOURNAL Submitted (30-JUL-2013) Contact:Shigeo Uchino National Institute of Neuroscience, Neurochemistry; 4-1-1 Ogawahigashi, Kodaira, Tokyo 187-8502, Japan URL :http://www.ncnp.go.jp/nin/index.html E-mail :uchino\@ncnp.go.jp FEATURES Location/Qualifiers source 1..4157 /organism="Mus musculus" /mol_type="mRNA" /strain="Crl:CD-1 (ICR)" /db_xref="taxon:10090" gene 1..4157 /gene="SHANK3c-3" CDS 189..4157 /gene="SHANK3c-3" /note="alternative splicing" /codon_start=1 /product="SH3 and multiple ankyrin repeat domains protein 3 variant c-3" /protein_id="BAN67189.1" /translation="MEAPGAGFACPLPPGIASVTYVFVYSPSGPGGSGPAPGPGPASP APPAPPPRGPKRKLYSAVPGRKFIAVKAHSPQGEGEIPLHRGEAVKVLSIGEGGFWEG TVKGRTGWFPADCVEEVQMRQYDTRHETREDRTKRLFRHYTVGSYDSLTSHSDYVIDD KVAILQKRDHEGFGFVLRGAKAETPIEEFTPTPAFPALQYLESVDVEGVAWRAGLRTG DFLIEVNGVNVVKVGHKQVVGLIRQGGNRLVMKVVSVTRKPEEDGARRRAPPPPKRAP STTLTLRSKSMTAELEELASIRRRKGEKLDEILAVAAEPTLRPDIADADSRAATVKQR PTSRRITPAEISSLFERQGLPGPEKLPGSLRKGIPRTKSVGEDEKLASLLEGRFPRST SMQDTVREGRGIPPPPQTAPPPPPAPYYFDSGPPPTFSPPPPPGRAYDTVRSSFKPGL EARLGAGAAGLYDPSTPLGPLPYPERQKRARSMIILQDSAPEVGDVPRPAPAATPPER PKRRPRPSGPDSPYANLGAFSASLFAPSKPQRRKSPLVKQLQVEDAQERAALAVGSPG PVGGSFAREPSPTHRGPRPGSLDYSSGEGLGLTFGGPSPGPVKERRLEERRRSTVFLS VGAIEGSPPSADLPSLQPSRSIDERLLGTGATTGRDLLLPSPVSALKPLVGGPSLGPS GSTFIHPLTGKPLDPSSPLALALAARERALASQTPSRSPTPVHSPDADRPGPLFVDVQ TRDSERGPLASPAFSPRSPAWIPVPARREAEKPPREERKSPEDKKSMILSVLDTSLQR PAGLIVVHATSNGQEPSRLGAEEERPGTPELAPAPMQAAAVAEPMPSPRAQPPGSIPA DPGPGQGSSEEEPELVFAVNLPPAQLSSSDEETREELARIGLVPPPEEFANGILLTTP PPGPGPLPTTVPSPASGKPSSELPPAPESAADSGVEEADTRSSSDPHLETTSTISTVS SMSTLSSESGELTDTHTSFADGHTFLLEKPPVPPKPKLKSPLGKGPVTFRDPLLKQSS DSELMAQQHHAASTGLASAAGPARPRYLFQRRSKLWGDPVESRGLPGPEDDKPTVISE LSSRLQQLNKDTRSLGEEPVGGLGSLLDPAKKSPIAAARLFSSLGELSTISAQRSPGG PGGGASYSVRPSGRYPVARRAPSPVKPASLERVEGLGAGVGGAGRPFGLTPPTILKSS SLSIPHEPKEVRFVVRSVSARSRSPSPSPLPSPSPGSGPSAGPRRPFQQKPLQLWSKF DVGDWLESIHLGEHRDRFEDHEIEGAHLPALTKEDFVELGVTRVGHRMNIERALRQLD GS Alignment Scores: Length: 4157 Score: 3356.50 Matches: 705 Percent Similarity: 55.5% Conservative: 0 Best Local Similarity: 55.5% Mismatches: 0 Query Match: 91.9% Indels: 565 Gaps: 1 US-18-021-693-17 (1-706) x AB841411 (1-4157) Qy 2 GlyProLysArgLysLeuTyrSerAlaValProGlyArgLysPheIleAlaValLysAla 21 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 345 GGCCCGAAGCGGAAACTTTACAGTGCCGTCCCCGGCCGCAAGTTCATCGCTGTGAAGGCG 404 Qy 22 HisSerProGlnGlyGluGlyGluIleProLeuHisArgGlyGluAlaValLysValLeu 41 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 405 CACAGCCCGCAGGGCGAGGGCGAGATCCCGCTGCACCGCGGCGAGGCCGTGAAGGTGCTC 464 Qy 42 SerIleGlyGluGlyGlyPheTrpGluGlyThrValLysGlyArgThrGlyTrpPhePro 61 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 465 AGCATTGGGGAGGGCGGTTTCTGGGAGGGAACCGTGAAGGGCCGAACAGGCTGGTTCCCA 524 Qy 62 AlaAspCysValGluGluValGlnMetArgGlnTyrAspThrArgHisGluThrArgGlu 81 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 525 GCTGACTGTGTGGAAGAAGTGCAGATGCGACAGTATGACACCCGGCATGAAACCAGAGAG 584 Qy 82 AspArgThrLysArgLeuPheArgHisTyrThrValGlySerTyrAspSerLeuThrSer 101 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 585 GACCGGACGAAGCGTCTCTTCCGCCACTACACTGTGGGTTCCTATGACAGCCTCACTTCA 644 Qy 102 HisSerAspTyrValIleAspAspLysValAlaIleLeuGlnLysArgAspHisGluGly 121 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 645 CACAGCGATTATGTCATCGATGATAAGGTGGCTATCCTGCAGAAAAGGGACCATGAGGGG 704 Qy 122 PheGlyPheValLeuArgGlyAlaLysAlaGluThrProIleGluGluPheThrProThr 141 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 705 TTTGGCTTTGTTCTCCGGGGAGCCAAAGCAGAGACCCCCATTGAGGAGTTTACACCCACA 764 Qy 142 ProAlaPheProAlaLeuGlnTyrLeuGluSerValAspValGluGlyValAlaTrpArg 161 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 765 CCTGCCTTCCCTGCACTCCAATACCTTGAGTCTGTAGATGTGGAAGGTGTGGCCTGGAGG 824 Qy 162 AlaGlyLeuArgThrGlyAspPheLeuIleGluValAsnGlyValAsnValValLysVal 181 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 825 GCTGGACTTCGAACTGGGGACTTCCTCATTGAGGTGAACGGAGTGAATGTCGTGAAGGTT 884 Qy 182 GlyHisLysGlnValValGlyLeuIleArgGlnGlyGlyAsnArgLeuValMetLysVal 201 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 885 GGACACAAGCAAGTGGTGGGTCTCATCCGTCAGGGTGGCAACCGCCTGGTCATGAAGGTT 944 Qy 202 ValSerValThrArgLysProGluGluAspGlyAlaArgArgArgAlaProProProPro 221 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 945 GTGTCTGTGACCAGGAAACCCGAGGAGGATGGTGCTCGGCGCAGAGCCCCACCACCCCCA 1004 Qy 222 LysArgAlaProSerThrThrLeuThrLeuArgSerLysSerMetThrAlaGluLeuGlu 241 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1005 AAGAGGGCTCCCAGCACCACGCTGACCCTGCGGTCCAAGTCCATGACGGCTGAGCTCGAG 1064 Qy 242 GluLeuAlaSerIleArg------------------------------------------ 247 |||||||||||||||||| Db 1065 GAACTTGCTTCCATTCGGAGAAGAAAAGGGGAGAAGTTGGATGAGATCCTGGCAGTTGCC 1124 Qy 247 ------------------------------------------------------------ 247 Db 1125 GCGGAGCCGACACTGAGGCCGGACATTGCAGATGCTGACTCGAGGGCGGCCACTGTCAAG 1184 Qy 247 ------------------------------------------------------------ 247 Db 1185 CAGCGGCCCACCAGCCGGAGGATCACCCCTGCTGAGATCAGCTCATTGTTTGAGCGCCAG 1244 Qy 247 ------------------------------------------------------------ 247 Db 1245 GGCCTCCCAGGCCCAGAGAAGCTGCCGGGCTCTCTGCGGAAGGGGATTCCACGGACCAAA 1304 Qy 247 ------------------------------------------------------------ 247 Db 1305 TCTGTAGGGGAGGATGAGAAGCTGGCATCCCTACTGGAAGGGCGCTTCCCACGCAGCACG 1364 Qy 247 ------------------------------------------------------------ 247 Db 1365 TCAATGCAGGACACAGTGCGTGAAGGTCGAGGCATTCCACCCCCGCCGCAGACCGCCCCG 1424 Qy 247 ------------------------------------------------------------ 247 Db 1425 CCACCCCCACCCGCGCCCTACTACTTCGACTCCGGGCCACCCCCCACCTTCTCACCGCCG 1484 Qy 247 ------------------------------------------------------------ 247 Db 1485 CCACCACCGGGCCGGGCCTATGACACTGTGCGCTCCAGCTTCAAACCAGGCCTGGAGGCT 1544 Qy 247 ------------------------------------------------------------ 247 Db 1545 CGTCTGGGTGCGGGGGCCGCCGGCCTGTATGATCCGAGCACGCCTCTGGGCCCGCTGCCC 1604 Qy 247 ------------------------------------------------------------ 247 Db 1605 TACCCTGAGCGTCAGAAGCGTGCGCGCTCCATGATCATACTGCAGGACTCTGCGCCAGAA 1664 Qy 247 ------------------------------------------------------------ 247 Db 1665 GTGGGTGATGTCCCCCGGCCTGCGCCTGCCGCCACACCGCCTGAGCGCCCCAAGCGCCGG 1724 Qy 247 ------------------------------------------------------------ 247 Db 1725 CCTCGGCCGTCAGGCCCTGATAGTCCCTATGCCAACCTGGGCGCCTTCAGTGCCAGCCTC 1784 Qy 247 ------------------------------------------------------------ 247 Db 1785 TTCGCTCCGTCGAAACCACAGCGCCGCAAGAGCCCGCTGGTGAAGCAGCTTCAGGTGGAG 1844 Qy 247 ------------------------------------------------------------ 247 Db 1845 GACGCTCAGGAGCGCGCGGCCCTGGCCGTGGGTAGCCCGGGACCAGTGGGCGGAAGCTTT 1904 Qy 247 ------------------------------------------------------------ 247 Db 1905 GCACGAGAACCCTCTCCGACGCACCGCGGGCCCCGGCCAGGCAGCCTTGACTACAGCTCT 1964 Qy 247 ------------------------------------------------------------ 247 Db 1965 GGAGAAGGCCTAGGCCTTACCTTCGGCGGCCCTAGCCCTGGCCCAGTCAAGGAGCGGCGC 2024 Qy 247 ------------------------------------------------------------ 247 Db 2025 CTGGAGGAGCGACGCCGTTCCACTGTGTTCCTCTCTGTGGGTGCCATCGAGGGCAGCCCT 2084 Qy 247 ------------------------------------------------------------ 247 Db 2085 CCCAGCGCGGATCTGCCATCCCTACAACCCTCCCGCTCCATTGATGAGCGCCTCCTGGGG 2144 Qy 247 ------------------------------------------------------------ 247 Db 2145 ACAGGCGCCACCACTGGCCGCGATTTGCTACTCCCCTCCCCTGTCTCTGCTCTGAAGCCA 2204 Qy 247 ------------------------------------------------------------ 247 Db 2205 TTGGTCGGTGGTCCCAGCCTTGGGCCCTCAGGCTCCACCTTCATCCACCCTCTCACTGGC 2264 Qy 247 ------------------------------------------------------------ 247 Db 2265 AAACCCTTGGATCCTAGCTCACCCTTAGCTCTTGCTCTGGCTGCCCGGGAGCGGGCTCTG 2324 Qy 247 ------------------------------------------------------------ 247 Db 2325 GCCTCGCAAACACCTTCCCGGTCCCCCACACCTGTGCACAGCCCCGATGCTGACCGCCCT 2384 Qy 247 ------------------------------------------------------------ 247 Db 2385 GGACCCCTCTTTGTGGATGTGCAAACCCGAGACTCTGAGAGAGGACCGTTGGCTTCCCCA 2444 Qy 247 ------------------------------------------------------------ 247 Db 2445 GCCTTCTCCCCTCGGAGTCCAGCGTGGATTCCAGTGCCTGCTCGGAGAGAGGCAGAGAAG 2504 Qy 247 ------------------------------------------------------------ 247 Db 2505 CCCCCTCGGGAAGAGCGGAAGTCACCAGAGGACAAGAAGTCCATGATCCTCAGCGTCTTG 2564 Qy 247 ------------------------------------------------------------ 247 Db 2565 GACACGTCCTTGCAACGGCCAGCTGGCCTTATTGTTGTGCATGCCACCAGCAATGGGCAG 2624 Qy 247 ------------------------------------------------------------ 247 Db 2625 GAGCCCAGCAGGCTGGGGGCTGAAGAGGAGCGCCCCGGTACTCCGGAGCTGGCCCCAGCC 2684 Qy 247 ------------------------------------------------------------ 247 Db 2685 CCCATGCAGGCAGCAGCTGTGGCAGAGCCCATGCCAAGCCCCCGGGCCCAGCCCCCTGGC 2744 Qy 248 ---------------------------------SerSerGluGluGluProGluLeuVal 256 ||||||||||||||||||||||||||| Db 2745 AGCATCCCAGCAGATCCCGGGCCAGGTCAAGGCAGCTCAGAGGAGGAGCCAGAGCTGGTA 2804 Qy 257 PheAlaValAsnLeuProProAlaGlnLeuSerSerSerAspGluGluThrArgGluGlu 276 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 2805 TTCGCTGTGAACCTGCCACCTGCTCAGCTGTCCTCCAGCGATGAGGAGACCAGAGAGGAG 2864 Qy 277 LeuAlaArgIleGlyLeuValProProProGluGluPheAlaAsnGlyIleLeuLeuThr 296 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 2865 CTGGCCCGCATAGGGCTAGTGCCACCCCCTGAAGAGTTTGCCAATGGGATCCTGCTGACC 2924 Qy 297 ThrProProProGlyProGlyProLeuProThrThrValProSerProAlaSerGlyLys 316 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 2925 ACCCCGCCCCCAGGGCCGGGCCCCTTGCCCACCACGGTACCCAGCCCGGCCTCAGGGAAG 2984 Qy 317 ProSerSerGluLeuProProAlaProGluSerAlaAlaAspSerGlyValGluGluAla 336 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 2985 CCCAGCAGCGAGCTGCCCCCTGCCCCTGAGTCTGCAGCTGACTCTGGAGTAGAGGAGGCT 3044 Qy 337 AspThrArgSerSerSerAspProHisLeuGluThrThrSerThrIleSerThrValSer 356 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3045 GACACTCGAAGCTCCAGTGACCCCCACCTGGAGACCACAAGCACCATTTCCACAGTGTCC 3104 Qy 357 SerMetSerThrLeuSerSerGluSerGlyGluLeuThrAspThrHisThrSerPheAla 376 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3105 AGCATGTCCACCCTGAGCTCGGAGAGTGGGGAACTCACGGACACCCACACCTCCTTTGCC 3164 Qy 377 AspGlyHisThrPheLeuLeuGluLysProProValProProLysProLysLeuLysSer 396 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3165 GATGGACACACTTTTCTACTCGAGAAGCCACCAGTGCCTCCCAAGCCCAAGCTCAAGTCC 3224 Qy 397 ProLeuGlyLysGlyProValThrPheArgAspProLeuLeuLysGlnSerSerAspSer 416 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3225 CCGCTGGGGAAGGGGCCGGTGACCTTCAGGGACCCGCTGCTGAAGCAATCCTCGGACAGT 3284 Qy 417 GluLeuMetAlaGlnGlnHisHisAlaAlaSerThrGlyLeuAlaSerAlaAlaGlyPro 436 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3285 GAGCTCATGGCCCAGCAGCACCATGCTGCCTCTACTGGGTTGGCTTCTGCTGCTGGGCCC 3344 Qy 437 AlaArgProArgTyrLeuPheGlnArgArgSerLysLeuTrpGlyAspProValGluSer 456 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3345 GCCCGCCCTCGCTACCTCTTCCAGAGAAGGTCCAAGCTGTGGGGGGACCCCGTGGAGAGT 3404 Qy 457 ArgGlyLeuProGlyProGluAspAspLysProThrValIleSerGluLeuSerSerArg 476 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3405 CGGGGGCTCCCTGGGCCTGAAGATGACAAACCAACTGTGATCAGTGAGCTCAGCTCCCGT 3464 Qy 477 LeuGlnGlnLeuAsnLysAspThrArgSerLeuGlyGluGluProValGlyGlyLeuGly 496 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3465 CTGCAGCAGCTGAATAAAGACACACGCTCCTTGGGGGAGGAACCAGTTGGTGGCCTGGGC 3524 Qy 497 SerLeuLeuAspProAlaLysLysSerProIleAlaAlaAlaArgLeuPheSerSerLeu 516 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3525 AGCCTGCTGGACCCTGCTAAGAAGTCACCCATTGCAGCAGCTCGGCTCTTCAGCAGCCTC 3584 Qy 517 GlyGluLeuSerThrIleSerAlaGlnArgSerProGlyGlyProGlyGlyGlyAlaSer 536 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3585 GGTGAGCTGAGCACCATCTCAGCGCAGCGCAGCCCGGGGGGCCCGGGCGGAGGGGCCTCC 3644 Qy 537 TyrSerValArgProSerGlyArgTyrProValAlaArgArgAlaProSerProValLys 556 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3645 TACTCGGTGCGGCCCAGCGGCCGGTACCCCGTGGCGAGACGAGCCCCGAGCCCAGTGAAA 3704 Qy 557 ProAlaSerLeuGluArgValGluGlyLeuGlyAlaGlyValGlyGlyAlaGlyArgPro 576 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3705 CCCGCATCGCTGGAGCGGGTGGAGGGGCTGGGGGCGGGCGTGGGAGGCGCGGGGCGGCCC 3764 Qy 577 PheGlyLeuThrProProThrIleLeuLysSerSerSerLeuSerIleProHisGluPro 596 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3765 TTCGGCCTCACGCCTCCCACCATCCTCAAGTCGTCCAGCCTCTCCATCCCGCACGAACCC 3824 Qy 597 LysGluValArgPheValValArgSerValSerAlaArgSerArgSerProSerProSer 616 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3825 AAGGAAGTGCGCTTCGTGGTGCGAAGTGTGAGTGCGCGCAGCCGCTCCCCCTCACCATCT 3884 Qy 617 ProLeuProSerProSerProGlySerGlyProSerAlaGlyProArgArgProPheGln 636 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3885 CCGCTGCCCTCGCCTTCTCCCGGCTCTGGCCCCAGTGCCGGCCCGCGTCGGCCATTTCAA 3944 Qy 637 GlnLysProLeuGlnLeuTrpSerLysPheAspValGlyAspTrpLeuGluSerIleHis 656 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3945 CAGAAGCCCCTGCAGCTCTGGAGCAAGTTCGATGTGGGCGACTGGCTGGAGAGCATCCAC 4004 Qy 657 LeuGlyGluHisArgAspArgPheGluAspHisGluIleGluGlyAlaHisLeuProAla 676 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 4005 TTAGGCGAGCACCGAGACCGCTTCGAGGACCATGAGATCGAAGGCGCACACCTGCCTGCG 4064 Qy 677 LeuThrLysGluAspPheValGluLeuGlyValThrArgValGlyHisArgMetAsnIle 696 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 4065 CTCACCAAGGAAGACTTCGTGGAGCTGGGCGTCACACGCGTTGGCCACCGCATGAACATC 4124 Qy 697 GluArgAlaLeuArgGlnLeuAspGlySer 706 |||||||||||||||||||||||||||||| Db 4125 GAGCGTGCGCTCAGGCAGCTGGATGGCAGC 4154 The previous rejection of Claims 1, 3-4 and 81 under 35 U.S.C. 102(a)(1) as being anticipated by Uchino et al. (Accession No. AB569469, publicly available since 2010, see sequence search available in SCV, which has been copied/pasted below for Applicants’ convenience: result 1 from 20251007_124819_us-18-021-693-18.rge) is withdrawn because Uchino et al. teach a human shank3 gene having 55.6% sequence identity Applicants’ SEQ ID NO: 18 (see below boldfaced percent identity). 20251007_124819_us-18-021-693-18.rge RESULT 1 AB569469 LOCUS AB569469 5196 bp mRNA linear PRI 07-JUL-2010 DEFINITION Homo sapiens SHANK3 mRNA for SH3 and multiple ankyrin repeat domains 3, complete cds. ACCESSION AB569469 VERSION AB569469.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 AUTHORS Uchino,S., Waga,C. and Kohsaka,S. TITLE Novel veriants of human SHANK3 gene JOURNAL Unpublished REFERENCE 2 (bases 1 to 5196) AUTHORS Uchino,S., Waga,C. and Kohsaka,S. TITLE Direct Submission JOURNAL Submitted (23-JUN-2010) Contact:Shigeo Uchino National Institute of Neuroscience, Department of Neurochemistry; Ogawahigashi 4-1-1, Kodaira, Tokyo 187-8502, Japan E-mail :uchino\@ncnp.go.jp Phone :81-42-341-2711 Fax :81-42-346-1751 FEATURES Location/Qualifiers source 1..5196 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" gene <1..>5196 /gene="SHANK3" CDS 1..5196 /gene="SHANK3" /codon_start=1 /product="SH3 and multiple ankyrin repeat domains 3" /protein_id="BAJ09793.1" /translation="MDGPGASAVVVRVGIPDLQQTKCLRLDPAAPVWAAKQRVLCALN HSLQDALNYGLFQPPSRGRAGKFLDEERLLQEYPPNLDTPLPYLEFRYKRRVYAQNLI DDKQFAKLHTKANLKKFMDYVQLHSTDKVARLLDKGLDPNFHDPDSGECPLSLAAQLD NATDLLKVLKNGGAHLDFRTRDGLTAVHCATRQRNAAALTTLLDLGASPDYKDSRGLT PLYHSALGGGDALCCELLLHDHAQLGITDENGWQEIHQACRFGHVQHLEHLLFYGADM GAQNASGNTALHICALYNQESCARVLLFRGANRDVRNYNSQTAFQVAIIAGNFELAEV IKTHKDSDVVPFRETPSYAKRRRLAGPSGLASPRPLQRSASDINLKGEAQPAASPGPS LRSLPHQLLLQRLQEEKDRDRDADQESNISGPLAGRAGQSKISPSGPGGPGPAPGPGP APPAPPAPPPRGPKRKLYSAVPGRKFIAVKAHSPQGEGEIPLHRGEAVKVLSIGEGGF WEGTVKGRTGWFPADCVEEVQMRQHDTRPETREDRTKRLFRHYTVGSYDSLTSHSDYV IDDKVAVLQKRDHEGFGFVLRGAKAETPIEEFTPTPAFPALQYLESVDVEGVAWRAGL RTGDFLIEVNGVNVVKVGHKQVVALIRQGGNRLVMKVVSVTRKPEEDGARRRAPPPPK RAPSTTLTLRSKSMTAELEELASIRRRKGEKLDEMLAAAAEPTLRPDIADADSRAATV KQRPTSRRITPAEISSLFERQGLPGPEKLPGSLRKGIPRTKSVGEDEKLASLLEGRFP RSTSMQDPVREGRGIPPPPQTAPPPPPAPYYFDSGPPPAFSPPPPPGRAYDTVRSSFK PGLEARLGAGAAGLYEPGAALGPLPYPERQKRARSMIILQDSAPESGDAPRPPPAATP PERPKRRPRPPGPDSPYANLGAFSASLFAPSKPQRRKSPLVKQLQVEDAQERAALAVG SPGPGGGSFAREPSPTHRGPRPGGLDYGAGDGPGLAFGGPGPAKDRRLEERRRSTVFL SVGAIEGSAPGADLPSLQPSRSIDERLLGTGPTAGRDLLLPSPVSALKPLVSGPSLGP SGSTFIHPLTGKPLDPSSPLALALAARERALASQAPSRSPTPVHSPDADRPGPLFVDV QARDPERGSLASPAFSPRSPAWIPVPARREAEKVPREERKSPEDKKSMILSVLDTSLQ RPAGLIVVHATSNGQEPSRLGGAEEERPGTPELAPAPMQSAAVAEPLPSPRAQPPGGT PADAGPGQGSSEEEPELVFAVNLPPAQLSSSDEETREELARIGLVPPPEEFANGVLLA TPLAGPGPSPTTVPSPASGKPSSEPPPAPESAADSGVEEADTRSSSDPHLETTSTIST VSSMSTLSSESGELTDTHTSFADGHTFLLEKPPVPPKPKLKSPLGKGPVTFRDPLLKQ SSDSELMAQQHHAASAGLASAAGPARPRYLFQRRSKLWGDPVESRGLPGPEDDKPTVI SELSSRLQQLNKDTRSLGEEPVGGLGSLLDPAKKSPIAAARLFSSLGELSSISAQRSP GGPGGGASYSVRPSGRYPVARRAPSPVKPASLERVEGLGAGAGGAGRPFGLTPPTILK SSSLSIPHEPKEVRFVVRSVSARSRSPSPSPLPSPASGPGPGAPGPRRPFQQKPLQLW SKFDVGDWLESIHLGEHRDRFEDHEIEGAHLPALTKDDFVELGVTRVGHRMNIERALR QLDGS" exon <1..63 /gene="SHANK3" /number=1 exon 64..267 /gene="SHANK3" /number=2 exon 268..339 /gene="SHANK3" /number=3 exon 340..447 /gene="SHANK3" /number=4 exon 448..600 /gene="SHANK3" /number=5 exon 601..768 /gene="SHANK3" /number=6 exon 769..885 /gene="SHANK3" /number=7 exon 886..963 /gene="SHANK3" /number=8 exon 964..1029 /gene="SHANK3" /number=9 exon 1030..1305 /gene="SHANK3" /number=10 exon 1306..1497 /gene="SHANK3" /number=11 exon 1498..1611 /gene="SHANK3" /number=12 exon 1612..1689 /gene="SHANK3" /number=13 exon 1690..1770 /gene="SHANK3" /number=14 exon 1771..1896 /gene="SHANK3" /number=15 exon 1897..2028 /gene="SHANK3" /number=16 exon 2029..2109 /gene="SHANK3" /number=17 exon 2110..2133 /gene="SHANK3" /number=18 exon 2134..2265 /gene="SHANK3" /number=19 exon 2266..2349 /gene="SHANK3" /number=20 exon 2350..4605 /gene="SHANK3" /number=21 exon 4606..>5196 /gene="SHANK3" /number=2 Alignment Scores: Length: 5196 Score: 3359.00 Matches: 706 Percent Similarity: 55.6% Conservative: 0 Best Local Similarity: 55.6% Mismatches: 0 Query Match: 91.9% Indels: 564 Gaps: 1 US-18-021-693-18 (1-707) x AB569469 (1-5196) Qy 2 GlyProLysArgLysLeuTyrSerAlaValProGlyArgLysPheIleAlaValLysAla 21 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1384 GGCCCGAAGCGGAAACTTTACAGCGCCGTCCCCGGCCGCAAGTTCATCGCCGTGAAGGCG 1443 Qy 22 HisSerProGlnGlyGluGlyGluIleProLeuHisArgGlyGluAlaValLysValLeu 41 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1444 CACAGCCCGCAGGGTGAAGGCGAGATCCCGCTGCACCGCGGCGAGGCCGTGAAGGTGCTC 1503 Qy 42 SerIleGlyGluGlyGlyPheTrpGluGlyThrValLysGlyArgThrGlyTrpPhePro 61 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1504 AGCATTGGGGAGGGCGGTTTCTGGGAGGGAACCGTGAAAGGCCGCACGGGCTGGTTCCCG 1563 Qy 62 AlaAspCysValGluGluValGlnMetArgGlnHisAspThrArgProGluThrArgGlu 81 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1564 GCCGACTGCGTGGAGGAAGTGCAGATGAGGCAGCATGACACACGGCCTGAAACGCGGGAG 1623 Qy 82 AspArgThrLysArgLeuPheArgHisTyrThrValGlySerTyrAspSerLeuThrSer 101 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1624 GACCGGACGAAGCGGCTCTTTCGGCACTACACAGTGGGCTCCTACGACAGCCTCACCTCA 1683 Qy 102 HisSerAspTyrValIleAspAspLysValAlaValLeuGlnLysArgAspHisGluGly 121 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1684 CACAGCGATTATGTCATTGATGACAAAGTGGCTGTCCTGCAGAAACGGGACCACGAGGGC 1743 Qy 122 PheGlyPheValLeuArgGlyAlaLysAlaGluThrProIleGluGluPheThrProThr 141 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1744 TTTGGTTTTGTGCTCCGGGGAGCCAAAGCAGAGACCCCCATCGAGGAGTTCACGCCCACG 1803 Qy 142 ProAlaPheProAlaLeuGlnTyrLeuGluSerValAspValGluGlyValAlaTrpArg 161 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1804 CCAGCCTTCCCGGCGCTGCAGTATCTCGAGTCGGTGGACGTGGAGGGTGTGGCCTGGAGG 1863 Qy 162 AlaGlyLeuArgThrGlyAspPheLeuIleGluValAsnGlyValAsnValValLysVal 181 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1864 GCCGGGCTGCGCACGGGAGACTTCCTCATCGAGGTGAACGGGGTGAACGTGGTGAAGGTC 1923 Qy 182 GlyHisLysGlnValValAlaLeuIleArgGlnGlyGlyAsnArgLeuValMetLysVal 201 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1924 GGACACAAGCAGGTGGTGGCTCTGATTCGCCAGGGTGGCAACCGCCTCGTCATGAAGGTT 1983 Qy 202 ValSerValThrArgLysProGluGluAspGlyAlaArgArgArgAlaProProProPro 221 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1984 GTGTCTGTGACAAGGAAGCCAGAAGAGGACGGGGCTCGGCGCAGAGCCCCACCGCCCCCC 2043 Qy 222 LysArgAlaProSerThrThrLeuThrLeuArgSerLysSerMetThrAlaGluLeuGlu 241 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 2044 AAGAGGGCCCCCAGCACCACACTGACCCTGCGCTCCAAGTCCATGACAGCTGAGCTCGAG 2103 Qy 242 GluLeuAlaSerIleArg------------------------------------------ 247 |||||||||||||||||| Db 2104 GAACTTGCCTCCATTCGGAGAAGAAAAGGGGAGAAGCTGGACGAGATGCTGGCAGCCGCC 2163 Qy 247 ------------------------------------------------------------ 247 Db 2164 GCAGAGCCAACGCTGCGGCCAGACATCGCAGACGCAGACTCCAGAGCCGCCACCGTCAAA 2223 Qy 247 ------------------------------------------------------------ 247 Db 2224 CAGAGGCCCACCAGTCGGAGGATCACACCCGCCGAGATTAGCTCATTGTTTGAACGCCAG 2283 Qy 247 ------------------------------------------------------------ 247 Db 2284 GGCCTCCCAGGCCCAGAGAAGCTGCCGGGCTCCTTGCGGAAGGGGATTCCACGGACCAAG 2343 Qy 247 ------------------------------------------------------------ 247 Db 2344 TCTGTAGGGGAGGACGAGAAGCTGGCGTCCCTGCTGGAAGGGCGCTTCCCGCGGAGCACC 2403 Qy 247 ------------------------------------------------------------ 247 Db 2404 TCGATGCAAGACCCGGTGCGCGAGGGTCGCGGCATCCCGCCCCCGCCGCAGACCGCGCCG 2463 Qy 247 ------------------------------------------------------------ 247 Db 2464 CCTCCCCCGCCCGCGCCCTACTACTTCGACTCGGGGCCGCCCCCGGCCTTCTCGCCGCCG 2523 Qy 247 ------------------------------------------------------------ 247 Db 2524 CCCCCGCCGGGCCGCGCCTACGACACGGTGCGCTCCAGCTTCAAGCCCGGCCTGGAGGCG 2583 Qy 247 ------------------------------------------------------------ 247 Db 2584 CGCCTGGGCGCGGGCGCTGCCGGCCTGTACGAGCCGGGCGCGGCCCTCGGCCCGCTGCCG 2643 Qy 247 ------------------------------------------------------------ 247 Db 2644 TATCCCGAGCGGCAGAAGCGCGCGCGCTCCATGATCATCCTGCAGGACTCGGCGCCCGAG 2703 Qy 247 ------------------------------------------------------------ 247 Db 2704 TCGGGCGACGCCCCTCGACCCCCGCCCGCGGCCACCCCGCCCGAGCGACCCAAGCGCCGG 2763 Qy 247 ------------------------------------------------------------ 247 Db 2764 CCGCGGCCGCCCGGCCCCGACAGCCCCTACGCCAACCTGGGCGCCTTCAGCGCCAGCCTC 2823 Qy 247 ------------------------------------------------------------ 247 Db 2824 TTCGCTCCGTCCAAGCCGCAGCGCCGCAAGAGCCCCCTGGTGAAGCAGCTGCAGGTGGAG 2883 Qy 247 ------------------------------------------------------------ 247 Db 2884 GACGCGCAGGAGCGCGCGGCCCTGGCCGTGGGCAGCCCCGGTCCCGGCGGCGGCAGCTTC 2943 Qy 247 ------------------------------------------------------------ 247 Db 2944 GCCCGCGAGCCCTCCCCGACCCACCGCGGTCCGCGCCCGGGTGGCCTCGACTACGGCGCG 3003 Qy 247 ------------------------------------------------------------ 247 Db 3004 GGCGATGGCCCGGGGCTCGCGTTCGGCGGCCCGGGCCCGGCCAAGGACCGGCGGCTGGAG 3063 Qy 247 ------------------------------------------------------------ 247 Db 3064 GAGCGGCGCCGCTCCACTGTGTTCCTGTCCGTGGGGGCCATCGAGGGCAGCGCCCCCGGC 3123 Qy 247 ------------------------------------------------------------ 247 Db 3124 GCGGATCTGCCATCCCTACAGCCCTCCCGCTCCATCGACGAGCGCCTCCTGGGGACCGGC 3183 Qy 247 ------------------------------------------------------------ 247 Db 3184 CCCACCGCCGGCCGCGACCTGCTGCTGCCCTCCCCGGTGTCTGCCCTGAAGCCGTTGGTC 3243 Qy 247 ------------------------------------------------------------ 247 Db 3244 AGCGGCCCGAGCCTGGGGCCCTCGGGTTCCACCTTCATCCACCCACTCACCGGCAAACCC 3303 Qy 247 ------------------------------------------------------------ 247 Db 3304 CTGGACCCCAGCTCACCCCTGGCCCTTGCCCTGGCTGCCCGAGAGCGAGCTCTGGCCTCC 3363 Qy 247 ------------------------------------------------------------ 247 Db 3364 CAGGCGCCCTCCCGGTCCCCCACACCCGTGCACAGTCCCGACGCCGACCGCCCCGGACCC 3423 Qy 247 ------------------------------------------------------------ 247 Db 3424 CTGTTTGTGGATGTACAGGCCCGGGACCCAGAGCGAGGGTCCCTGGCTTCCCCGGCTTTC 3483 Qy 247 ------------------------------------------------------------ 247 Db 3484 TCCCCACGGAGCCCAGCCTGGATTCCTGTGCCTGCTCGCAGGGAGGCAGAGAAGGTCCCC 3543 Qy 247 ------------------------------------------------------------ 247 Db 3544 CGGGAGGAGCGGAAGTCACCCGAGGACAAGAAGTCCATGATCCTCAGCGTCCTGGACACA 3603 Qy 247 ------------------------------------------------------------ 247 Db 3604 TCCCTGCAGCGGCCAGCTGGCCTCATCGTTGTGCACGCCACCAGCAACGGGCAGGAGCCC 3663 Qy 247 ------------------------------------------------------------ 247 Db 3664 AGCAGGCTGGGGGGGGCCGAAGAGGAGCGCCCGGGCACCCCGGAGTTGGCCCCGGCCCCC 3723 Qy 247 ------------------------------------------------------------ 247 Db 3724 ATGCAGTCAGCGGCTGTGGCAGAGCCCCTGCCCAGCCCCCGGGCCCAGCCCCCTGGTGGC 3783 Qy 248 ------------------------------SerSerGluGluGluProGluLeuValPhe 257 |||||||||||||||||||||||||||||| Db 3784 ACCCCGGCAGACGCCGGGCCAGGCCAGGGCAGCTCAGAGGAAGAGCCAGAGCTGGTGTTT 3843 Qy 258 AlaValAsnLeuProProAlaGlnLeuSerSerSerAspGluGluThrArgGluGluLeu 277 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3844 GCTGTGAACCTGCCACCTGCCCAGCTGTCGTCCAGCGATGAGGAGACCAGGGAGGAGCTG 3903 Qy 278 AlaArgIleGlyLeuValProProProGluGluPheAlaAsnGlyValLeuLeuAlaThr 297 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3904 GCCCGAATTGGGTTGGTGCCACCCCCTGAAGAGTTTGCCAACGGGGTCCTGCTGGCCACC 3963 Qy 298 ProLeuAlaGlyProGlyProSerProThrThrValProSerProAlaSerGlyLysPro 317 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3964 CCACTCGCTGGCCCGGGCCCCTCGCCCACCACGGTGCCCAGCCCGGCCTCAGGGAAGCCC 4023 Qy 318 SerSerGluProProProAlaProGluSerAlaAlaAspSerGlyValGluGluAlaAsp 337 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 4024 AGCAGTGAGCCACCCCCTGCCCCTGAGTCTGCAGCCGACTCTGGGGTGGAGGAGGCTGAC 4083 Qy 338 ThrArgSerSerSerAspProHisLeuGluThrThrSerThrIleSerThrValSerSer 357 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 4084 ACACGCAGCTCCAGCGACCCCCACCTGGAGACCACAAGCACCATCTCCACGGTGTCCAGC 4143 Qy 358 MetSerThrLeuSerSerGluSerGlyGluLeuThrAspThrHisThrSerPheAlaAsp 377 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 4144 ATGTCCACCTTGAGCTCGGAGAGCGGGGAACTCACTGACACCCACACCTCCTTCGCTGAC 4203 Qy 378 GlyHisThrPheLeuLeuGluLysProProValProProLysProLysLeuLysSerPro 397 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 4204 GGACACACTTTTCTACTCGAGAAGCCACCAGTGCCTCCCAAGCCCAAGCTCAAGTCCCCG 4263 Qy 398 LeuGlyLysGlyProValThrPheArgAspProLeuLeuLysGlnSerSerAspSerGlu 417 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 4264 CTGGGGAAGGGGCCGGTGACCTTCAGGGACCCGCTGCTGAAGCAGTCCTCGGACAGCGAG 4323 Qy 418 LeuMetAlaGlnGlnHisHisAlaAlaSerAlaGlyLeuAlaSerAlaAlaGlyProAla 437 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 4324 CTCATGGCCCAGCAGCACCACGCCGCCTCTGCCGGGCTGGCCTCTGCCGCCGGGCCTGCC 4383 Qy 438 ArgProArgTyrLeuPheGlnArgArgSerLysLeuTrpGlyAspProValGluSerArg 457 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 4384 CGCCCTCGCTACCTCTTCCAGAGAAGGTCCAAGCTATGGGGGGACCCCGTGGAGAGCCGG 4443 Qy 458 GlyLeuProGlyProGluAspAspLysProThrValIleSerGluLeuSerSerArgLeu 477 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 4444 GGGCTCCCTGGGCCTGAAGACGACAAACCAACTGTGATCAGTGAGCTCAGCTCCCGCCTG 4503 Qy 478 GlnGlnLeuAsnLysAspThrArgSerLeuGlyGluGluProValGlyGlyLeuGlySer 497 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 4504 CAGCAGCTGAACAAGGACACGCGTTCCCTGGGGGAGGAACCAGTTGGTGGCCTGGGCAGC 4563 Qy 498 LeuLeuAspProAlaLysLysSerProIleAlaAlaAlaArgLeuPheSerSerLeuGly 517 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 4564 CTGCTGGACCCTGCCAAGAAGTCGCCCATCGCAGCAGCTCGGCTCTTCAGCAGCCTCGGT 4623 Qy 518 GluLeuSerSerIleSerAlaGlnArgSerProGlyGlyProGlyGlyGlyAlaSerTyr 537 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 4624 GAGCTGAGCTCCATTTCAGCGCAGCGCAGCCCCGGGGGCCCGGGCGGCGGGGCCTCGTAC 4683 Qy 538 SerValArgProSerGlyArgTyrProValAlaArgArgAlaProSerProValLysPro 557 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 4684 TCGGTGAGGCCCAGTGGCCGCTACCCCGTGGCGAGACGCGCCCCGAGCCCGGTGAAGCCC 4743 Qy 558 AlaSerLeuGluArgValGluGlyLeuGlyAlaGlyAlaGlyGlyAlaGlyArgProPhe 577 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 4744 GCGTCGCTGGAGCGGGTGGAGGGGCTGGGGGCGGGCGCGGGGGGCGCAGGGCGGCCCTTC 4803 Qy 578 GlyLeuThrProProThrIleLeuLysSerSerSerLeuSerIleProHisGluProLys 597 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 4804 GGCCTCACGCCCCCCACCATCCTCAAGTCGTCCAGCCTCTCCATCCCGCACGAGCCCAAG 4863 Qy 598 GluValArgPheValValArgSerValSerAlaArgSerArgSerProSerProSerPro 617 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 4864 GAGGTGCGCTTCGTGGTGCGCAGCGTGAGCGCGCGCAGTCGCTCCCCCTCGCCGTCGCCG 4923 Qy 618 LeuProSerProAlaSerGlyProGlyProGlyAlaProGlyProArgArgProPheGln 637 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 4924 CTGCCCTCGCCCGCGTCCGGCCCCGGCCCCGGCGCCCCCGGCCCACGCCGACCCTTCCAG 4983 Qy 638 GlnLysProLeuGlnLeuTrpSerLysPheAspValGlyAspTrpLeuGluSerIleHis 657 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 4984 CAGAAGCCGCTGCAGCTCTGGAGCAAGTTCGACGTGGGCGACTGGCTGGAGAGCATCCAC 5043 Qy 658 LeuGlyGluHisArgAspArgPheGluAspHisGluIleGluGlyAlaHisLeuProAla 677 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 5044 CTAGGCGAGCACCGCGACCGCTTCGAGGACCATGAGATAGAAGGCGCGCACCTACCCGCG 5103 Qy 678 LeuThrLysAspAspPheValGluLeuGlyValThrArgValGlyHisArgMetAsnIle 697 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 5104 CTTACCAAGGACGACTTCGTGGAGCTGGGCGTCACGCGCGTGGGCCACCGCATGAACATC 5163 Qy 698 GluArgAlaLeuArgGlnLeuAspGlySer 707 |||||||||||||||||||||||||||||| Db 5164 GAGCGCGCGCTCAGGCAGCTGGACGGCAGC 5193 Double Patenting - MAINTAINED The nonstatutory double patenting rejection is based on a judicially created doctrine grounded in public policy (a policy reflected in the statute) so as to prevent the unjustified or improper timewise extension of the “right to exclude” granted by a patent and to prevent possible harassment by multiple assignees. A nonstatutory obviousness-type double patenting rejection is appropriate where the conflicting claims are not identical, but at least one examined application claim is not patentably distinct from the reference claim(s) because the examined application claim is either anticipated by, or would have been obvious over, the reference claim(s). See, e.g., In re Berg, 140 F.3d 1428, 46 USPQ2d 1226 (Fed. Cir. 1998); In re Goodman, 11 F.3d 1046, 29 USPQ2d 2010 (Fed. Cir. 1993); In re Longi, 759 F.2d 887, 225 USPQ 645 (Fed. Cir. 1985); In re Van Ornum, 686 F.2d 937, 214 USPQ 761 (CCPA 1982); In re Vogel, 422 F.2d 438, 164 USPQ 619 (CCPA 1970); and In re Thorington, 418 F.2d 528, 163 USPQ 644 (CCPA 1969). A timely filed terminal disclaimer in compliance with 37 CFR 1.321(c) or 1.321(d) may be used to overcome an actual or provisional rejection based on a nonstatutory double patenting ground provided the conflicting application or patent either is shown to be commonly owned with this application, or claims an invention made as a result of activities undertaken within the scope of a joint research agreement. Effective January 1, 1994, a registered attorney or agent of record may sign a terminal disclaimer. A terminal disclaimer signed by the assignee must fully comply with 37 CFR 3.73(b). It is noted by the Examiner that all of the previous double patenting rejections shown below are maintained because Applicants have requested that they be held in abeyance until allowable subject matter has been identified. Claims 1-4, 6, 9, 16, 19-20, 23, 27-28 and 80-98 are provisionally rejected on the ground of nonstatutory obviousness-type double patenting as being unpatentable over claims 1-58 of copending Application No. 19158554. This is a provisional obviousness-type double patenting rejection because the conflicting claims have not in fact been patented. Claim 1 of the instant application: A non-naturally occurring polynucleotide encoding a Shank3 protein, wherein the Shank3 protein comprises an SH3 domain, a PDZ domain, a Homer binding domain, a Cortactin binding domain, and a SAM domain; wherein the SH3 domain comprises at least 90% identity to residues 474-525 of SEQ ID NO: 6 or at least 90% identity to residues 473-524 of SEQ ID NO: 5;wherein the PDZ domain comprises at least 90% identity to residues 573-662 of SEQ ID NO: 6 or at least 90% identity to residues 572-661 of SEQ ID NO: 5;wherein the Homer binding domain comprises at least 90% identity to residues 1294-1323 of SEQ ID NO: 5 or 6;wherein the Cortactin binding domain comprises at least 90% identity to residues 1400-1426 of SEQ ID NO: 5 or 6 and/or wherein the SAM domain comprises at least 90% identity to residues 1664-1729 of SEQ ID NO: 6 or at least 90% identity to residues 1663-1728 of SEQ ID NO:5; wherein the amino acid sequence of the Shank3 protein encoded by the polynucleotide is at least 90% identical to the amino acid sequence of any one of SEQ ID NOs: 17-20 or consists of the amino acid sequence of any one of SEQ ID NOs: 17-20, wherein sequence identity is calculated using the Needleman-Wunsch algorithm; and wherein the polynucleotide is less than 4.7 kb. Claim 1 of ‘554 application: A method of delivering a human miniShank3 protein to the central nervous system (CNS) of a subject in need thereof, said method comprising administering to the CNS of the subject a pharmaceutical composition comprising a recombinant AAV virion comprising: (1) a recombinant AAV vector comprising an expression cassette flanked by inverted terminal repeats (ITRs), wherein the expression cassette comprises a polynucleotide encoding a human miniShank3 protein comprising an amino acid sequence that is at least 90% identical to SEQ ID NO: 18 or SEQ ID NO: 20, operably linked to a human Syn promoter and a polyA signal sequence; and (2) an AAV9 capsid or a capsid having an amino acid sequence that is at least 90% identical or at least 95% identical to SEQ ID NO: 29. Claims of the instant application differ in that they are drawn to a polynucleotide encoding a human Shank3 protein (SEQ ID NO: 18) and the 554’ application is drawn to a method of delivering a human shank3 protein using a AAV vector comprising a polynucleotide encoding human shank3 protein comprising the amino acid sequence of SEQ ID NO: 18. The Examiner notes that the SEQ ID NO: 18 from the instant application and the ‘554 application is 100% identical. The instant application further claims an AAV vector comprising said polynucleotide, and methods of administering said AAV vector to a subject with neurodevelopmental disorder, all of which significantly overlap in scope with the claims of ‘554 application. All of the limitations of the dependent claims are also disclosed in the specification of ‘554 application. Taken together, it would have been obvious for a person of ordinary skill in the art (POSITA) to practice the methods of ‘554 application using said polynucleotide/AAV vectors/methods of the instant claims. A POSITA would have been motivated to practice such because both applications are drawn to virtually identical subject matter for the use of human shank3 protein for methods of treating neurodevelopmental disorders. A POSITA would have had a reasonable expectation of success based on the teachings of instant application and the ‘554 application since all of the required biochemical reagents and techniques are disclosed therein. Claims 1-4, 6, 9, 16, 19-20, 23, 27-28 and 80-98 are provisionally rejected on the ground of nonstatutory obviousness-type double patenting as being unpatentable over claims 1-29 of copending Application No. 19378942. This is a provisional obviousness-type double patenting rejection because the conflicting claims have not in fact been patented. Claim 1 of the instant application: A non-naturally occurring polynucleotide encoding a Shank3 protein, wherein the Shank3 protein comprises an SH3 domain, a PDZ domain, a Homer binding domain, a Cortactin binding domain, and a SAM domain; wherein the SH3 domain comprises at least 90% identity to residues 474-525 of SEQ ID NO: 6 or at least 90% identity to residues 473-524 of SEQ ID NO: 5;wherein the PDZ domain comprises at least 90% identity to residues 573-662 of SEQ ID NO: 6 or at least 90% identity to residues 572-661 of SEQ ID NO: 5;wherein the Homer binding domain comprises at least 90% identity to residues 1294-1323 of SEQ ID NO: 5 or 6;wherein the Cortactin binding domain comprises at least 90% identity to residues 1400-1426 of SEQ ID NO: 5 or 6 and/or wherein the SAM domain comprises at least 90% identity to residues 1664-1729 of SEQ ID NO: 6 or at least 90% identity to residues 1663-1728 of SEQ ID NO:5; wherein the amino acid sequence of the Shank3 protein encoded by the polynucleotide is at least 90% identical to the amino acid sequence of any one of SEQ ID NOs: 17-20 or consists of the amino acid sequence of any one of SEQ ID NOs: 17-20, wherein sequence identity is calculated using the Needleman-Wunsch algorithm; and wherein the polynucleotide is less than 4.7 kb. Claim 1 of ‘942 application: A method of treating an autism spectrum disorder (ASD) or Phelan-McDermid syndrome in a primate subject in need thereof, the method comprising administering to the primate subject a therapeutically effective amount of a composition comprising an AAV vector, wherein the AAV vector comprises a polynucleotide encoding a Shank3 protein. Claims of the instant application differ in that they are drawn to a polynucleotide encoding a human Shank3 protein (SEQ ID NO: 18) and the 942’ application is drawn to a method of treating an autism by administering a human shank3 protein using a AAV vector comprising a polynucleotide encoding human shank3 protein comprising the amino acid sequence of SEQ ID NO: 18. The Examiner notes that the SEQ ID NO: 18 from the instant application and the ‘942 application is 100% identical. The instant application further claims an AAV vector comprising said polynucleotide, and methods of administering said AAV vector to a subject with neurodevelopmental disorder including autism (see claim 29 of the instant application), all of which significantly overlap in scope with the claims of ‘942 application. All of the limitations of the dependent claims are also disclosed in the specification of ‘942 application. Taken together, it would have been obvious for a person of ordinary skill in the art (POSITA) to practice the methods of ‘942 application using said polynucleotide/AAV vectors/methods of the instant claims. A POSITA would have been motivated to practice such because both applications are drawn to virtually identical subject matter for the use of human shank3 protein for methods of treating neurodevelopmental disorders including autism. A POSITA would have had a reasonable expectation of success based on the teachings of instant application and the ‘942 application since all of the required biochemical reagents and techniques are disclosed therein. Conclusion Claims 1-4, 6, 9, 16, 19-20, 23, 27-28 and 80-98 are rejected for the reasons as stated above. Applicants must respond to the objections/rejections in this Office action to be fully responsive in prosecution. THIS ACTION IS MADE FINAL. Applicant is reminded of the extension of time policy as set forth in 37 CFR 1.136(a). A shortened statutory period for reply to this final action is set to expire THREE MONTHS from the mailing date of this action. In the event a first reply is filed within TWO MONTHS of the mailing date of this final action and the advisory action is not mailed until after the end of the THREE-MONTH shortened statutory period, then the shortened statutory period will expire on the date the advisory action is mailed, and any extension fee pursuant to 37 CFR 1.136(a) will be calculated from the mailing date of the advisory action. In no event, however, will the statutory period for reply expire later than SIX MONTHS from the mailing date of this final action. Any inquiry concerning this communication or earlier communications from the examiner should be directed to JAE W LEE whose telephone number is (571)272-9949. The examiner can normally be reached on M-F between 9:00-6:00. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Manjunath Rao can be reached on (571)272-0939. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of an application may be obtained from the Patent Application Information Retrieval (PAIR) system. Status information for published applications may be obtained from either Private PAIR or Public PAIR. Status information for unpublished applications is available through Private PAIR only. For more information about the PAIR system, see http://pair-direct.uspto.gov. Should you have questions on access to the Private PAIR system, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative or access to the automated information system, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /JAE W LEE/ Examiner, Art Unit 1656 /MANJUNATH N RAO/Supervisory Patent Examiner, Art Unit 1656 (n.r.)
Read full office action

Prosecution Timeline

Feb 16, 2023
Application Filed
Apr 21, 2026
Examiner Interview (Telephonic)
May 01, 2026
Non-Final Rejection mailed — §102, §112, §DP
Aug 03, 2026
Response Filed
Sep 14, 2026
Examiner Interview (Telephonic)
Sep 18, 2026
Final Rejection mailed — §102, §112, §DP (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12747464
METHOD FOR THE BIOSYNTHESIS OF DIOSMIN AND/OR HESPERIDIN IN A MICROORGANISM
2y 4m to grant Granted Sep 29, 2026
Patent 12734213
ANTIVIRAL COMPOSITIONS AND METHODS
3y 10m to grant Granted Sep 15, 2026
Patent 12735715
NOVEL PROMOTER AND USE THEREOF
2y 10m to grant Granted Sep 15, 2026
Patent 12735725
ALTERING TISSUE TROPISM OF ADENO-ASSOCIATED VIRUSES
2y 5m to grant Granted Sep 15, 2026
Patent 12703866
ENGINEERED MICROORGANISMS
3y 2m to grant Granted Aug 11, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

Strategy Recommendation AI-generated — please review before filing

Get a prosecution strategy drawn from examiner precedents, rejection analysis, and claim mapping.
Typically takes 5-10 seconds — AI-generated, attorney review required before filing

Prosecution Projections

3-4
Expected OA Rounds
66%
Grant Probability
99%
With Interview (+38.6%)
3y 4m (~0m remaining)
Median Time to Grant
Moderate
PTA Risk
Based on 421 resolved cases by this examiner. Grant probability derived from career allowance rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month