Prosecution Insights
Last updated: April 19, 2026
Application No. 18/031,731

ANTIBODY-DRUG CONJUGATE AND APPLICATION THEREOF

Non-Final OA §DP
Filed
Apr 13, 2023
Examiner
HADDAD, MAHER M
Art Unit
1641
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
Keymed Biosciences Co. Ltd.
OA Round
1 (Non-Final)
50%
Grant Probability
Moderate
1-2
OA Rounds
3y 1m
To Grant
99%
With Interview

Examiner Intelligence

Grants 50% of resolved cases
50%
Career Allow Rate
525 granted / 1042 resolved
-9.6% vs TC avg
Strong +54% interview lift
Without
With
+54.2%
Interview Lift
resolved cases with interview
Typical timeline
3y 1m
Avg Prosecution
51 currently pending
Career history
1093
Total Applications
across all art units

Statute-Specific Performance

§101
0.7%
-39.3% vs TC avg
§103
38.8%
-1.2% vs TC avg
§102
10.8%
-29.2% vs TC avg
§112
15.1%
-24.9% vs TC avg
Black line = Tech Center average estimate • Based on career data from 1042 resolved cases

Office Action

§DP
DETAILED ACTION 1. The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . 2 Applicant's amendment, filed on 05/15/2025, is acknowledged. 3. Claims 1, 8, 12 and 18-30 are pending and under examination. 4. Applicant’s IDS, filed 05/23/2023, 08/12/2024, 05/15/2025, 05/28/25 and 07/15/2025, is acknowledged. 5. The nonstatutory double patenting rejection is based on a judicially created doctrine grounded in public policy (a policy reflected in the statute) so as to prevent the unjustified or improper timewise extension of the “right to exclude” granted by a patent and to prevent possible harassment by multiple assignees. A nonstatutory double patenting rejection is appropriate where the conflicting claims are not identical, but at least one examined application claim is not patentably distinct from the reference claim(s) because the examined application claim is either anticipated by, or would have been obvious over, the reference claim(s). See, e.g., In re Berg, 140 F.3d 1428, 46 USPQ2d 1226 (Fed. Cir. 1998); In re Goodman, 11 F.3d 1046, 29 USPQ2d 2010 (Fed. Cir. 1993); In re Longi, 759 F.2d 887, 225 USPQ 645 (Fed. Cir. 1985); In re Van Ornum, 686 F.2d 937, 214 USPQ 761 (CCPA 1982); In re Vogel, 422 F.2d 438, 164 USPQ 619 (CCPA 1970); In re Thorington, 418 F.2d 528, 163 USPQ 644 (CCPA 1969). A timely filed terminal disclaimer in compliance with 37 CFR 1.321(c) or 1.321(d) may be used to overcome an actual or provisional rejection based on nonstatutory double patenting provided the reference application or patent either is shown to be commonly owned with the examined application, or claims an invention made as a result of activities undertaken within the scope of a joint research agreement. See MPEP § 717.02 for applications subject to examination under the first inventor to file provisions of the AIA as explained in MPEP § 2159. See MPEP § 2146 et seq. for applications not subject to examination under the first inventor to file provisions of the AIA . A terminal disclaimer must be signed in compliance with 37 CFR 1.321(b). The filing of a terminal disclaimer by itself is not a complete reply to a nonstatutory double patenting (NSDP) rejection. A complete reply requires that the terminal disclaimer be accompanied by a reply requesting reconsideration of the prior Office action. Even where the NSDP rejection is provisional the reply must be complete. See MPEP § 804, subsection I.B.1. For a reply to a non-final Office action, see 37 CFR 1.111(a). For a reply to final Office action, see 37 CFR 1.113(c). A request for reconsideration while not provided for in 37 CFR 1.113(c) may be filed after final for consideration. See MPEP §§ 706.07(e) and 714.13. The USPTO Internet website contains terminal disclaimer forms which may be used. Please visit www.uspto.gov/patent/patents-forms. The actual filing date of the application in which the form is filed determines what form (e.g., PTO/SB/25, PTO/SB/26, PTO/AIA /25, or PTO/AIA /26) should be used. A web-based eTerminal Disclaimer may be filled out completely online using web-screens. An eTerminal Disclaimer that meets all requirements is auto-processed and approved immediately upon submission. For more information about eTerminal Disclaimers, refer to www.uspto.gov/patents/apply/applying-online/eterminal-disclaimer. 6. Claims 1, 8, 12 and 18-30 are provisionally rejected on the ground of nonstatutory double patenting as being unpatentable over claims 2-5, 9, 19-33 of copending Application No. 17604735 (reference application). Although the claims at issue are not identical, they are not patentably distinct from each other because the claims of the `735 are directed to anti-human Claudin 18.2 comprising the VH of SEQ ID NO: 231 and VL of SEQ I DNO: 261 comprising the claimed CDRs (see sequence alignment below). The `735 applicant also claims a conjugate comprising the antibody attached to a cytotoxic drug (see referenced claims 9, 19-22, 24 and 27-33). The specification of the `735 discloses the coupling (i.e., physically linking) to conjugate the antibody to a detectable substance (see page 31 top ¶). It would have been obvious to one skilled in the art to link the antibody to the cytotoxic. Alignment of VH of referenced/claimed SEQ ID NO: 231/41 and 65 comprising claims SEQ ID NO: 24-43-44. Qy 1 GGSISSNYAWN--------------YIYYSGNTNYNPSLKS------------------- 27 ||||||||||| |||||||||||||||| Db 26 GGSISSNYAWNWIRQPPGKGLEWIGYIYYSGNTNYNPSLKSRVTISRDTSKNQFSLKLSS 85 Qy 28 -------------SYYGNSFIY 36 ||||||||| Db 86 VTAADTAVYYCATSYYGNSFIY 107 Alignment of VH of referenced/claimed SEQ ID NO: 261/116 and 65 comprising claims SEQ ID NO: 50-52. Qy 1 KSSQSLLNSGNQKNYLT---------------WASTRES--------------------- 24 ||||||||||||||||| ||||||| Db 24 KSSQSLLNSGNQKNYLTWYQQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTLTISS 83 Qy 25 -----------QNAYSFPWT 33 ||||||||| Db 84 LQAEDVAVYYCQNAYSFPWT 103 The claims of the `735 renders the instant claims obvious. This is a provisional nonstatutory double patenting rejection because the patentably indistinct claims have not in fact been patented. 7. Claims 1, 8, 12 and 18-30 are provisionally rejected on the ground of nonstatutory double patenting as being unpatentable over claims 1-18 of copending Application No. 18910550 (reference application). Although the claims at issue are not identical, they are not patentably distinct from each other because the claims of the `550 are directed to antibody-drug conjugate which has the structure shown in Formula Ab-(L-D)p comprising the anti-human Claudin 18.2 comprising 100% identical VH of SEQ ID NO: 61/61 and VL of SEQ I DNO: 49/66 comprising the claimed CDRs (see sequence alignment below), a linker and a cytotoxic agent. Alignment of VL referenced/claimed SEQ ID NO: 65 and claims SEQ ID NO: 42-43-44. Qy 1 GGSISSNYAWN--------------YIYYSGNTNYNPSLKS------------------- 27 ||||||||||| |||||||||||||||| Db 26 GGSISSNYAWNWIRQPPGKGLEWIGYIYYSGNTNYNPSLKSRVTISRDTSKNQFSLKLSS 85 Qy 28 -------------SYYGNSFIY 36 ||||||||| Db 86 VTAADTAVYYCATSYYGNSFIY 107 Alignment of VL referenced/claimed SEQ ID NO: 49/66 and claims SEQ ID NO: 50-51-52. Qy 1 KSSQSLLNSGNQKNYLT---------------WASTRES--------------------- 24 ||||||||||||||||| ||||||| Db 24 KSSQSLLNSGNQKNYLTWYQQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTLTISS 83 Qy 25 -----------QNAYSFPWT 33 ||||||||| Db 84 LQAEDVAVYYCQNAYSFPWT 103 The claims of the `550 application anticipate the instant claims. This is a provisional nonstatutory double patenting rejection because the patentably indistinct claims have not in fact been patented. 8. Claims 1, 8, 12 and 18-30 are provisionally rejected on the ground of nonstatutory double patenting as being unpatentable over claims 1-4, 6-7, 9-19, 2426, 28-31 of copending Application No. 18927411 (reference application). Although the claims at issue are not identical, they are not patentably distinct from each other because the claims of the `411 are directed to method of using antibody-drug conjugate which has the structure shown in Formula Ab-(L-D)p comprising the anti-human Claudin 18.2 comprising 100% identical VH of claimed/referenced SEQ ID NO: 7/65 (41) and VL of claimed/referenced SEQ I DNO: 8/66(49) comprising the claimed CDRs, a linker and a cytotoxic agent. The claims of the `411 applicant anticipate the instant claims. This is a provisional nonstatutory double patenting rejection because the patentably indistinct claims have not in fact been patented. 9. No claim is allowed. 10. The prior art made of record and not relied upon is considered pertinent to applicant's disclosure. Singh et al. Anti-claudin 18.2 antibody as new targeted therapy for advanced gastric cancer. J Hematol Oncol. 2017 May 12;10(1):105. 11. Any inquiry concerning this communication or earlier communications from the examiner should be directed to MAHER M HADDAD whose telephone number is (571)272-0845. The examiner can normally be reached on Monday-Friday from7:00AM to 4:30PM. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Misook Yu, can be reached at telephone number 571-272-0839. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of an application may be obtained from Patent Center. Status information for published applications may be obtained from Patent Center. Status information for unpublished applications is available through Patent Center for authorized users only. Should you have questions about access to Patent Center, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) Form at https://www.uspto.gov/patents/uspto-automated- interview-request-air-form. November 10, 2025 /MAHER M HADDAD/ Primary Examiner, Art Unit 1644
Read full office action

Prosecution Timeline

Apr 13, 2023
Application Filed
May 15, 2025
Response after Non-Final Action
Nov 11, 2025
Non-Final Rejection — §DP (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12600770
ANTIBODIES TO CONNECTIVE TISSUE GROWTH FACTOR (CTGF) AND USES THEREOF
2y 5m to grant Granted Apr 14, 2026
Patent 12590166
CD20 BINDING MOLECULES AND USES THEREOF
2y 5m to grant Granted Mar 31, 2026
Patent 12590157
METHODS OF TREATING GASTROINTESTINAL IMMUNE-RELATED ADVERSE EVENTS IN IMMUNE ONCOLOGY TREATMENTS
2y 5m to grant Granted Mar 31, 2026
Patent 12590144
CARDIAC TROPONIN I SPECIFIC ANTIBODY, KIT AND USES THEREOF
2y 5m to grant Granted Mar 31, 2026
Patent 12577310
CANINIZED ANTIBODIES TO CANINE INTERLEUKIN-31 RECEPTOR ALPHA
2y 5m to grant Granted Mar 17, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

AI Strategy Recommendation

Get an AI-powered prosecution strategy using examiner precedents, rejection analysis, and claim mapping.
Powered by AI — typically takes 5-10 seconds

Prosecution Projections

1-2
Expected OA Rounds
50%
Grant Probability
99%
With Interview (+54.2%)
3y 1m
Median Time to Grant
Low
PTA Risk
Based on 1042 resolved cases by this examiner. Grant probability derived from career allow rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month