Prosecution Insights
Last updated: April 19, 2026
Application No. 18/037,918

GENETICALLY ENGINEERED BACTERIUM CAPABLE OF PRODUCING CYTOKININS WITH ISOPRENOID SIDE CHAINS

Non-Final OA §103
Filed
May 19, 2023
Examiner
PAK, YONG D
Art Unit
1652
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
Acies Bio D O O
OA Round
1 (Non-Final)
74%
Grant Probability
Favorable
1-2
OA Rounds
3y 0m
To Grant
88%
With Interview

Examiner Intelligence

Grants 74% — above average
74%
Career Allow Rate
685 granted / 924 resolved
+14.1% vs TC avg
Moderate +14% lift
Without
With
+14.0%
Interview Lift
resolved cases with interview
Typical timeline
3y 0m
Avg Prosecution
55 currently pending
Career history
979
Total Applications
across all art units

Statute-Specific Performance

§101
7.0%
-33.0% vs TC avg
§103
21.0%
-19.0% vs TC avg
§102
21.8%
-18.2% vs TC avg
§112
32.6%
-7.4% vs TC avg
Black line = Tech Center average estimate • Based on career data from 924 resolved cases

Office Action

§103
Notice of Pre-AIA or AIA Status The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . DETAILED ACTION This application is a 371 of PCT/EP2021/083188. The response filed on December 19, 2025 has been entered. Election/Restrictions Applicant’s election without traverse of Group I with a species election of (1) Bacillus subtilis as the gram-positive microorganism, (2) SEQ ID NO:7 as the polypeptide having adenylate isopentenyltransferase, (3) LOG (cytokinin riboside 5’-monophosphate phosphoribohydrolase) from C. glutamicum (gene Cgl2379, UniProt Q8NN34), SEQ ID NO:34, DXS (1-deoxy-D-xylulose-5-phospahte synthase) from B. subtilis, SEQ ID NO:63, PurA (adenylosuccinate synthase) from B. subtilis (gene purA), and CYP450 monooxygenase (cytochrome P450 monooxygenase) from Rhodococcus fascians SEQ ID NO:93 as the polypeptides whose expression or activity in increase, and (4) (a) purine nucleotide degradation pathway of purine nucleoside phosphorylase (PNP) encoded by deoD and adenosine phosphoribosyltransferase (APRT) encoded by apt and (b) guanosine monophosphate biosynthesis pathway of IMP dehydrogenase encoded by guaB and GMP synthetase encoded by guaA as the polypeptides whose expression or activity is decreased in the reply filed on December 19, 2025 is acknowledged. Claims 50-52 are withdrawn from further consideration pursuant to 37 CFR 1.142(b) as being drawn to a nonelected invention, there being no allowable generic or linking claim. Election was made without traverse in the reply filed on December 19, 2025. Applicants request for rejoinder has been noted. Status of Claims Claims 1 and 34-52 are pending. Claims 50-52 are withdrawn. Claims 1 and 34-49 are under examination. Information Disclosure Statement The information disclosure statement (IDS) submitted on May 26, 2022 is in compliance with the provisions of 37 CFR 1.97. Accordingly, the information disclosure statement is being considered by the examiner. Priority Acknowledgment is made of applicant’s claim for foreign priority under 35 U.S.C. 119 (a)-(d). Receipt is acknowledged of certified copies of papers required by 37 CFR 1.55. Nucleotide and/or Amino Acid Sequence Disclosures REQUIREMENTS FOR PATENT APPLICATIONS CONTAINING NUCLEOTIDE AND/OR AMINO ACID SEQUENCE DISCLOSURES Items 1) and 2) provide general guidance related to requirements for sequence disclosures. 37 CFR 1.821(c) requires that patent applications which contain disclosures of nucleotide and/or amino acid sequences that fall within the definitions of 37 CFR 1.821(a) must contain a "Sequence Listing," as a separate part of the disclosure, which presents the nucleotide and/or amino acid sequences and associated information using the symbols and format in accordance with the requirements of 37 CFR 1.821 - 1.825. This "Sequence Listing" part of the disclosure may be submitted: In accordance with 37 CFR 1.821(c)(1) via the USPTO patent electronic filing system (see Section I.1 of the Legal Framework for Patent Electronic System (https://www.uspto.gov/PatentLegalFramework), hereinafter "Legal Framework") as an ASCII text file, together with an incorporation-by-reference of the material in the ASCII text file in a separate paragraph of the specification as required by 37 CFR 1.823(b)(1) identifying: the name of the ASCII text file; ii) the date of creation; and iii) the size of the ASCII text file in bytes; In accordance with 37 CFR 1.821(c)(1) on read-only optical disc(s) as permitted by 37 CFR 1.52(e)(1)(ii), labeled according to 37 CFR 1.52(e)(5), with an incorporation-by-reference of the material in the ASCII text file according to 37 CFR 1.52(e)(8) and 37 CFR 1.823(b)(1) in a separate paragraph of the specification identifying: the name of the ASCII text file; the date of creation; and the size of the ASCII text file in bytes; In accordance with 37 CFR 1.821(c)(2) via the USPTO patent electronic filing system as a PDF file (not recommended); or In accordance with 37 CFR 1.821(c)(3) on physical sheets of paper (not recommended). When a “Sequence Listing” has been submitted as a PDF file as in 1(c) above (37 CFR 1.821(c)(2)) or on physical sheets of paper as in 1(d) above (37 CFR 1.821(c)(3)), 37 CFR 1.821(e)(1) requires a computer readable form (CRF) of the “Sequence Listing” in accordance with the requirements of 37 CFR 1.824. If the "Sequence Listing" required by 37 CFR 1.821(c) is filed via the USPTO patent electronic filing system as a PDF, then 37 CFR 1.821(e)(1)(ii) or 1.821(e)(2)(ii) requires submission of a statement that the "Sequence Listing" content of the PDF copy and the CRF copy (the ASCII text file copy) are identical. If the "Sequence Listing" required by 37 CFR 1.821(c) is filed on paper or read-only optical disc, then 37 CFR 1.821(e)(1)(ii) or 1.821(e)(2)(ii) requires submission of a statement that the "Sequence Listing" content of the paper or read-only optical disc copy and the CRF are identical. Specific deficiencies and the required response to this Office Action are as follows: Specific deficiency – Nucleotide and/or amino acid sequences appearing in the specification are not identified by sequence identifiers in accordance with 37 CFR 1.821(d), see page 29. Required response – Applicant must provide: A substitute specification in compliance with 37 CFR 1.52, 1.121(b)(3) and 1.125 inserting the required sequence identifiers, consisting of: A copy of the previously-submitted specification, with deletions shown with strikethrough or brackets and insertions shown with underlining (marked-up version); A copy of the amended specification without markings (clean version); and A statement that the substitute specification contains no new matter. Specification The disclosure is objected to because it contains an embedded hyperlink and/or other form of browser-executable code, pages 5 and 17, for example. Applicant is required to delete the embedded hyperlink and/or other form of browser-executable code. See MPEP § 608.01. Applicant’s cooperation is requested in reviewing the specification for additional embedded hyperlink and/or other form of browser-executable code that may be present in the specification and making the appropriate correction(s). Claim Rejections - 35 USC § 103 In the event the determination of the status of the application as subject to AIA 35 U.S.C. 102 and 103 (or as subject to pre-AIA 35 U.S.C. 102 and 103) is incorrect, any correction of the statutory basis (i.e., changing from AIA to pre-AIA ) for the rejection will not be considered a new ground of rejection if the prior art relied upon, and the rationale supporting the rejection, would be the same under either status. The following is a quotation of 35 U.S.C. 103 which forms the basis for all obviousness rejections set forth in this Office action: A patent for a claimed invention may not be obtained, notwithstanding that the claimed invention is not identically disclosed as set forth in section 102, if the differences between the claimed invention and the prior art are such that the claimed invention as a whole would have been obvious before the effective filing date of the claimed invention to a person having ordinary skill in the art to which the claimed invention pertains. Patentability shall not be negated by the manner in which the invention was made. This application currently names joint inventors. In considering patentability of the claims the examiner presumes that the subject matter of the various claims was commonly owned as of the effective filing date of the claimed invention(s) absent any evidence to the contrary. Applicant is advised of the obligation under 37 CFR 1.56 to point out the inventor and effective filing dates of each claim that was not commonly owned as of the effective filing date of the later invention in order for the examiner to consider the applicability of 35 U.S.C. 102(b)(2)(C) for any potential 35 U.S.C. 102(a)(2) prior art against the later invention. Claims 1, 34-36, 38, and 48 is/are rejected under 35 U.S.C. 103 as being unpatentable over Ma (Genetic engineering of cytokinins and their application to agriculture. Crit Rev Biotechnol. 2008;28(3):213-32. – form PTO-1449) and Schumann (Production of recombinant proteins in Bacillus subtilis. Adv Appl Microbiol. 2007;62:137-89 – form PTO-892). Ma discloses that cytokinins are a class of plant hormones and are involved in plant growth and development (page 213, 1st paragraph). Ma discloses the cytokinin biosynthesis pathway in bacteria (FIG. 2 at page 215). Ma discloses that this pathway is called the de novo synthetic pathway (page 214, left column). Ma discloses that the initial step in the de novo biosynthesis of cytokinin is the formation of isopentenyladenosine 5’monophosphate (iPMP) from DMAPP and AMP, ADP or ATP, which is catalyzed by IPT (also known as adenylate isopentenyltransferase) (page 214 and FIG.2). Ma discloses that IPT is the rate-limiting enzyme and is likely the control point for cytokinin synthesis (page 214, right column). Regarding claim 1, Ma discloses E. coli expressing IPT resulted in production of cytokinins iP and zeatin (page 215). Regarding claim 38, Ma discloses a LOG gene that encodes a cytokinin-activating enzyme (cytokinin riboside 5'-monophosphate phosphoribohydrolase) that works in the final step of cytokinin biosynthesis that converts cytokinin nucleotide (iPMP, iPDP, iPTP,tZMP, tZDP and tZTP) to the nucleoside and the free-base form, which are biologically active (page 216, 3rd full paragraph). Regarding claim 48, Ma discloses that co-expression of IPT and a P450 monooxygenase enabled yeast to produce trans-zeatin (page 216, 2nd full paragraph). Ma does not disclose a gram-positive bacterium or B. subtilis expressing IPT, LOG, and P450 monooxygenase. However, production of heterologous enzymes in Bacillus subtilis, a Gram-positive bacterium, was well established in the art, as discussed below. Regarding claims 34-36, Schumann discloses that B. subtilis has advantages over host cells, such as E. coli, because B. subtilis (1) is nonpathogenic, (2) secretes proteins efficiently, (3) it does not produce any endotoxin, (4) has been granted a GRAS status, (5) has no significant bias in codon usage, and (6) a great deal of vital information concerning its transcription and translation mechanisms, genetic manipulation, and large-scale fermentation has been acquired (page 139, top). Schuman discloses methods of increasing expressing heterologous enzymes in B. subtilis (Sections II and III). Therefore, in combining the above references, it would have been obvious to one having ordinary skill in the art before the time the claimed invention was effectively filed to increase expression of IPT, LOG, and cytochrome P450 monooxygenase in Bacillus subtilis. One having ordinary skill in the art would have been motivated to do so in order to produce cytokinins, such as trans-zeatin, in a nonpathogenic and GRAS host cell. One having ordinary skill in the art would have had a reasonable expectation of success since Ma discloses cytokinin biosynthesis pathway in bacteria, E. coli expressing of a heterologous IPT, and expression of LOG and P450 monooxygenase in cytokinin biosynthesis and Schumann discloses increasing expression of heterologous enzymes in Bacillus subtilis. Therefore, the above references render claims 1, 34-36, 38, and 48 prima facie obvious. Claim(s) 37, 39, and 49 is/are rejected under 35 U.S.C. 103 as being unpatentable over Ma (Genetic engineering of cytokinins and their application to agriculture. Crit Rev Biotechnol. 2008;28(3):213-32. – form PTO-1449) and Schumann (Production of recombinant proteins in Bacillus subtilis. Adv Appl Microbiol. 2007;62:137-89 – form PTO-892) as applied to claims 1, 34-36, 38, and 48 above, and further in view of P58592 (UniProtKB/Swiss-Prot Database. May 8, 2019. – form PTO-892), Q8NN34 (UniProtKB/TrEMBL Database. October 16, 2019 – form PTO-892), and P46373 (UniProtKB/Swiss-Prot Database. May 8, 2019 – form PTO-892). Ma and Schumann do not teach the IPT recited in claim 37, the LOG recited in claim 39, and the cytochrome P450 monooxygenase recited in claim 49. However, all these enzymes were known in the art. Regarding claim 37, P58592 discloses an IPT having 100% sequence identity to the IPT of SEQ INO:7 (pages 1-2 and see the sequence alignment below). Regarding claim 39, Q8NN34 discloses a cytokinin riboside 5'-monophosphate phosphoribohydrolase having 100% sequence identity to the LOG of SEQ ID NO:34 of the instant application (pages 1-2 and see the sequence alignment below). Regarding claim 49, P46373 discloses a cytochrome P450 monooxygenase having 100% sequence identity to the cytochrome P450 monooxygenase of SEQ ID NO:93 of the instant application (pages 1-2 and see the sequence alignment below). Therefore, in combing the above teachings, it would have been obvious to one having ordinary skill in the art at the time the claimed invention was effectively filed to replacing the IPT, LOG, and cytochrome P450 monooxygenase with other known IPT, LOG, and cytochrome P450 monooxygenase because one of ordinary skill in the art would have been able to carry out such a substitution, and the results were reasonably predictable. Further, the normal desire of scientists or artisans to improve upon what is already generally known provides the motivation to substitute other known IPT, LOG, and cytochrome P450 monooxygenase. The rationale to support a conclusion that the claims would have been obvious is that the substitution of one known element (IPT, LOG, and cytochrome P450 monooxygenase) for another yields predictable results (catalyzing AMP + DMAPP to iPMP, catalyzing the final step of cytokinin biosynthesis, and catalyzing production of trans-zeatin) to one of ordinary skill in the art. Therefore, it would have been obvious to one of ordinary skill in the art to replace the prior art IPT, LOG, and cytochrome P450 monooxygenase with another known and available cytokinin biosynthesis enzyme, such as the IPT of P58592, LOG of Q8NN34, and cytochrome P450 monooxygenase of P46373. One having ordinary skill in the art would have had a reasonable expectation of success since Ma discloses cytokinin biosynthesis pathway in bacteria, E. coli expressing of a heterologous IPT, and expression of LOG and P450 monooxygenase in cytokinin biosynthesis, Schumann discloses increasing expression of heterologous enzymes in Bacillus subtilis, and IPT of P58592, LOG of Q8NN34, and cytochrome P450 monooxygenase of P46373 were known in the prior art. Therefore, the above references render claims 1, 34-39, and 48-49 prima facie obvious. Claim(s) 40-43 is/are rejected under 35 U.S.C. 103 as being unpatentable over Ma (Genetic engineering of cytokinins and their application to agriculture. Crit Rev Biotechnol. 2008;28(3):213-32. – form PTO-1449) and Schumann (Production of recombinant proteins in Bacillus subtilis. Adv Appl Microbiol. 2007;62:137-89 – form PTO-892) as applied to claims 1, 34-36, 38, and 48 above, and further in view of Julsing (Functional analysis of genes involved in the biosynthesis of isoprene in Bacillus subtilis. Appl Microbiol Biotechnol. 2007 Jul;75(6):1377-84 – form PTO-1449), Hecht (Enzyme-assisted preparation of isotope-labeled 1-deoxy-d-xylulose 5-phosphate. J Org Chem. 2001 Jun 1;66(11):3948-52 – form PTO-892), Wang (Directed evolution of adenylosuccinate synthetase from Bacillus subtilis and its application in metabolic engineering. J Biotechnol. 2016 Aug 10;231:115-121. Epub 2016 May 24 – form PTO-1449). Ma and Schuman do not disclose increasing the expression of DSX (1-deoxy-D-xylulose-5-phospahte synthase) nor PurA. Regarding claim 40, Julsing discloses DMADP (synonymous with DMAPP) is produced in the mevalonate pathway (page 1378, 1st full paragraph). DMAPP is the substrate of IPT (see Ma above). Julsing references Hecht for the teaching of a Bacillus subtilis DXS (page 1382, 1st full paragraph). Regarding claim 41, Hecht discloses Bacillus subtilis DXS of accession D84432 having 100% sequence identity to the DXS of SEQ ID NO:63 of the instant application (page 3951, 3rd full paragraph and see the sequence alignment below). Regarding claims 42-43, Wang discloses a Bacillus subtilis adenylsoccuiante synthase encoded by purA that catalyzes the first step of the conversion of IMP to AMP of the purine biosynthesis pathway in Bacillus subtilis (abstract, Section 2 and table 1). AMP is the substrate of IPT (see Ma above). Therefore, in combining the above references, it would have been obvious to one having ordinary skill in the art before the time the claimed invention was effectively filed to increase expression of DXS and PurA in Bacillus subtilis expressing IPT, LOG, and cytochrome P450 monooxygenase. One having ordinary skill in the art would have been motivated to do so in order to increase the precursors of cytokinin production and thereby increasing production of cytokinins, such as trans-zeatin One having ordinary skill in the art would have had a reasonable expectation of success since Ma discloses cytokinin biosynthesis pathway in bacteria, E. coli expressing of a heterologous IPT, and expression of LOG and P450 monooxygenase in cytokinin biosynthesis, Schumann discloses increasing expression of heterologous enzymes in Bacillus subtilis, Julsing and Hecht disclose a Bacillus subtilis DXS, Wang discloses a Bacillus subtilis PurA, and Liu discloses a system for deletion of multiple genes in Bacillus subtilis. Therefore, the above references render claims 1, 34-36, 38, 40-43, and 48 prima facie obvious. Claim(s) 44-45 is/are rejected under 35 U.S.C. 103 as being unpatentable over Ma (Genetic engineering of cytokinins and their application to agriculture. Crit Rev Biotechnol. 2008;28(3):213-32. – form PTO-1449) and Schumann (Production of recombinant proteins in Bacillus subtilis. Adv Appl Microbiol. 2007;62:137-89 – form PTO-892) as applied to claims 1, 34-36, 38, and 48 above, and further in view of Zhang (Adenine phosphoribosyl transferase 1 is a key enzyme catalyzing cytokinin conversion from nucleobases to nucleotides in Arabidopsis. Mol Plant. 2013 Sep;6(5):1661-72 – form PTO-892), Ashihara (Purine nucleoside phosphorylases: properties, functions, and clinical aspects, Pharmacology & Therapeutics, Volume 88, Issue 3, 2000, Pages 349-425 – form PTO-892), O34443 (GenPept Database. April 10, 2019 – form PTO), AAB72065 (GenBank Database. July 24, 2016 – form PTO-892), and Liu (Introduction of marker-free deletions in Bacillus subtilis using the AraR repressor and the ara promoter. Microbiology (Reading). 2008 Sep;154(Pt 9):2562-2570 – form PTO-892). Ma and Schuman do not disclose decreasing expression or activity of endogenous adenosine phosphoribosyltransferase encoded by apt and endogenous purine nucleotide phosphorylase encoded by deoD, which are enzymes of the purine nucleotide degradation pathway. Regarding claims 44-45, Zhang discloses that adenosine phosphoribosyltransferase catalyzes the cytoknin conversion from free bases (active form) to nucleotides and loss of adenosine phosphoribosyltransferase leads to excess accumulation of cytokinin bases (abstract). Ashihara discloses that nucleotide phosphorylase is involved in cytokinin metabolism (Section 3.4 at pages 99-100). O34443 discloses Bacillus subtilis adenosine phosphoribosyltransferase (APRT) encoded by apt (pages 1-2). AAB72065 discloses Bacillus subtilis purine nucleotide phosphorylase encoded by deoD (pages 1-2). Liu discloses a system for deletion of multiple genes in Bacillus subtilis (abstract page 2563, 2nd full paragraph). Therefore, in combining the above references, it would have been obvious to one having ordinary skill in the art before the time the claimed invention was effectively filed to decrease expression or activity of apt and deoD in Bacillus subtilis expressing IPT, LOG, and cytochrome P450 monooxygenase. One having ordinary skill in the art would have been motivated to do so in order to increase production of cytokinin. One having ordinary skill in the art would have had a reasonable expectation of success since Ma discloses cytokinin biosynthesis pathway in bacteria, E. coli expressing of a heterologous IPT, and expression of LOG and P450 monooxygenase in cytokinin biosynthesis, Schumann discloses increasing expression of heterologous enzymes in Bacillus subtilis, Bacillus subtilis apt and deoD were known in the art, and Liu discloses a system for deletion of multiple genes in Bacillus subtilis. Therefore, the above references render claims 1, 34-36, 38, 44-45, and 48 prima facie obvious. Claim(s) 46-47 is/are rejected under 35 U.S.C. 103 as being unpatentable over Ma (Genetic engineering of cytokinins and their application to agriculture. Crit Rev Biotechnol. 2008;28(3):213-32. – form PTO-1449) and Schumann (Production of recombinant proteins in Bacillus subtilis. Adv Appl Microbiol. 2007;62:137-89 – form PTO-892) as applied to claims 1, 34-36, 38, and 48 above, and further in view of Wang (Directed evolution of adenylosuccinate synthetase from Bacillus subtilis and its application in metabolic engineering. J Biotechnol. 2016 Aug 10;231:115-121. Epub 2016 May 24 – form PTO-1449), NP_387890 (GenPept Database. Septemer 18, 2018 – form PTO-892), NP_388517 (GenPept Database. September 18, 2018 – form PTO-892, and Liu (Introduction of marker-free deletions in Bacillus subtilis using the AraR repressor and the ara promoter. Microbiology (Reading). 2008 Sep;154(Pt 9):2562-2570 – form PTO-892). Ma and Schuman do not disclose decreasing expression or activity of endogenous IMP dehydrogenase encoded by guaB and endogenous GMP synthetase encoded by gauA, which are enzymes of the guanosine monophosphate biosynthesis. Regarding claims 46-47, Wang discloses that inactivation of IMP dehydrogenase in Bacillus subtilis increases production of IMP, which is precursor to AMP, substrate of cytokinin synthesis (page 120, 3rd full paragraph and Fig. 1). Wang discloses that IMP is converted to XMP by guaB and XMP is converted to GMP by guaA (Fig. 1). NP_387890 discloses Bacillus subtilis IMP dehydrogenase encoded by guaA (pages 1-2). NP_388517 discloses Bacillus subtilis GMP synthetase encoded by guaA (pages 1-2). Liu discloses a system for deletion of multiple genes in Bacillus subtilis (abstract page 2563, 2nd full paragraph). Therefore, in combining the above references, it would have been obvious to one having ordinary skill in the art before the time the claimed invention was effectively filed to decrease expression or activity of guaB and guaA in Bacillus subtilis. One having ordinary skill in the art would have been motivated to do so in order to increase production of cytokinin by increasing production of IMP and thereby AMP, precursors to cytokinin synthesis. One having ordinary skill in the art would have had a reasonable expectation of success since Ma discloses cytokinin biosynthesis pathway in bacteria and E. coli expressing of a heterologous IPT, Schumann discloses increasing expression of heterologous enzymes in Bacillus subtilis, Bacillus subtilis guaB and guaA were known in the art, and and Liu discloses a system for deletion of multiple genes in Bacillus subtilis. Therefore, the above references render claims 1, 34-36, 38, 46-47, and 48 prima facie obvious. Conclusion Claims 1 and 34-52 are pending. Claims 50-52 are withdrawn. Claims 1 and 34-49 are rejected. Any inquiry concerning this communication or earlier communications from the examiner should be directed to YONG D PAK whose telephone number is (571)272-0935. The examiner can normally be reached M-Th: 5:30 am - 3:30 pm. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Robert Mondesi can be reached on 408-918-7584. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /YONG D PAK/Primary Examiner, Art Unit 1652 Sequence alignment between the IPT of SEQ ID NO:7 of the instant application (“Qy”) and the IPT of P58592 (“Db”) PT_RALN1 ID IPT_RALN1 Reviewed; 238 AA. AC P58592; DT 23-JAN-2002, integrated into UniProtKB/Swiss-Prot. DT 23-JAN-2002, sequence version 1. DT 09-APR-2025, entry version 116. DE RecName: Full=Adenylate dimethylallyltransferase; DE EC=2.5.1.27; DE AltName: Full=Dimethylallyl transferase; DE AltName: Full=Isopentenyl transferase; DE AltName: Full=Trans-zeatin producing protein; GN Name=tzs; OrderedLocusNames=RSp1225; ORFNames=RS03169; OS Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000) (Ralstonia OS solanacearum). OG Plasmid megaplasmid Rsp. OC Bacteria; Pseudomonadati; Pseudomonadota; Betaproteobacteria; OC Burkholderiales; Burkholderiaceae; Ralstonia; OC Ralstonia solanacearum species complex. OX NCBI_TaxID=267608; RN [1] RP NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. RC STRAIN=ATCC BAA-1114 / GMI1000; RX PubMed=11823852; DOI=10.1038/415497a; RA Salanoubat M., Genin S., Artiguenave F., Gouzy J., Mangenot S., Arlat M., RA Billault A., Brottier P., Camus J.-C., Cattolico L., Chandler M., RA Choisne N., Claudel-Renard C., Cunnac S., Demange N., Gaspin C., Lavie M., RA Moisan A., Robert C., Saurin W., Schiex T., Siguier P., Thebault P., RA Whalen M., Wincker P., Levy M., Weissenbach J., Boucher C.A.; RT "Genome sequence of the plant pathogen Ralstonia solanacearum."; RL Nature 415:497-502(2002). CC -!- FUNCTION: Transfers dimethylallyl groups to AMP as part of the CC biosynthesis of cytokinin phytohormones. {ECO:0000250}. CC -!- CATALYTIC ACTIVITY: CC Reaction=dimethylallyl diphosphate + AMP = N(6)- CC (dimethylallyl)adenosine 5'-phosphate + diphosphate; CC Xref=Rhea:RHEA:15285, ChEBI:CHEBI:33019, ChEBI:CHEBI:57526, CC ChEBI:CHEBI:57623, ChEBI:CHEBI:456215; EC=2.5.1.27; CC -!- SIMILARITY: Belongs to the isopentenyl transferase family. CC {ECO:0000305}. CC --------------------------------------------------------------------------- CC Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms CC Distributed under the Creative Commons Attribution (CC BY 4.0) License CC --------------------------------------------------------------------------- DR EMBL; AL646053; CAD18376.1; -; Genomic_DNA. DR RefSeq; WP_011004509.1; NC_003296.1. DR AlphaFoldDB; P58592; -. DR SMR; P58592; -. DR STRING; 267608.RSp1225; -. DR EnsemblBacteria; CAD18376; CAD18376; RSp1225. DR KEGG; rso:RSp1225; -. DR PATRIC; fig|267608.8.peg.4715; -. DR eggNOG; COG0324; Bacteria. DR HOGENOM; CLU_1115409_0_0_4; -. DR Proteomes; UP000001436; Plasmid megaplasmid Rsp. DR GO; GO:0009824; F:AMP dimethylallyltransferase activity; IEA:UniProtKB-EC. DR GO; GO:0009691; P:cytokinin biosynthetic process; IEA:UniProtKB-KW. DR Gene3D; 1.10.287.890; Crystal structure of tRNA isopentenylpyrophosphate transferase (bh2366) domain; 1. DR Gene3D; 3.40.50.300; P-loop containing nucleotide triphosphate hydrolases; 1. DR InterPro; IPR027417; P-loop_NTPase. DR InterPro; IPR002648; Tzs. DR Pfam; PF01745; IPT; 1. DR PIRSF; PIRSF000507; IPT; 1. DR SUPFAM; SSF52540; P-loop containing nucleoside triphosphate hydrolases; 1. PE 3: Inferred from homology; KW Cytokinin biosynthesis; Plasmid; Reference proteome; Transferase. FT CHAIN 1..238 FT /note="Adenylate dimethylallyltransferase" FT /id="PRO_0000216436" SQ SEQUENCE 238 AA; 26526 MW; 95F1596E0BF2400C CRC64; Query Match 100.0%; Score 1231; Length 238; Best Local Similarity 100.0%; Matches 238; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 MPVRLYLIWGATTTGKTAQSVALARSAGAPVISLDRVQCCHELAVGSGRPSPSELLGTRR 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MPVRLYLIWGATTTGKTAQSVALARSAGAPVISLDRVQCCHELAVGSGRPSPSELLGTRR 60 Qy 61 EYLCEREVSRGVVSAAEANQLLLDKVARYATQERALILEGGSVSLINAMIRDARWSERGE 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 EYLCEREVSRGVVSAAEANQLLLDKVARYATQERALILEGGSVSLINAMIRDARWSERGE 120 Qy 121 WILRRIPVPGRAAFMAAARKRVREMLDPPPGQAGILDELQGLWGYPRNHAVLEDIDGYRQ 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 WILRRIPVPGRAAFMAAARKRVREMLDPPPGQAGILDELQGLWGYPRNHAVLEDIDGYRQ 180 Qy 181 IIRYANALQVPICRITSIDPNAKALLIERIAQEYWEHALWQEQEFLGIPASWMRADDA 238 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 IIRYANALQVPICRITSIDPNAKALLIERIAQEYWEHALWQEQEFLGIPASWMRADDA 238 Sequence alignment between the LOG of SEQ ID NO:34 of the instant application (“Qy”) and the LOG of Q8NN34 “Db”) Q8NN34_CORGL ID Q8NN34_CORGL Unreviewed; 195 AA. AC Q8NN34; Q6M378; DT 01-OCT-2002, integrated into UniProtKB/TrEMBL. DT 01-OCT-2002, sequence version 1. DT 05-FEB-2025, entry version 129. DE RecName: Full=Cytokinin riboside 5'-monophosphate phosphoribohydrolase {ECO:0000256|RuleBase:RU363015}; DE EC=3.2.2.n1 {ECO:0000256|RuleBase:RU363015}; GN OrderedLocusNames=Cgl2379 {ECO:0000313|EMBL:BAB99772.1}; OS Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC OS 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / OS 534). OC Bacteria; Bacillati; Actinomycetota; Actinomycetes; Mycobacteriales; OC Corynebacteriaceae; Corynebacterium. OX NCBI_TaxID=196627 {ECO:0000313|EMBL:BAB99772.1, ECO:0000313|Proteomes:UP000000582}; RN [1] {ECO:0000313|Proteomes:UP000000582} RP NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. RC STRAIN=ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / RC NCIMB 10025 {ECO:0000313|Proteomes:UP000000582}; RX PubMed=12743753; DOI=10.1007/s00253-003-1328-1; RA Ikeda M., Nakagawa S.; RT "The Corynebacterium glutamicum genome: features and impacts on RT biotechnological processes."; RL Appl. Microbiol. Biotechnol. 62:99-109(2003). RN [2] {ECO:0007829|PDB:5ITS} RP X-RAY CRYSTALLOGRAPHY (2.30 ANGSTROMS). RX PubMed=27507425; DOI=10.1038/srep31390; RA Seo H., Kim S., Sagong H.Y., Son H.F., Jin K.S., Kim I.K., Kim K.J.; RT "Structural basis for cytokinin production by LOG from Corynebacterium RT glutamicum."; RL Sci. Rep. 6:31390-31390(2016). RN [3] {ECO:0007829|PDB:5ZBL} RP X-RAY CRYSTALLOGRAPHY (2.30 ANGSTROMS) IN COMPLEX WITH AMP. RX PubMed=29901273; DOI=10.1111/1462-2920.14287; RA Seo H., Kim K.J.; RT "Structural insight into molecular mechanism of cytokinin activating RT protein from Pseudomonas aeruginosa PAO1."; RL Environ. Microbiol. 20:3214-3223(2018). CC -!- CATALYTIC ACTIVITY: CC Reaction=9-ribosyl-trans-zeatin 5'-phosphate + H2O = trans-zeatin + D- CC ribose 5-phosphate; Xref=Rhea:RHEA:48564, ChEBI:CHEBI:15377, CC ChEBI:CHEBI:16522, ChEBI:CHEBI:78346, ChEBI:CHEBI:87947; EC=3.2.2.n1; CC Evidence={ECO:0000256|RuleBase:RU363015}; CC -!- CATALYTIC ACTIVITY: CC Reaction=N(6)-(dimethylallyl)adenosine 5'-phosphate + H2O = N(6)- CC dimethylallyladenine + D-ribose 5-phosphate; Xref=Rhea:RHEA:48560, CC ChEBI:CHEBI:15377, ChEBI:CHEBI:17660, ChEBI:CHEBI:57526, CC ChEBI:CHEBI:78346; EC=3.2.2.n1; CC Evidence={ECO:0000256|RuleBase:RU363015}; CC -!- SIMILARITY: Belongs to the LOG family. {ECO:0000256|ARBA:ARBA00006763, CC ECO:0000256|RuleBase:RU363015}. CC --------------------------------------------------------------------------- CC Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms CC Distributed under the Creative Commons Attribution (CC BY 4.0) License CC --------------------------------------------------------------------------- DR EMBL; BA000036; BAB99772.1; -; Genomic_DNA. DR RefSeq; NP_601580.1; NC_003450.3. DR RefSeq; WP_011015078.1; NC_006958.1. DR PDB; 5ITS; X-ray; 2.30 A; A/B/C/D=1-195. DR PDB; 5ZBL; X-ray; 2.30 A; A/B/C/D=1-195. DR PDBsum; 5ITS; -. DR PDBsum; 5ZBL; -. DR AlphaFoldDB; Q8NN34; -. DR SMR; Q8NN34; -. DR STRING; 196627.cg2612; -. DR KEGG; cgb:cg2612; -. DR KEGG; cgl:Cgl2379; -. DR PATRIC; fig|196627.13.peg.2314; -. DR eggNOG; COG1611; Bacteria. DR HOGENOM; CLU_058336_4_2_11; -. DR OrthoDB; 9801098at2; -. DR BioCyc; CORYNE:G18NG-11976-MONOMER; -. DR Proteomes; UP000000582; Chromosome. DR GO; GO:0005829; C:cytosol; IEA:TreeGrafter. DR GO; GO:0102682; F:cytokinin riboside 5'-monophosphate phosphoribohydrolase activity; IEA:RHEA. DR GO; GO:0000166; F:nucleotide binding; IEA:UniProtKB-KW. DR GO; GO:0009691; P:cytokinin biosynthetic process; IEA:UniProtKB-UniRule. DR Gene3D; 3.40.50.450; -; 1. DR InterPro; IPR005269; LOG. DR InterPro; IPR031100; LOG_fam. DR NCBIfam; TIGR00730; Rossman fold protein, TIGR00730 family; 1. DR PANTHER; PTHR31223; LOG FAMILY PROTEIN YJL055W; 1. DR PANTHER; PTHR31223:SF70; LOG FAMILY PROTEIN YJL055W; 1. DR Pfam; PF03641; Lysine_decarbox; 1. DR SUPFAM; SSF102405; MCP/YpsA-like; 1. PE 1: Evidence at protein level; KW 3D-structure {ECO:0007829|PDB:5ITS, ECO:0007829|PDB:5ZBL}; KW Cytokinin biosynthesis {ECO:0000256|RuleBase:RU363015}; KW Hydrolase {ECO:0000256|RuleBase:RU363015}; KW Nucleotide-binding {ECO:0007829|PDB:5ZBL}; KW Reference proteome {ECO:0000313|Proteomes:UP000000582}. FT BINDING 19 FT /ligand="AMP" FT /ligand_id="ChEBI:CHEBI:456215" FT /evidence="ECO:0007829|PDB:5ZBL" FT BINDING 99 FT /ligand="AMP" FT /ligand_id="ChEBI:CHEBI:456215" FT /evidence="ECO:0007829|PDB:5ZBL" FT BINDING 100 FT /ligand="AMP" FT /ligand_id="ChEBI:CHEBI:456215" FT /evidence="ECO:0007829|PDB:5ZBL" FT BINDING 116 FT /ligand="AMP" FT /ligand_id="ChEBI:CHEBI:456215" FT /evidence="ECO:0007829|PDB:5ZBL" FT BINDING 118 FT /ligand="AMP" FT /ligand_id="ChEBI:CHEBI:456215" FT /evidence="ECO:0007829|PDB:5ZBL" FT BINDING 119 FT /ligand="AMP" FT /ligand_id="ChEBI:CHEBI:456215" FT /evidence="ECO:0007829|PDB:5ZBL" FT BINDING 121 FT /ligand="AMP" FT /ligand_id="ChEBI:CHEBI:456215" FT /evidence="ECO:0007829|PDB:5ZBL" FT BINDING 122 FT /ligand="AMP" FT /ligand_id="ChEBI:CHEBI:456215" FT /evidence="ECO:0007829|PDB:5ZBL" FT BINDING 125 FT /ligand="AMP" FT /ligand_id="ChEBI:CHEBI:456215" FT /evidence="ECO:0007829|PDB:5ZBL" SQ SEQUENCE 195 AA; 21491 MW; DE73FEDDB01AB348 CRC64; Query Match 100.0%; Score 1018; Length 195; Best Local Similarity 100.0%; Matches 195; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 MTSLFDAPTLQRVTVFTGSALGSSSLYTQAAQTLAKTAVDRGIDLVYGGGKVGLMGIVAD 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MTSLFDAPTLQRVTVFTGSALGSSSLYTQAAQTLAKTAVDRGIDLVYGGGKVGLMGIVAD 60 Qy 61 AFLESGGEAFGVITESLMKGELGHEKLTELEIVPDMHIRKRRMAELGDGFIAMPGGAGTL 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 AFLESGGEAFGVITESLMKGELGHEKLTELEIVPDMHIRKRRMAELGDGFIAMPGGAGTL 120 Qy 121 EELFEVWTWQQLGIHQKPVALYDVDGFWQPLLEMLEQMTQRGFIKRDFFECLIVESDPHA 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 EELFEVWTWQQLGIHQKPVALYDVDGFWQPLLEMLEQMTQRGFIKRDFFECLIVESDPHA 180 Qy 181 LLKAMQTWTPPAPKW 195 ||||||||||||||| Db 181 LLKAMQTWTPPAPKW 195 Sequence alignment between the cytochrome P450 monooxygenase of SEQ ID NO:93 of the instant application (“Qy”) and the cytochrome P450 monooxygenase of P46373 (“Db”) FAS1_RHOFA ID FAS1_RHOFA Reviewed; 399 AA. AC P46373; DT 01-NOV-1995, integrated into UniProtKB/Swiss-Prot. DT 01-NOV-1995, sequence version 1. DT 05-FEB-2025, entry version 97. DE RecName: Full=Cytochrome P450 FAS1; DE EC=1.14.-.-; GN Name=fas1; Synonyms=CYP105E1; OS Rhodococcoides fascians (Rhodococcus fascians). OG Plasmid pFiD188. OC Bacteria; Bacillati; Actinomycetota; Actinomycetes; Mycobacteriales; OC Nocardiaceae; Rhodococcoides. OX NCBI_TaxID=1828; RN [1] RP NUCLEOTIDE SEQUENCE [GENOMIC DNA]. RC STRAIN=D188; RX PubMed=8169198; DOI=10.1128/jb.176.9.2492-2501.1994; RA Crespi M., Vereecke D., Temmerman W., van Montagu M., Desomer J.; RT "The fas operon of Rhodococcus fascians encodes new genes required for RT efficient fasciation of host plants."; RL J. Bacteriol. 176:2492-2501(1994). CC -!- FUNCTION: May be involved in the biosynthesis of cytokinin CC phytohormones and in host plant fasciation (leafy gall). CC -!- COFACTOR: CC Name=heme; Xref=ChEBI:CHEBI:30413; Evidence={ECO:0000250}; CC -!- SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250}. CC -!- INDUCTION: During the interaction with host plants. CC -!- SIMILARITY: Belongs to the cytochrome P450 family. {ECO:0000305}. CC --------------------------------------------------------------------------- CC Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms CC Distributed under the Creative Commons Attribution (CC BY 4.0) License CC --------------------------------------------------------------------------- DR EMBL; Z29635; CAA82741.1; -; Genomic_DNA. DR PIR; A55578; A55578. DR RefSeq; WP_015586131.1; NZ_NPFU01000019.1. DR RefSeq; YP_007878704.1; NC_021080.1. DR AlphaFoldDB; P46373; -. DR SMR; P46373; -. DR STRING; 1443905.GCA_000761075_00040; -. DR eggNOG; COG2124; Bacteria. DR GO; GO:0005737; C:cytoplasm; IEA:UniProtKB-SubCell. DR GO; GO:0020037; F:heme binding; IEA:InterPro. DR GO; GO:0005506; F:iron ion binding; IEA:InterPro. DR GO; GO:0004497; F:monooxygenase activity; IEA:UniProtKB-KW. DR GO; GO:0016705; F:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen; IEA:InterPro. DR CDD; cd11030; CYP105-like; 1. DR FunFam; 1.10.630.10:FF:000018; Cytochrome P450 monooxygenase; 1. DR Gene3D; 1.10.630.10; Cytochrome P450; 1. DR InterPro; IPR001128; Cyt_P450. DR InterPro; IPR002397; Cyt_P450_B. DR InterPro; IPR017972; Cyt_P450_CS. DR InterPro; IPR036396; Cyt_P450_sf. DR PANTHER; PTHR46696:SF1; CYTOCHROME P450 YJIB-RELATED; 1. DR PANTHER; PTHR46696; P450, PUTATIVE (EUROFUNG)-RELATED; 1. DR Pfam; PF00067; p450; 1. DR PRINTS; PR00359; BP450. DR PRINTS; PR00385; P450. DR SUPFAM; SSF48264; Cytochrome P450; 1. DR PROSITE; PS00086; CYTOCHROME_P450; 1. PE 2: Evidence at transcript level; KW Cytoplasm; Heme; Iron; Metal-binding; Monooxygenase; Oxidoreductase; KW Plasmid. FT CHAIN 1..399 FT /note="Cytochrome P450 FAS1" FT /id="PRO_0000052231" FT BINDING 349 FT /ligand="heme" FT /ligand_id="ChEBI:CHEBI:30413" FT /ligand_part="Fe" FT /ligand_part_id="ChEBI:CHEBI:18248" FT /note="axial binding residue" FT /evidence="ECO:0000250" SQ SEQUENCE 399 AA; 43596 MW; A66B6F3DF1286566 CRC64; Query Match 100.0%; Score 2020; Length 399; Best Local Similarity 100.0%; Matches 399; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 MAGTADLPLEMRRNGLNPTEELAQVRDRDGVIPVGELYGAPAFLVCRYEDVRRIFADSNR 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MAGTADLPLEMRRNGLNPTEELAQVRDRDGVIPVGELYGAPAFLVCRYEDVRRIFADSNR 60 Qy 61 FSNAHTPMFAIPSGGDVIEDELAAMRAGNLIGLDPPDHTRLRHILAAEFSVHRLSRLQPR 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 FSNAHTPMFAIPSGGDVIEDELAAMRAGNLIGLDPPDHTRLRHILAAEFSVHRLSRLQPR 120 Qy 121 IAEIVDSALDGLEQAGQPADLMDRYALPVSLLVLCELLGVPYADRDELRDRTARLLDLSA 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 IAEIVDSALDGLEQAGQPADLMDRYALPVSLLVLCELLGVPYADRDELRDRTARLLDLSA 180 Qy 181 SAEQRAVAQREDRRYMATLVTRAQEQPGDDLLGILARKIGDNLSTDELISIISLIMLGGH 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 SAEQRAVAQREDRRYMATLVTRAQEQPGDDLLGILARKIGDNLSTDELISIISLIMLGGH 240 Qy 241 ETTASMIGLSVLALLHHPEQAAMMIEDPNCVNSGIEELLRWLSVAHSQPPRMAVTEVQIA 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 ETTASMIGLSVLALLHHPEQAAMMIEDPNCVNSGIEELLRWLSVAHSQPPRMAVTEVQIA 300 Qy 301 GVTIPAGSFVIPSLLAANRDSNLTDRPDDLDITRGVAGHLAFGHGVHFCLGHSLARMTLR 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 GVTIPAGSFVIPSLLAANRDSNLTDRPDDLDITRGVAGHLAFGHGVHFCLGHSLARMTLR 360 Qy 361 TAVPAVLRRFPDLALSPSHDVRLRSASIVLGLEELQLTW 399 ||||||||||||||||||||||||||||||||||||||| Db 361 TAVPAVLRRFPDLALSPSHDVRLRSASIVLGLEELQLTW 399 Sequence alignment between the DXS of SEQ ID NO:63 of the instant application (“Qy”) and the DSX of Jusling/B. subtilis (“Db”) DXS_BACSU ID DXS_BACSU Reviewed; 633 AA. AC P54523; DT 01-OCT-1996, integrated into UniProtKB/Swiss-Prot. DT 01-OCT-1996, sequence version 1. DT 18-JUN-2025, entry version 154. DE RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase {ECO:0000255|HAMAP-Rule:MF_00315}; DE EC=2.2.1.7 {ECO:0000255|HAMAP-Rule:MF_00315}; DE AltName: Full=1-deoxyxylulose-5-phosphate synthase {ECO:0000255|HAMAP-Rule:MF_00315}; DE Short=DXP synthase {ECO:0000255|HAMAP-Rule:MF_00315}; DE Short=DXPS {ECO:0000255|HAMAP-Rule:MF_00315}; GN Name=dxs {ECO:0000255|HAMAP-Rule:MF_00315}; Synonyms=yqiE; GN OrderedLocusNames=BSU24270; OS Bacillus subtilis (strain 168). OC Bacteria; Bacillati; Bacillota; Bacilli; Bacillales; Bacillaceae; Bacillus. OX NCBI_TaxID=224308; RN [1] RP NUCLEOTIDE SEQUENCE [GENOMIC DNA]. RC STRAIN=168 / JH642; RX PubMed=8969508; DOI=10.1099/13500872-142-11-3103; RA Mizuno M., Masuda S., Takemaru K., Hosono S., Sato T., Takeuchi M., RA Kobayashi Y.; RT "Systematic sequencing of the 283 kb 210 degrees-232 degrees region of the RT Bacillus subtilis genome containing the skin element and many sporulation RT genes."; RL Microbiology 142:3103-3111(1996). RN [2] RP NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. RC STRAIN=168; RX PubMed=9384377; DOI=10.1038/36786; RA Kunst F., Ogasawara N., Moszer I., Albertini A.M., Alloni G., Azevedo V., RA Bertero M.G., Bessieres P., Bolotin A., Borchert S., Borriss R., RA Boursier L., Brans A., Braun M., Brignell S.C., Bron S., Brouillet S., RA Bruschi C.V., Caldwell B., Capuano V., Carter N.M., Choi S.-K., RA Codani J.-J., Connerton I.F., Cummings N.J., Daniel R.A., Denizot F., RA Devine K.M., Duesterhoeft A., Ehrlich S.D., Emmerson P.T., Entian K.-D., RA Errington J., Fabret C., Ferrari E., Foulger D., Fritz C., Fujita M., RA Fujita Y., Fuma S., Galizzi A., Galleron N., Ghim S.-Y., Glaser P., RA Goffeau A., Golightly E.J., Grandi G., Guiseppi G., Guy B.J., Haga K., RA Haiech J., Harwood C.R., Henaut A., Hilbert H., Holsappel S., Hosono S., RA Hullo M.-F., Itaya M., Jones L.-M., Joris B., Karamata D., Kasahara Y., RA Klaerr-Blanchard M., Klein C., Kobayashi Y., Koetter P., Koningstein G., RA Krogh S., Kumano M., Kurita K., Lapidus A., Lardinois S., Lauber J., RA Lazarevic V., Lee S.-M., Levine A., Liu H., Masuda S., Mauel C., RA Medigue C., Medina N., Mellado R.P., Mizuno M., Moestl D., Nakai S., RA Noback M., Noone D., O'Reilly M., Ogawa K., Ogiwara A., Oudega B., RA Park S.-H., Parro V., Pohl T.M., Portetelle D., Porwollik S., RA Prescott A.M., Presecan E., Pujic P., Purnelle B., Rapoport G., Rey M., RA Reynolds S., Rieger M., Rivolta C., Rocha E., Roche B., Rose M., Sadaie Y., RA Sato T., Scanlan E., Schleich S., Schroeter R., Scoffone F., Sekiguchi J., RA Sekowska A., Seror S.J., Serror P., Shin B.-S., Soldo B., Sorokin A., RA Tacconi E., Takagi T., Takahashi H., Takemaru K., Takeuchi M., RA Tamakoshi A., Tanaka T., Terpstra P., Tognoni A., Tosato V., Uchiyama S., RA Vandenbol M., Vannier F., Vassarotti A., Viari A., Wambutt R., Wedler E., RA Wedler H., Weitzenegger T., Winters P., Wipat A., Yamamoto H., Yamane K., RA Yasumoto K., Yata K., Yoshida K., Yoshikawa H.-F., Zumstein E., RA Yoshikawa H., Danchin A.; RT "The complete genome sequence of the Gram-positive bacterium Bacillus RT subtilis."; RL Nature 390:249-256(1997). CC -!- FUNCTION: Catalyzes the acyloin condensation reaction between C atoms 2 CC and 3 of pyruvate and glyceraldehyde 3-phosphate to yield 1-deoxy-D- CC xylulose-5-phosphate (DXP). {ECO:0000255|HAMAP-Rule:MF_00315}. CC -!- CATALYTIC ACTIVITY: CC Reaction=D-glyceraldehyde 3-phosphate + pyruvate + H(+) = 1-deoxy-D- CC xylulose 5-phosphate + CO2; Xref=Rhea:RHEA:12605, ChEBI:CHEBI:15361, CC ChEBI:CHEBI:15378, ChEBI:CHEBI:16526, ChEBI:CHEBI:57792, CC ChEBI:CHEBI:59776; EC=2.2.1.7; Evidence={ECO:0000255|HAMAP- CC Rule:MF_00315}; CC -!- COFACTOR: CC Name=Mg(2+); Xref=ChEBI:CHEBI:18420; CC Evidence={ECO:0000255|HAMAP-Rule:MF_00315}; CC Note=Binds 1 Mg(2+) ion per subunit. {ECO:0000255|HAMAP-Rule:MF_00315}; CC -!- COFACTOR: CC Name=thiamine diphosphate; Xref=ChEBI:CHEBI:58937; CC Evidence={ECO:0000255|HAMAP-Rule:MF_00315}; CC Note=Binds 1 thiamine pyrophosphate per subunit. {ECO:0000255|HAMAP- CC Rule:MF_00315}; CC -!- PATHWAY: Metabolic intermediate biosynthesis; 1-deoxy-D-xylulose 5- CC phosphate biosynthesis; 1-deoxy-D-xylulose 5-phosphate from D- CC glyceraldehyde 3-phosphate and pyruvate: step 1/1. {ECO:0000255|HAMAP- CC Rule:MF_00315}. CC -!- SUBUNIT: Homodimer. {ECO:0000255|HAMAP-Rule:MF_00315}. CC -!- SIMILARITY: Belongs to the transketolase family. DXPS subfamily. CC {ECO:0000255|HAMAP-Rule:MF_00315}. CC --------------------------------------------------------------------------- CC Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms CC Distributed under the Creative Commons Attribution (CC BY 4.0) License CC --------------------------------------------------------------------------- DR EMBL; D84432; BAA12576.1; -; Genomic_DNA. DR EMBL; AL009126; CAB14358.1; -; Genomic_DNA. DR PIR; B69961; B69961. DR RefSeq; NP_390307.1; NC_000964.3. DR RefSeq; WP_003245985.1; NZ_OZ025638.1. DR AlphaFoldDB; P54523; -. DR SMR; P54523; -. DR FunCoup; P54523; 450. DR STRING; 224308.BSU24270; -. DR PaxDb; 224308-BSU24270; -. DR EnsemblBacteria; CAB14358; CAB14358; BSU_24270. DR GeneID; 938609; -. DR KEGG; bsu:BSU24270; -. DR PATRIC; fig|224308.179.peg.2645; -. DR eggNOG; COG1154; Bacteria. DR InParanoid; P54523; -. DR OrthoDB; 9803371at2; -. DR PhylomeDB; P54523; -. DR BioCyc; BSUB:BSU24270-MONOMER; -. DR BioCyc; MetaCyc:BSU24270-MONOMER; -. DR UniPathway; UPA00064; UER00091. DR Proteomes; UP000001570; Chromosome. DR GO; GO:0005829; C:cytosol; IBA:GO_Central. DR GO; GO:0008661; F:1-deoxy-D-xylulose-5-phosphate synthase activity; IBA:GO_Central. DR GO; GO:0000287; F:magnesium ion binding; IEA:UniProtKB-UniRule. DR GO; GO:0030976; F:thiamine pyrophosphate binding; IEA:UniProtKB-UniRule. DR GO; GO:0052865; P:1-deoxy-D-xylulose 5-phosphate biosynthetic process; IEA:UniProtKB-UniPathway. DR GO; GO:0019288; P:isopentenyl diphosphate biosynthetic process, methylerythritol 4-phosphate pathway; IBA:GO_Central. DR GO; GO:0016114; P:terpenoid biosynthetic process; IEA:UniProtKB-UniRule. DR GO; GO:0009228; P:thiamine biosynthetic process; IEA:UniProtKB-UniRule. DR CDD; cd02007; TPP_DXS; 1. DR CDD; cd07033; TPP_PYR_DXS_TK_like; 1. DR FunFam; 3.40.50.920:FF:000002; 1-deoxy-D-xylulose-5-phosphate synthase; 1. DR FunFam; 3.40.50.970:FF:000030; 1-deoxy-D-xylulose-5-phosphate synthase; 1. DR Gene3D; 3.40.50.920; -; 1. DR Gene3D; 3.40.50.970; -; 2. DR HAMAP; MF_00315; DXP_synth; 1. DR InterPro; IPR005477; Dxylulose-5-P_synthase. DR InterPro; IPR029061; THDP-binding. DR InterPro; IPR009014; Transketo_C/PFOR_II. DR InterPro; IPR005475; Transketolase-like_Pyr-bd. DR InterPro; IPR020826; Transketolase_BS. DR InterPro; IPR033248; Transketolase_C. DR InterPro; IPR049557; Transketolase_CS. DR NCBIfam; TIGR00204; dxs; 1. DR NCBIfam; NF003933; PRK05444.2-2; 1. DR PANTHER; PTHR43322; 1-D-DEOXYXYLULOSE 5-PHOSPHATE SYNTHASE-RELATED; 1. DR PANTHER; PTHR43322:SF5; 1-DEOXY-D-XYLULOSE-5-PHOSPHATE SYNTHASE, CHLOROPLASTIC; 1. DR Pfam; PF13292; DXP_synthase_N; 1. DR Pfam; PF02779; Transket_pyr; 1. DR Pfam; PF02780; Transketolase_C; 1. DR SMART; SM00861; Transket_pyr; 1. DR SUPFAM; SSF52518; Thiamin diphosphate-binding fold (THDP-binding); 2. DR SUPFAM; SSF52922; TK C-terminal domain-like; 1. DR PROSITE; PS00801; TRANSKETOLASE_1; 1. DR PROSITE; PS00802; TRANSKETOLASE_2; 1. PE 3: Inferred from homology; KW Isoprene biosynthesis; Magnesium; Metal-binding; Reference proteome; KW Thiamine biosynthesis; Thiamine pyrophosphate; Transferase. FT CHAIN 1..633 FT /note="1-deoxy-D-xylulose-5-phosphate synthase" FT /id="PRO_0000189086" FT BINDING 72 FT /ligand="thiamine diphosphate" FT /ligand_id="ChEBI:CHEBI:58937" FT /evidence="ECO:0000255|HAMAP-Rule:MF_00315" FT BINDING 113..115 FT /ligand="thiamine diphosphate" FT /ligand_id="ChEBI:CHEBI:58937" FT /evidence="ECO:0000255|HAMAP-Rule:MF_00315" FT BINDING 144 FT /ligand="Mg(2+)" FT /ligand_id="ChEBI:CHEBI:18420" FT /evidence="ECO:0000255|HAMAP-Rule:MF_00315" FT BINDING 145..146 FT /ligand="thiamine diphosphate" FT /ligand_id="ChEBI:CHEBI:58937" FT /evidence="ECO:0000255|HAMAP-Rule:MF_00315" FT BINDING 173 FT /ligand="Mg(2+)" FT /ligand_id="ChEBI:CHEBI:18420" FT /evidence="ECO:0000255|HAMAP-Rule:MF_00315" FT BINDING 173 FT /ligand="thiamine diphosphate" FT /ligand_id="ChEBI:CHEBI:58937" FT /evidence="ECO:0000255|HAMAP-Rule:MF_00315" FT BINDING 284 FT /ligand="thiamine diphosphate" FT /ligand_id="ChEBI:CHEBI:58937" FT /evidence="ECO:0000255|HAMAP-Rule:MF_00315" FT BINDING 367 FT /ligand="thiamine diphosphate" FT /ligand_id="ChEBI:CHEBI:58937" FT /evidence="ECO:0000255|HAMAP-Rule:MF_00315" SQ SEQUENCE 633 AA; 69559 MW; 333B65355F0CEF8F CRC64; Query Match 100.0%; Score 3282; Length 633; Best Local Similarity 100.0%; Matches 633; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 MDLLSIQDPSFLKNMSIDELEKLSDEIRQFLITSLSASGGHIGPNLGVVELTVALHKEFN 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MDLLSIQDPSFLKNMSIDELEKLSDEIRQFLITSLSASGGHIGPNLGVVELTVALHKEFN 60 Qy 61 SPKDKFLWDVGHQSYVHKLLTGRGKEFATLRQYKGLCGFPKRSESEHDVWETGHSSTSLS 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 SPKDKFLWDVGHQSYVHKLLTGRGKEFATLRQYKGLCGFPKRSESEHDVWETGHSSTSLS 120 Qy 121 GAMGMAAARDIKGTDEYIIPIIGDGALTGGMALEALNHIGDEKKDMIVILNDNEMSIAPN 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 GAMGMAAARDIKGTDEYIIPIIGDGALTGGMALEALNHIGDEKKDMIVILNDNEMSIAPN 180 Qy 181 VGAIHSMLGRLRTAGKYQWVKDELEYLFKKIPAVGGKLAATAERVKDSLKYMLVSGMFFE 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 VGAIHSMLGRLRTAGKYQWVKDELEYLFKKIPAVGGKLAATAERVKDSLKYMLVSGMFFE 240 Qy 241 ELGFTYLGPVDGHSYHELIENLQYAKKTKGPVLLHVITKKGKGYKPAETDTIGTWHGTGP 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 ELGFTYLGPVDGHSYHELIENLQYAKKTKGPVLLHVITKKGKGYKPAETDTIGTWHGTGP 300 Qy 301 YKINTGDFVKPKAAAPSWSGLVSGTVQRMAREDGRIVAITPAMPVGSKLEGFAKEFPDRM 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 YKINTGDFVKPKAAAPSWSGLVSGTVQRMAREDGRIVAITPAMPVGSKLEGFAKEFPDRM 360 Qy 361 FDVGIAEQHAATMAAAMAMQGMKPFLAIYSTFLQRAYDQVVHDICRQNANVFIGIDRAGL 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 FDVGIAEQHAATMAAAMAMQGMKPFLAIYSTFLQRAYDQVVHDICRQNANVFIGIDRAGL 420 Qy 421 VGADGETHQGVFDIAFMRHIPNMVLMMPKDENEGQHMVHTALSYDEGPIAMRFPRGNGLG 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 421 VGADGETHQGVFDIAFMRHIPNMVLMMPKDENEGQHMVHTALSYDEGPIAMRFPRGNGLG 480 Qy 481 VKMDEQLKTIPIGTWEVLRPGNDAVILTFGTTIEMAIEAAEELQKEGLSVRVVNARFIKP 540 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 481 VKMDEQLKTIPIGTWEVLRPGNDAVILTFGTTIEMAIEAAEELQKEGLSVRVVNARFIKP 540 Qy 541 IDEKMMKSILKEGLPILTIEEAVLEGGFGSSILEFAHDQGEYHTPIDRMGIPDRFIEHGS 600 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 541 IDEKMMKSILKEGLPILTIEEAVLEGGFGSSILEFAHDQGEYHTPIDRMGIPDRFIEHGS 600 Qy 601 VTALLEEIGLTKQQVANRIRLLMPPKTHKGIGS 633 ||||||||||||||||||||||||||||||||| Db 601 VTALLEEIGLTKQQVANRIRLLMPPKTHKGIGS 633
Read full office action

Prosecution Timeline

May 19, 2023
Application Filed
Mar 20, 2026
Non-Final Rejection — §103 (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12595472
MANNANASE VARIANTS
2y 5m to grant Granted Apr 07, 2026
Patent 12590301
METHODS FOR SAFE AND EFFECTIVE THROMBOLYSIS USING SEQUENTIAL ADMINISTRATION OF TISSUE PLASMINOGEN ACTIVATOR AND MUTANT PRO-UROKINASE
2y 5m to grant Granted Mar 31, 2026
Patent 12570964
Bacterium And Obtaining Method And Application Thereof
2y 5m to grant Granted Mar 10, 2026
Patent 12559734
Reverse Transcriptase Mutants with Increased Activity and Thermostability
2y 5m to grant Granted Feb 24, 2026
Patent 12540160
METHODS FOR THE PURIFICATION OF REFOLDED FC-PEPTIDE FUSION PROTEIN
2y 5m to grant Granted Feb 03, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

AI Strategy Recommendation

Get an AI-powered prosecution strategy using examiner precedents, rejection analysis, and claim mapping.
Powered by AI — typically takes 5-10 seconds

Prosecution Projections

1-2
Expected OA Rounds
74%
Grant Probability
88%
With Interview (+14.0%)
3y 0m
Median Time to Grant
Low
PTA Risk
Based on 924 resolved cases by this examiner. Grant probability derived from career allow rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month