Prosecution Insights
Last updated: April 19, 2026
Application No. 18/042,282

VARIANTS OF A FAMILY 44 XYLOGLUCANASE

Final Rejection §102§103
Filed
Feb 20, 2023
Examiner
PAK, YONG D
Art Unit
1652
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
Novozymes A/S
OA Round
2 (Final)
74%
Grant Probability
Favorable
3-4
OA Rounds
3y 0m
To Grant
88%
With Interview

Examiner Intelligence

Grants 74% — above average
74%
Career Allow Rate
685 granted / 924 resolved
+14.1% vs TC avg
Moderate +14% lift
Without
With
+14.0%
Interview Lift
resolved cases with interview
Typical timeline
3y 0m
Avg Prosecution
55 currently pending
Career history
979
Total Applications
across all art units

Statute-Specific Performance

§101
7.0%
-33.0% vs TC avg
§103
21.0%
-19.0% vs TC avg
§102
21.8%
-18.2% vs TC avg
§112
32.6%
-7.4% vs TC avg
Black line = Tech Center average estimate • Based on career data from 924 resolved cases

Office Action

§102 §103
Notice of Pre-AIA or AIA Status The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . DETAILED ACTION This application is a 371 of PCT/EP2021/073379. The amendment filed on October 31, 2025 has been entered. Election/Restrictions Applicant elected with traverse of Group I with a species election of (1) SEQ ID NO:2 as the parent xyloglucanase and (2) P111Q + S123P + A129T + V159M as the amino acid modifications made in said parent xyloglucanase in the reply filed on July 18, 2025. Claims 26-33 and 39-40 are withdrawn from further consideration pursuant to 37 CFR 1.142(b), as being drawn to a nonelected species and invention, there being no allowable generic or linking claim. Applicant timely traversed the restriction (election) requirement in the reply filed on July 18, 2025. Status of Claims Claims 22-40 are pending. Claims 26-33 and 39-40 are withdrawn. Claims 22-25 and 34-38 are under examination. Information Disclosure Statement The information disclosure statement (IDS) submitted on November 20, 2025 and November 10, 2025 are in compliance with the provisions of 37 CFR 1.97. Accordingly, the information disclosure statements are being considered by the examiner. Claim Rejections - 35 USC § 102 In the event the determination of the status of the application as subject to AIA 35 U.S.C. 102 and 103 (or as subject to pre-AIA 35 U.S.C. 102 and 103) is incorrect, any correction of the statutory basis for the rejection will not be considered a new ground of rejection if the prior art relied upon, and the rationale supporting the rejection, would be the same under either status. The following is a quotation of the appropriate paragraphs of 35 U.S.C. 102 that form the basis for the rejections under this section made in this Office action: A person shall be entitled to a patent unless – (a)(1) the claimed invention was patented, described in a printed publication, or in public use, on sale or otherwise available to the public before the effective filing date of the claimed invention. Claim(s) 22-25 and 34-38 is/are rejected under 35 U.S.C. 102(a)(1) as being anticipated by Lant (US 2009/0312221 - form PTO-1449). Regarding claims 22-23 and 34-36, Lant discloses a xyloglucanase variant of SEQ ID NO:3, wherein the variant has 111Q + 123P + 129T + 159M amino acid substitutions, the variant has at least 95% sequence identity to SEQ ID NO:2 of the instant application, and the variant has xyloglucanase activity ([0341] see the sequence alignment below). Regarding claims 24-25, Lant discloses that the xyloglucanase variant comprises one or more of 68H, 92V, 118A, 156Y, 200P and 331F ([0354]). Regarding claims 37-38, Lant discloses a detergent composition comprising the xyloglucanase variant in the form of a gel ([0006] and [0392]-[0393]. Therefore, the reference of Lant anticipates claims 22-25 and 34-38. Applicant's arguments filed October 31, 2025 have been fully considered but they are not persuasive. Applicant argues that paragraph [0341] of Lant does not teach or suggest xyloglucanase with four substitutions, let alone a variant with substitutions at positions 111, 123, 129, and 159, e.g., a variant with the substitutions 111Q+123P+129T+159M. This is not found persuasive. Lant discloses a xyloglucanase variant of SEQ ID NO:3, wherein the variant has one to several amino acid substitutions, such as 111Q + 123P + 129T + 159M amino acid substitutions. Claims 22-25 and 34-38 of the instant application are directed to a xyloglucanase variant comprising the four recited 111+123+129+159/111Q + 123P + 129T + 159M amino acid substitutions and having at least 80-95% to SEQ ID NO:2. Therefore, the claimed xyloglucanase variant of the instant application allows for other amino acid substitutions disclosed by Lant in paragraph [0341]). Applicant argues that the number of possible quadruple mutants from the 52 substitutions is estimated to be more than 270,000 and therefore, the skilled artisan would not envisage a xyloglucanase variant with the four substitutions 111Q+123P+129T+159M. This is not found persuasive. MPEP 2131.02. II. states that “when the species is clearly named, the species claim is anticipated no matter how many other species are additionally named. See Ex parteA, 17 USPQ2d 1716 (Bd. Pat. App. & Inter. 1990) (The claimed compound was named in a reference which also disclosed 45 other compounds. The Board held that the comprehensiveness of the listing did not negate the fact that the compound claimed was specifically taught. The Board compared the facts to the situation in which the compound was found in the Merck Index, saying that “the tenth edition of the Merck Index lists ten thousand compounds. In our view, each and every one of those compounds is ‘described’”. In the instant case, since the species, 111Q+123P+129T+159M, is clearly named, the species is anticipated. Hence the rejection has been maintained. Claim(s) 22-25 and 34-38 is/are rejected under 35 U.S.C. 102(a)(1) as being anticipated by Besenmatter (US 2011/0092409 - form PTO-1449). Regarding claims 22-23 and 34-36, Besenmatter discloses a xyloglucanase variant of SEQ ID NO:3, wherein the variant has 111Q + 123P + 129T + 159M amino acid substitutions, the variant has at least 95% sequence identity to SEQ ID NO:2 of the instant application, and the variant has xyloglucanase activity ([0073] see the sequence alignment below). Regarding claims 24-25, Besenmatter discloses that the xyloglucanase variant comprises one or more of 68H, 92V, 118A, 156Y, 200P and 331F ([0086]). Regarding claims 37-38, Besenmatter discloses a detergent composition comprising the xyloglucanase variant in the form of a gel ([0009] and [0127-[0128]). Therefore, the reference of Besenmatter anticipates claims 22-25 and 34-38. Applicant's arguments filed October 31, 2025 have been fully considered but they are not persuasive. Applicant argues that paragraph [0079] of Bessenmatter does not teach or suggest xyloglucanase with four substitutions, let alone a variant with substitutions at positions 111, 123, 129, and 159, e.g., a variant with the substitutions 111Q+123P+129T+159M. This is not found persuasive. Bessenmatter discloses a xyloglucanase variant of SEQ ID NO:3, wherein the variant one to several amino acid substitutions, such as 111Q + 123P + 129T + 159M amino acid substitutions. Claims 22-25 and 34-38 of the instant application are directed to a xyloglucanase variant comprising the four recited 111+123+129+159/111Q + 123P + 129T + 159M amino acid substitutions and having at least 80-95% to SEQ ID NO:2. Therefore, the claimed xyloglucanase of the instant application allows for other amino acid substitutions disclosed by Bessenmatter in paragraph [0079]). Applicant argues that the number of possible quadruple mutants from the 52 substitutions is estimated to be more than 270,000 and therefore, the skilled artisan would not envisage a xyloglucanase variant with the four substitutions 111Q+123P+129T+159M. This is not found persuasive. MPEP 2131.02. II. states that “when the species is clearly named, the species claim is anticipated no matter how many other species are additionally named. See Ex parteA, 17 USPQ2d 1716 (Bd. Pat. App. & Inter. 1990) (The claimed compound was named in a reference which also disclosed 45 other compounds. The Board held that the comprehensiveness of the listing did not negate the fact that the compound claimed was specifically taught. The Board compared the facts to the situation in which the compound was found in the Merck Index, saying that “the tenth edition of the Merck Index lists ten thousand compounds. In our view, each and every one of those compounds is ‘described’”. In the instant case, since the species, 111Q+123P+129T+159M, is clearly named, the species is anticipated. Hence the rejection has been maintained. Claim Rejections - 35 USC § 103 The following is a quotation of 35 U.S.C. 103 which forms the basis for all obviousness rejections set forth in this Office action: A patent for a claimed invention may not be obtained, notwithstanding that the claimed invention is not identically disclosed as set forth in section 102, if the differences between the claimed invention and the prior art are such that the claimed invention as a whole would have been obvious before the effective filing date of the claimed invention to a person having ordinary skill in the art to which the claimed invention pertains. Patentability shall not be negated by the manner in which the invention was made. The factual inquiries for establishing a background for determining obviousness under 35 U.S.C. 103 are summarized as follows: 1. Determining the scope and contents of the prior art. 2. Ascertaining the differences between the prior art and the claims at issue. 3. Resolving the level of ordinary skill in the pertinent art. 4. Considering objective evidence present in the application indicating obviousness or nonobviousness. This application currently names joint inventors. In considering patentability of the claims the examiner presumes that the subject matter of the various claims was commonly owned as of the effective filing date of the claimed invention(s) absent any evidence to the contrary. Applicant is advised of the obligation under 37 CFR 1.56 to point out the inventor and effective filing dates of each claim that was not commonly owned as of the effective filing date of the later invention in order for the examiner to consider the applicability of 35 U.S.C. 102(b)(2)(C) for any potential 35 U.S.C. 102(a)(2) prior art against the later invention. Claim(s) 22-25 and 34-38 is/are rejected under 35 U.S.C. 103 as being unpatentable over Gori (WO 2018/184816 – form PTO-1449) and Lant (US 2009/0312221 - form PTO-1449). Regarding claims 22 and 24-25, Gori discloses a Paenibacillus polymyxa xyloglucanase of SEQ ID NO:87 having 100% sequence identity to the xyloglucanase of SEQ ID NO:2 of the instant application (page 29, lines 3-10 and see the sequence alignment below). The xyloglucanase of SEQ ID NO:87 of Gori has 68H, 92V, 118A, 156Y, 200P and 331F amino acid substitutions compared to the xyloglucanase of SEQ ID NO:1 of the instant application. Regarding claims 37-38, Gori discloses a detergent composition comprising the xyloglucanase in the form of a gel or liquid (page 28, line 36 through page 29, line 10 and page 91, line 32 through page 92. Line 11). Gori does not disclose a xyloglucanase variant of SEQ ID NO:87 comprising 111Q + 123P + 129T + 159M amino acid substitutions. Regarding claims 22-23, Lant discloses introducing 111Q + 123P + 129T + 159M amino acid substitutions into a Paenibacillus polymyxa xyloglucanase ([0341]). Lant discloses that the resulting xyloglucanase variants have improved stability in detergent compositions ([0015]). Regarding claims 34-36, introducing the 111Q + 123P + 129T + 159M amino acid substitutions into the xyloglucanase of Gori results in a xyloglucanase variant having at least 95% but less than 100% sequence identity to SEQ ID NO:2 of the instant application. Regarding claims 37-38, Lant discloses a detergent composition comprising the xyloglucanase variant in the form of a gel or liquid ([0006] and [0392]-[0393]). Therefore, in combining the teachings of Gori and Lant, it would have been obvious to one having ordinary skill in the art before the claimed invention was effectively filed to introduce 111Q + 123P + 129T + 159M amino acid substitutions into the xyloglucanase of Gori. One having ordinary skill in the art would have been motivated to introduce the 111Q + 123P + 129T + 159M amino acid substitutions in order to improve the stability of the xyloglucanase of Gori in a detergent composition. One having ordinary skill in the art would have had a reasonable expectation of success since Gori discloses a Paenibacillus polymyxa xyloglucanase and Lant discloses improving the stability of Paenibacillus polymyxa xyloglucanase in a detergent composition by introducing 111Q + 123P + 129T + 159M amino acid substitutions. Using the known technique of introducing amino acid substitutions (111Q + 123P + 129T + 159M) in Paenibacillus polymyxa xyloglucanase for improving stability of Paenibacillus polymyxa xyloglucanase in a detergent composition would have been obvious to one of ordinary skill. The rationale supporting that the claims would have been obvious is that a method of enhancing a particular class of devices (Paenibacillus polymyxa xyloglucanase in a detergent composition) has been made part of the ordinary capabilities of one skilled in the art based upon the teaching of such improvement in other situations. One of ordinary skill in the art would have been capable of applying this known method of enhancement (introducing 111Q + 123P + 129T + 159M amino acid substitutions) to a “base” device (Paenibacillus polymyxa xyloglucanase) in the prior art and the results would have been predictable to one of ordinary skill in the art. Therefore, the above references render claims 22-25 and 34-38 prima facie obvious. Applicant's arguments filed October 31, 2025 have been fully considered but they are not persuasive. Applicant argues that the number of possible quadruple mutants from the 52 substitutions is estimated to be more than 270,000 and therefore, the skilled artisan would not envisage a xyloglucanase variant with the four substitutions 111Q+123P+129T+159M. This is not found persuasive. MPEP 2144.08. II. A. 4. (a) states that “[t]here is no absolute correlation between the size of the prior art genus and a conclusion of obviousness.” In the instant case, Lant discloses introducing one to several amino acid substitutions, such as 111Q + 123P + 129T + 159M, into a Paenibacillus polymyxa xyloglucanase, resulting in xyloglucanase variants have improved stability in detergent compositions ([0015] and [0341]). Claims 22-25 and 34-38 of the instant application are directed to a xyloglucanase variant comprising the four recited 111+123+129+159/111Q + 123P + 129T + 159M amino acid substitutions and having at least 80-95% to SEQ ID NO:2. Therefore, the claims of the instant application do not preclude introducing other amino acid substitutions disclosed by Lant. Several or all of 52 amino acid substitutions can be introduced into the xyloglucanase of Gori. Hence the rejection has been maintained. Claim(s) 22-25 and 34-38 is/are rejected under 35 U.S.C. 103 as being unpatentable over Gori (WO 2018/184816 – form PTO-1449) and Besenmatter (US 2011/0092409 - form PTO-1449). Regarding claims 22 and 24-25, Gori discloses a Paenibacillus polymyxa xyloglucanase of SEQ ID NO:87 having 100% sequence identity to the xyloglucanase of SEQ ID NO:2 of the instant application (page 29, lines 3-10 and see the sequence alignment below). The xyloglucanase of SEQ ID NO:87 of Gori has 68H, 92V, 118A, 156Y, 200P and 331F amino acid substitutions compared to the xyloglucanase of SEQ ID NO:1 of the instant application. Regarding claims 37-38, Gori discloses a detergent composition comprising the xyloglucanase in the form of a gel or liquid (page 28, line 36 through page 29, line 10 and page 91, line 32 through page 92. Line 11). Gori does not disclose a xyloglucanase variant of SEQ ID NO:87 comprising 111Q + 123P + 129T + 159M amino acid substitutions. Regarding claims 22-23, Besenmatter discloses introducing 111Q + 123P + 129T + 159M amino acid substitutions into a Paenibacillus polymyxa xyloglucanase ([0073]). Besenmatter discloses that the resulting xyloglucanase variants have improved stability in detergent compositions ([0009]). Regarding claims 34-36, introducing the 111Q + 123P + 129T + 159M amino acid substitutions into the xyloglucanase of Gori results in a xyloglucanase variant having at least 95% but less than 100% sequence identity to SEQ ID NO:2 of the instant application. Regarding claims 37-38, Besenmatter discloses a detergent composition comprising the xyloglucanase variant in the form of a gel or liquid ([0009] and [0127-[0128]). Therefore, in combining the teachings of Gori and Besenmatter, it would have been obvious to one having ordinary skill in the art before the claimed invention was effectively filed to introduce 111Q + 123P + 129T + 159M amino acid substitutions into the xyloglucanase of Gori. One having ordinary skill in the art would have been motivated to introduce the 111Q + 123P + 129T + 159M amino acid substitutions in order to improve the stability of the xyloglucanase of Gori in a detergent composition. One having ordinary skill in the art would have had a reasonable expectation of success since Gori discloses a Paenibacillus polymyxa xyloglucanase and Besenmatter discloses improving the stability of Paenibacillus polymyxa xyloglucanase in a detergent composition by introducing 111Q + 123P + 129T + 159M amino acid substitutions. Using the known technique of introducing amino acid substitutions (111Q + 123P + 129T + 159M) in Paenibacillus polymyxa xyloglucanase for improving stability of Paenibacillus polymyxa xyloglucanase in a detergent composition would have been obvious to one of ordinary skill. The rationale supporting that the claims would have been obvious is that a method of enhancing a particular class of devices (Paenibacillus polymyxa xyloglucanase in a detergent composition) has been made part of the ordinary capabilities of one skilled in the art based upon the teaching of such improvement in other situations. One of ordinary skill in the art would have been capable of applying this known method of enhancement (introducing 111Q + 123P + 129T + 159M amino acid substitutions) to a “base” device (Paenibacillus polymyxa xyloglucanase) in the prior art and the results would have been predictable to one of ordinary skill in the art. Therefore, the above references render claims 22-25 and 34-38 prima facie obvious. Applicant's arguments filed October 31, 2025 have been fully considered but they are not persuasive. Applicant argues that the number of possible quadruple mutants from the 52 substitutions is estimated to be more than 270,000 and therefore, the skilled artisan would not envisage a xyloglucanase variant with the four substitutions 111Q+123P+129T+159M. This is not found persuasive. MPEP 2144.08. II. A. 4. (a) states that “[t]here is no absolute correlation between the size of the prior art genus and a conclusion of obviousness.” In the instant case, Besenmatter discloses introducing several amino acid substitutions, such as 111Q + 123P + 129T + 159M, into a Paenibacillus polymyxa xyloglucanase, resulting in xyloglucanase variants have improved stability in detergent compositions ([0009] and [0073]). Claims 22-25 and 34-38 are directed to a xyloglucanase variant comprising the four recited 111+123+129+159/111Q + 123P + 129T + 159M amino acid substitutions and having at least 80-95% to SEQ ID NO:2. Therefore, the claims of the instant application do not preclude introducing other amino acid substitutions disclosed by Besenmatter. Several or all of 52 amino acid substitutions can be introduced into the xyloglucanase of Gori. Hence the rejection has been maintained. Conclusion Claims 22-40 are pending. Claims 36-33 and 39-40 are withdrawn. Claims 22-25 and 34-38 are rejected. THIS ACTION IS MADE FINAL. Applicant is reminded of the extension of time policy as set forth in 37 CFR 1.136(a). A shortened statutory period for reply to this final action is set to expire THREE MONTHS from the mailing date of this action. In the event a first reply is filed within TWO MONTHS of the mailing date of this final action and the advisory action is not mailed until after the end of the THREE-MONTH shortened statutory period, then the shortened statutory period will expire on the date the advisory action is mailed, and any nonprovisional extension fee (37 CFR 1.17(a)) pursuant to 37 CFR 1.136(a) will be calculated from the mailing date of the advisory action. In no event, however, will the statutory period for reply expire later than SIX MONTHS from the mailing date of this final action. Any inquiry concerning this communication or earlier communications from the examiner should be directed to YONG D PAK whose telephone number is (571)272-0935. The examiner can normally be reached M-Th: 5:30 am - 3:30 pm. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Robert Mondesi can be reached on 408-918-7584. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /YONG D PAK/Primary Examiner, Art Unit 1652 Sequence alignment between the xyloglucanase of SEQ ID NO:2 of the instant application (“Qy”) and the xyloglucanase of SEQ ID NO:3 of Lant (“Db”) US-12-478-793-3 Filing date in PALM: 2009-06-05 Sequence 3, US/12478793 Publication No. US20090312221A1 GENERAL INFORMATION APPLICANT: THE PROCTER AND GAMBLE COMPANY TITLE OF INVENTION: DETERGENT COMPOSITION COMPRISING A VARIANT OF A FAMILY 44 XYLOGLUCANASE TITLE OF INVENTION: VARIANT FILE REFERENCE: CM3305L CURRENT APPLICATION NUMBER: US/12/478,793 CURRENT FILING DATE: 2009-06-05 NUMBER OF SEQ ID NOS: 7 SEQ ID NO 3 LENGTH: 524 TYPE: PRT ORGANISM: Paenibacillus polymyxa Query Match 98.2%; Score 2735; Length 524; Best Local Similarity 98.7%; Matches 517; Conservative 0; Mismatches 7; Indels 0; Gaps 0; Qy 1 VVHGQTAKTITIKVDTFKDRKPISPYIYGTNQDLAGDENMAARRLGGNRMTGYNWENNMS 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 VVHGQTAKTITIKVDTFKDRKPISPYIYGTNQDLAGDENMAARRLGGNRMTGYNWENNMS 60 Qy 61 NAGSDWQHSSDNYLCSNGGLTQAECEKPGAVVTSFHDQSLKLGTYSLVTLPMAGYVAADG 120 ||||||| ||||||||||||||||||||||| ||||||||||||||||||||||||| || Db 61 NAGSDWQQSSDNYLCSNGGLTQAECEKPGAVTTSFHDQSLKLGTYSLVTLPMAGYVAKDG 120 Qy 121 NGSVQESEAAPSARWNQVVNAKNAPFQLQPDLNDNYVYVDEFVHFLVNKYGTASTKAGVK 180 |||||||| |||||||||||||||||||||||||| |||||||||||||||||||||||| Db 121 NGSVQESEKAPSARWNQVVNAKNAPFQLQPDLNDNRVYVDEFVHFLVNKYGTASTKAGVK 180 Qy 181 GYALDNEPALWSHTHPRIHPEKVGAKELVDRSVSLSKAVKAIDAGAEVFGPVLYGFGAYK 240 ||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||| Db 181 GYALDNEPALWSHTHPRIHGEKVGAKELVDRSVSLSKAVKAIDAGAEVFGPVLYGFGAYK 240 Qy 241 DLQTAPDWDSVKGNYSWFVDYYLDQMRLSSQVEGKRLLDVFDVHWYPEAMGGGIRITNEV 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 DLQTAPDWDSVKGNYSWFVDYYLDQMRLSSQVEGKRLLDVFDVHWYPEAMGGGIRITNEV 300 Qy 301 GNDETKKARMQAPRTLWDPTYKEDSWIAQWFSEFLPILPRLKQSVDKYYPGTKLAMTEYS 360 |||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||| Db 301 GNDETKKARMQAPRTLWDPTYKEDSWIAQWNSEFLPILPRLKQSVDKYYPGTKLAMTEYS 360 Qy 361 YGGENDISGGIAMTDVLGILGKNDVYMANYWKLKDGVNNYVSAAYKLYRNYDGKNSTFGD 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 YGGENDISGGIAMTDVLGILGKNDVYMANYWKLKDGVNNYVSAAYKLYRNYDGKNSTFGD 420 Qy 421 TSVSAQTSDIVNSSVHASVTNASDKELHLVVMNKSMDSAFDAQFDLSGAKTYISGKVWGF 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 421 TSVSAQTSDIVNSSVHASVTNASDKELHLVVMNKSMDSAFDAQFDLSGAKTYISGKVWGF 480 Qy 481 DKNSSQIKEAAPITQISGNRFTYTVPPLTAYHIVLTTGNDTSPV 524 |||||||||||||||||||||||||||||||||||||||||||| Db 481 DKNSSQIKEAAPITQISGNRFTYTVPPLTAYHIVLTTGNDTSPV 524 Sequence alignment between the xyloglucanase of SEQ ID NO:2 of the instant application (“Qy”) and the xyloglucanase of SEQ ID NO:3 of Besenmatter (“Db”) US-12-995-706-3 Filing date in PALM: 2010-12-14 Sequence 3, US/12995706 Publication No. US20110092409A1 GENERAL INFORMATION APPLICANT: Besenmatter, Werner APPLICANT: Peter, Esben Friis APPLICANT: Gibson, Keith APPLICANT: Rasmussen, Frank Winther APPLICANT: Skjoet, Michael TITLE OF INVENTION: vARIANTS OF FAMILY 44 XYLOGLUCANASE FILE REFERENCE: 11363-US-PCT CURRENT APPLICATION NUMBER: US/12/995,706 CURRENT FILING DATE: 2010-12-02 PRIOR APPLICATION NUMBER: PCT/EP2009/056875 PRIOR FILING DATE: 2009-06-04 PRIOR APPLICATION NUMBER: EP 08157769.4 PRIOR FILING DATE: 2008-06-06 PRIOR APPLICATION NUMBER: US 61/059,832 PRIOR FILING DATE: 2008-06-09 NUMBER OF SEQ ID NOS: 7 SEQ ID NO 3 LENGTH: 524 TYPE: PRT ORGANISM: Paenibacillus polymyxa Query Match 98.2%; Score 2735; Length 524; Best Local Similarity 98.7%; Matches 517; Conservative 0; Mismatches 7; Indels 0; Gaps 0; Qy 1 VVHGQTAKTITIKVDTFKDRKPISPYIYGTNQDLAGDENMAARRLGGNRMTGYNWENNMS 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 VVHGQTAKTITIKVDTFKDRKPISPYIYGTNQDLAGDENMAARRLGGNRMTGYNWENNMS 60 Qy 61 NAGSDWQHSSDNYLCSNGGLTQAECEKPGAVVTSFHDQSLKLGTYSLVTLPMAGYVAADG 120 ||||||| ||||||||||||||||||||||| ||||||||||||||||||||||||| || Db 61 NAGSDWQQSSDNYLCSNGGLTQAECEKPGAVTTSFHDQSLKLGTYSLVTLPMAGYVAKDG 120 Qy 121 NGSVQESEAAPSARWNQVVNAKNAPFQLQPDLNDNYVYVDEFVHFLVNKYGTASTKAGVK 180 |||||||| |||||||||||||||||||||||||| |||||||||||||||||||||||| Db 121 NGSVQESEKAPSARWNQVVNAKNAPFQLQPDLNDNRVYVDEFVHFLVNKYGTASTKAGVK 180 Qy 181 GYALDNEPALWSHTHPRIHPEKVGAKELVDRSVSLSKAVKAIDAGAEVFGPVLYGFGAYK 240 ||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||| Db 181 GYALDNEPALWSHTHPRIHGEKVGAKELVDRSVSLSKAVKAIDAGAEVFGPVLYGFGAYK 240 Qy 241 DLQTAPDWDSVKGNYSWFVDYYLDQMRLSSQVEGKRLLDVFDVHWYPEAMGGGIRITNEV 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 DLQTAPDWDSVKGNYSWFVDYYLDQMRLSSQVEGKRLLDVFDVHWYPEAMGGGIRITNEV 300 Qy 301 GNDETKKARMQAPRTLWDPTYKEDSWIAQWFSEFLPILPRLKQSVDKYYPGTKLAMTEYS 360 |||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||| Db 301 GNDETKKARMQAPRTLWDPTYKEDSWIAQWNSEFLPILPRLKQSVDKYYPGTKLAMTEYS 360 Qy 361 YGGENDISGGIAMTDVLGILGKNDVYMANYWKLKDGVNNYVSAAYKLYRNYDGKNSTFGD 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 YGGENDISGGIAMTDVLGILGKNDVYMANYWKLKDGVNNYVSAAYKLYRNYDGKNSTFGD 420 Qy 421 TSVSAQTSDIVNSSVHASVTNASDKELHLVVMNKSMDSAFDAQFDLSGAKTYISGKVWGF 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 421 TSVSAQTSDIVNSSVHASVTNASDKELHLVVMNKSMDSAFDAQFDLSGAKTYISGKVWGF 480 Qy 481 DKNSSQIKEAAPITQISGNRFTYTVPPLTAYHIVLTTGNDTSPV 524 |||||||||||||||||||||||||||||||||||||||||||| Db 481 DKNSSQIKEAAPITQISGNRFTYTVPPLTAYHIVLTTGNDTSPV 524 Sequence alignment between the xyloglucanase of SEQ ID NO:2 of the instant application (“Qy”) and the xyloglucanase of SEQ ID NO:87 of Gori (“Db”) ID BFS75874 standard; protein; 524 AA. XX AC BFS75874; XX DT 29-NOV-2018 (first entry) XX DE Paenibacillus polymyxa xylanase mature polypeptide, SEQ ID 87. XX KW Endo 1 4 beta xylanase; biofilm; surfactant; textile; xylanase. XX OS Paenibacillus polymyxa. XX CC PN WO2018184816-A1. XX CC PD 11-OCT-2018. XX CC PF 16-MAR-2018; 2018WO-EP056730. XX PR 06-APR-2017; 2017EP-00165343. XX CC PA (NOVO ) NOVOZYMES AS. XX CC PI Gori K; XX DR WPI; 2018-781692/70. XX CC PT Cleaning composition used for deep cleaning of item, such as textile or CC PT surface using kit, comprises deoxyribonuclease (DNase), carbohydrase and CC PT cleaning component, where the carbohydrase is cellulase, amylase, CC PT mannanase or xylanase. XX CC PS Claim 5; SEQ ID NO 87; 108pp; English. XX CC The present invention relates to a novel cleaning composition useful for CC deep cleaning of an item e.g., textile. The cleaning composition CC comprises DNase, at least one carbohydrase and a cleaning component, CC wherein the carbohydrase is a cellulase, an amylase, a mannanase or a CC xylanase. The invention further relates to: (1) a method for formulating CC the cleaning composition; (2) a kit intended for deep cleaning; (3) a CC method for deep cleaning of the item. The cleaning composition of the CC invention is also used for removing biofilm or components. The present CC sequence represents a Paenibacillus polymyxa xylanase mature polypeptide, CC used in the invention for preparing the cleaning composition used for CC deep cleaning of the item. XX SQ Sequence 524 AA; Query Match 100.0%; Score 2784; Length 524; Best Local Similarity 100.0%; Matches 524; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 VVHGQTAKTITIKVDTFKDRKPISPYIYGTNQDLAGDENMAARRLGGNRMTGYNWENNMS 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 VVHGQTAKTITIKVDTFKDRKPISPYIYGTNQDLAGDENMAARRLGGNRMTGYNWENNMS 60 Qy 61 NAGSDWQHSSDNYLCSNGGLTQAECEKPGAVVTSFHDQSLKLGTYSLVTLPMAGYVAADG 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 NAGSDWQHSSDNYLCSNGGLTQAECEKPGAVVTSFHDQSLKLGTYSLVTLPMAGYVAADG 120 Qy 121 NGSVQESEAAPSARWNQVVNAKNAPFQLQPDLNDNYVYVDEFVHFLVNKYGTASTKAGVK 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 NGSVQESEAAPSARWNQVVNAKNAPFQLQPDLNDNYVYVDEFVHFLVNKYGTASTKAGVK 180 Qy 181 GYALDNEPALWSHTHPRIHPEKVGAKELVDRSVSLSKAVKAIDAGAEVFGPVLYGFGAYK 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 GYALDNEPALWSHTHPRIHPEKVGAKELVDRSVSLSKAVKAIDAGAEVFGPVLYGFGAYK 240 Qy 241 DLQTAPDWDSVKGNYSWFVDYYLDQMRLSSQVEGKRLLDVFDVHWYPEAMGGGIRITNEV 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 DLQTAPDWDSVKGNYSWFVDYYLDQMRLSSQVEGKRLLDVFDVHWYPEAMGGGIRITNEV 300 Qy 301 GNDETKKARMQAPRTLWDPTYKEDSWIAQWFSEFLPILPRLKQSVDKYYPGTKLAMTEYS 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 GNDETKKARMQAPRTLWDPTYKEDSWIAQWFSEFLPILPRLKQSVDKYYPGTKLAMTEYS 360 Qy 361 YGGENDISGGIAMTDVLGILGKNDVYMANYWKLKDGVNNYVSAAYKLYRNYDGKNSTFGD 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 YGGENDISGGIAMTDVLGILGKNDVYMANYWKLKDGVNNYVSAAYKLYRNYDGKNSTFGD 420 Qy 421 TSVSAQTSDIVNSSVHASVTNASDKELHLVVMNKSMDSAFDAQFDLSGAKTYISGKVWGF 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 421 TSVSAQTSDIVNSSVHASVTNASDKELHLVVMNKSMDSAFDAQFDLSGAKTYISGKVWGF 480 Qy 481 DKNSSQIKEAAPITQISGNRFTYTVPPLTAYHIVLTTGNDTSPV 524 |||||||||||||||||||||||||||||||||||||||||||| Db 481 DKNSSQIKEAAPITQISGNRFTYTVPPLTAYHIVLTTGNDTSPV 524
Read full office action

Prosecution Timeline

Feb 20, 2023
Application Filed
Jul 30, 2025
Non-Final Rejection — §102, §103
Oct 31, 2025
Response Filed
Feb 03, 2026
Final Rejection — §102, §103 (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12595472
MANNANASE VARIANTS
2y 5m to grant Granted Apr 07, 2026
Patent 12590301
METHODS FOR SAFE AND EFFECTIVE THROMBOLYSIS USING SEQUENTIAL ADMINISTRATION OF TISSUE PLASMINOGEN ACTIVATOR AND MUTANT PRO-UROKINASE
2y 5m to grant Granted Mar 31, 2026
Patent 12570964
Bacterium And Obtaining Method And Application Thereof
2y 5m to grant Granted Mar 10, 2026
Patent 12559734
Reverse Transcriptase Mutants with Increased Activity and Thermostability
2y 5m to grant Granted Feb 24, 2026
Patent 12540160
METHODS FOR THE PURIFICATION OF REFOLDED FC-PEPTIDE FUSION PROTEIN
2y 5m to grant Granted Feb 03, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

AI Strategy Recommendation

Get an AI-powered prosecution strategy using examiner precedents, rejection analysis, and claim mapping.
Powered by AI — typically takes 5-10 seconds

Prosecution Projections

3-4
Expected OA Rounds
74%
Grant Probability
88%
With Interview (+14.0%)
3y 0m
Median Time to Grant
Moderate
PTA Risk
Based on 924 resolved cases by this examiner. Grant probability derived from career allow rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month