Prosecution Insights
Last updated: July 17, 2026
Application No. 18/045,012

NOVEL RHODOPSIN MUTANTS

Non-Final OA §102§112
Filed
Oct 07, 2022
Priority
Oct 08, 2021 — JP 2021-165940
Examiner
BOESEN, CHRISTIAN C
Art Unit
1684
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
Shizuoka Prefectural University Corporation
OA Round
1 (Non-Final)
76%
Grant Probability
Favorable
1-2
OA Rounds
0m
Est. Remaining
97%
With Interview

Examiner Intelligence

Grants 76% — above average
76%
Career Allowance Rate
475 granted / 628 resolved
+15.6% vs TC avg
Strong +21% interview lift
Without
With
+21.3%
Interview Lift
resolved cases with interview
Typical timeline
3y 7m
Avg Prosecution
23 currently pending
Career history
651
Total Applications
across all art units

Statute-Specific Performance

§101
3.0%
-37.0% vs TC avg
§103
41.0%
+1.0% vs TC avg
§102
15.9%
-24.1% vs TC avg
§112
9.8%
-30.2% vs TC avg
Black line = Tech Center average estimate • Based on career data from 628 resolved cases

Office Action

§102 §112
Notice of Pre-AIA or AIA Status The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . DETAILED ACTION This Non-Final Office Action is responsive to the communication received 01/06/2026. Election/Restrictions Applicant’s election without traverse in the Reply filed on 01/06/2026 of Group II, claims 2-3 is acknowledged. The Restriction/Election Requirements are deemed proper and are made FINAL. Claims 1-10 are pending. Claims 1 and 4-10 are withdrawn from further consideration pursuant to 37 CFR 1.142(b) as being drawn to a nonelected invention, there being no allowable generic or linking claim. Election was made without traverse in the Reply filed on 01/06/2026. Claims 2-3 are under examination in this Office Action. Claim Rejections - 35 USC § 112 - (d) The following is a quotation of 35 U.S.C. 112(d): (d) REFERENCE IN DEPENDENT FORMS.—Subject to subsection (e), a claim in dependent form shall contain a reference to a claim previously set forth and then specify a further limitation of the subject matter claimed. A claim in dependent form shall be construed to incorporate by reference all the limitations of the claim to which it refers. The following is a quotation of the fourth paragraph of 35 U.S.C. 112 (pre-AIA ): Subject to the [fifth paragraph of 35 U.S.C. 112], a claim in dependent form shall contain a reference to a claim previously set forth and then specify a further limitation of the subject matter claimed. A claim in dependent form shall be construed to incorporate by reference all the limitations of the claim to which it refers. Claim 3 is/are rejected under 35 U.S.C. 112(d) or 35 U.S.C. 112 (pre-AIA ), fourth paragraph, as being of improper dependent form for failing to further limit the subject matter of the claim upon which it depends, or for failing to include all the limitations of the claim upon which it depends. Claim 2 is directed towards SEQ ID NOs 12, 4 and 8 and Claim 3 is directed towards SEQ ID NOs 4 to 7, 10 to 11 and 13, thus Claim 3 broadens the limitations of claim 2 by adding additional SEQ ID NOs not recited in independent claim 2.. Applicant may cancel the claim(s), amend the claim(s) to place the claim(s) in proper dependent form, rewrite the claim(s) in independent form, or present a sufficient showing that the dependent claim(s) complies with the statutory requirements. Claim Rejections - 35 USC § 102 The following is a quotation of the appropriate paragraphs of 35 U.S.C. 102 that form the basis for the rejections under this section made in this Office action: A person shall be entitled to a patent unless – (a)(1) the claimed invention was patented, described in a printed publication, or in public use, on sale or otherwise available to the public before the effective filing date of the claimed invention. Claim 2 is rejected under 35 U.S.C. 102(a)(1) as being anticipated by McCarren et al. (2007) Amino Acid Sequence Search Sequence 8 Result 1 UniProt downloaded 01/26/2026 pages 1 to 16 (hereinafter referred to as "McCarren") It is noted that In re Best (195 USPQ 430) and In re Fitzgerald (205 USPQ 594) discuss the support of rejections wherein the prior art discloses subject matter which there is reason to believe inherently includes functions that are newly cited or is identical to a product instantly claimed. In such a situation the burden is shifted to the applicants to "prove that subject matter shown to be in the prior art does not possess characteristic relied on" (205 USPQ 594, second column, first full paragraph). Claim 2 include limitations of and is capable of exerting proton translocation activity higher than that of a rhodopsin having an amino acid sequence set forth in SEQ ID NO: 3 that is/are reasonably interpreted as at best either a characteristic or an intended use limitation. With regards to claim 2, McCarren teaches: a) as in claim 2, SEQ ID NO 8 (see entire document especially pages 15-16). GenCore version 6.5.2 Copyright (c) 1993 - 2026 Biocceleration Ltd. OM protein - protein search, using sw model Run on: January 26, 2026, 09:56:17 ; Search time 46 Seconds (without alignments) 390720.870 Million cell updates/sec Title: US-18-045-012B-4 Perfect score: 1305 Sequence: 1 MTILSKKGFKVALATVAAGI..........NKIAFGVIIWNVAVTESESK 256 Scoring table: BLOSUM62DX Gapop 10.0 , Gapext 0.5 Searched: 182486956 unique seqs, 69584646596 residues Total number of hits satisfying chosen parameters: 182486956 Minimum DB seq length: 0 Maximum DB seq length: 2000000000 Post-processing: Minimum Match 0% Maximum Match 100% Listing first 150 summaries Database : UniProt_202504:* RESULT 1 A4GHN5_9BACT Query Match 100.0%; Score 1305; Length 256; Best Local Similarity 99.2%; Matches 254; Conservative 2; Mismatches 0; Indels 0; Gaps 0; Qy 1 MTILSKKGFKVALATVAAGILPASAHAATLXPNDYVGISFWLISMALIAATAFFFIETTR 60 ||||||||||||||||||||||||||||||:||||||||||||||||||||||||||||| Db 1 MTILSKKGFKVALATVAAGILPASAHAATLAPNDYVGISFWLISMALIAATAFFFIETTR 60 Qy 61 VEGKWKTSLTVSGLVTLVAAVHYFYMRDVWVSTGESPTVYRYIDWLITVPLLMVEFYLIL 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 VEGKWKTSLTVSGLVTLVAAVHYFYMRDVWVSTGESPTVYRYIDWLITVPLLMVEFYLIL 120 Qy 121 RAITKVSXGIFWRLMIGTVVMLVGGYAGEIGYISATLGFIIGMLGWAYILYEIFAGEASK 180 |||||||:|||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 RAITKVSIGIFWRLMIGTVVMLVGGYAGEIGYISATLGFIIGMLGWAYILYEIFAGEASK 180 Qy 181 VAADEAPASVQSAFSTMRWIVTIGWAIYPLGYFMGYMNGAVSDEALNIIYNFADVWNKIA 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 VAADEAPASVQSAFSTMRWIVTIGWAIYPLGYFMGYMNGAVSDEALNIIYNFADVWNKIA 240 Qy 241 FGVIIWNVAVTESESK 256 |||||||||||||||| Db 241 FGVIIWNVAVTESESK 256 Thus, McCarren anticipates the present claims. Conclusion No claim is allowed. Any inquiry concerning this communication or earlier communications from the Examiner should be directed to Christian Boesen whose telephone number is 571-270-1321. The Examiner can normally be reached on Monday-Friday 9:00 AM to 5:00 PM. If attempts to reach the Examiner by telephone are unsuccessful, the Examiner’s supervisor, Heather Calamita can be reached at 571-272-2876. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of an application may be obtained from the Patent Application Information Retrieval (PAIR) system. Status information for published applications may be obtained from either Private PAIR or Public PAIR. Status information for unpublished applications is available through Private PAIR only. For more information about the PAIR system, see http://pair-direct.uspto.gov. Should you have questions on access to the Private PAIR system, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative or access to the automated information system, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice . /CHRISTIAN C BOESEN/Primary Examiner, Art Unit 1684
Read full office action

Prosecution Timeline

Oct 07, 2022
Application Filed
Apr 24, 2026
Non-Final Rejection mailed — §102, §112 (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12680195
METHOD FOR PROMOTING DIVERSIFICATION OF ANTIBODY VARIABLE REGION
3y 6m to grant Granted Jul 14, 2026
Patent 12668893
Methods of Analyzing Cell Free Nucleic Acids and Applications Thereof
3y 10m to grant Granted Jun 30, 2026
Patent 12668891
CRISPR nuclease off-target detection by sequencing (CROFT-Seq)
3y 1m to grant Granted Jun 30, 2026
Patent 12649980
THREE-DIMENTIONAL SURFACE FOR PROTEIN AND SMALL MOLECULE MICROARRAYS
4y 2m to grant Granted Jun 09, 2026
Patent 12644203
NOVEL CELLULAR PHENOTYPE SCREENING METHOD
3y 2m to grant Granted Jun 02, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

Strategy Recommendation AI-generated — please review before filing

Get a prosecution strategy drawn from examiner precedents, rejection analysis, and claim mapping.
Typically takes 5-10 seconds — AI-generated, attorney review required before filing

Prosecution Projections

1-2
Expected OA Rounds
76%
Grant Probability
97%
With Interview (+21.3%)
3y 7m (~0m remaining)
Median Time to Grant
Low
PTA Risk
Based on 628 resolved cases by this examiner. Grant probability derived from career allowance rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month