Prosecution Insights
Last updated: April 19, 2026
Application No. 18/048,986

METHODS OF USING ANTI-CD79B IMMUNOCONJUGATES

Non-Final OA §102§103
Filed
Oct 24, 2022
Examiner
GODDARD, LAURA B
Art Unit
1642
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
Genentech Inc.
OA Round
1 (Non-Final)
51%
Grant Probability
Moderate
1-2
OA Rounds
3y 5m
To Grant
65%
With Interview

Examiner Intelligence

Grants 51% of resolved cases
51%
Career Allow Rate
636 granted / 1254 resolved
-9.3% vs TC avg
Moderate +15% lift
Without
With
+14.6%
Interview Lift
resolved cases with interview
Typical timeline
3y 5m
Avg Prosecution
66 currently pending
Career history
1320
Total Applications
across all art units

Statute-Specific Performance

§101
8.9%
-31.1% vs TC avg
§103
27.8%
-12.2% vs TC avg
§102
22.8%
-17.2% vs TC avg
§112
24.1%
-15.9% vs TC avg
Black line = Tech Center average estimate • Based on career data from 1254 resolved cases

Office Action

§102 §103
DETAILED ACTION Notice of Pre-AIA or AIA Status The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . 1. The Election filed December 19, 2025, in response to the Office Action of September 23, 2025, is acknowledged and has been entered. Applicants elected without traverse Group I and the species of immunoconjugate polatuzumab vedotin-piiq. Claims 1, 3, 6, 10-12, 20-24, 26, 29-31, 33-35, 38, 70, 102, 122, 128, 129, 145, 146, 150, 151, 193, 231, 269, 320, 321, 325 are pending. Claims 145, 146, 150, 151, 193, 231, 269, 320, 321, 325 have been withdrawn from further consideration by the examiner under 35 CFR 1.142(b) as being drawn to non-elected inventions. Claims 1, 3, 6, 10-12, 20-24, 26, 29-31, 33, 34, 38, 70, 102, 122, 128, 129 are currently under prosecution as drawn to the elected species of immunoconjugate polatuzumab vedotin-piiq. Note: The terms “polatuzumab vedotin” and “polatuzumab vedotin-piiq” refer to the same immunoconjugate. See “Alternative names” for polatuzumab vedotin-piiq in the Table on page 1469 of Deeks (Drugs, 2019, 79:1467-1475). Claim Rejections - 35 USC § 102 The following is a quotation of the appropriate paragraphs of 35 U.S.C. 102 that form the basis for the rejections under this section made in this Office action: A person shall be entitled to a patent unless – (a)(1) the claimed invention was patented, described in a printed publication, or in public use, on sale, or otherwise available to the public before the effective filing date of the claimed invention. 2. Claim(s) 1, 3, 6, 10-12, 20-24, 26, 29-31, 33-35, 38, 70, 102, 128, and 129 are rejected under 35 U.S.C. 102(a)(1) as being anticipated by US Patent 2017/0304438, Polson et al. Polson teaches a method for treating relapsed/refractory (R/R) follicular lymphoma (FL) in a human comprising administering to the human an effective amount of: (a) polatuzumab vedotin-piiq immunoconjugate; (b) venetoclax (Bcl-2 inhibitor); and (c) anti-CD20 antibody rituximab or obinituzumab (claims 1-30, 33, 35-41; [79-84]; [136-138]; [147-152]; [155-161]; [181]; Example 7 [456-463]); wherein polatuzumab is an anti-CD79b antibody comprising heavy and light chain SEQ ID NOs:36 and 38, respectively ([21-22]; [166]; claims 24 and 26), that are 100% identical to instant SEQ ID NOs:36 and 38 and comprise instant CDR SEQ ID NOs:21-26 (see sequence alignments below); wherein polatuzumab vedotin is administered intravenously (IV) to the individual at a dose of 1.8 mg/kg; the venetoclax is administered orally at a dose of 800 mg; and the obinutuzumab is administered IV at a dose of 1000 mg and on the following days of six 21-day induction cycles and in the order listed below: PNG media_image1.png 115 468 media_image1.png Greyscale PNG media_image2.png 270 412 media_image2.png Greyscale wherein the venetoclax and obinutuzumab are administered as a maintenance phase and administration of venetoclax precedes administration of obinutuzumab: PNG media_image3.png 241 412 media_image3.png Greyscale wherein maintenance therapy comprises: PNG media_image4.png 133 458 media_image4.png Greyscale and wherein inclusion criteria for treatment is: PNG media_image5.png 271 462 media_image5.png Greyscale PNG media_image6.png 149 464 media_image6.png Greyscale PNG media_image7.png 255 464 media_image7.png Greyscale Given Polson teaches administering the same claimed drugs to the same claimed patients and at the same claimed doses, routes, and regimens, the method of Polson would necessarily produce the same claimed results of: achieving complete response (CR) during or after administration of the combination; result in a complete response in at least about 55% to at least about 100% of humans during or after administration of the combination; result in an objective response in at least about 70% to at least about 100% of humans during or after administration of the combination; not result in peripheral neuropathy of Grade 3 or greater; not result in tumor lysis syndrome; result in Grade 3 or 4 adverse event in about 64%, about 59% or about 73% or less of the humans treated; result in a duration of CR at least about 1 month to about 3 months or more; result in a CR after the six 21-day cycles; result in a CR in at least 55% to about 100% of humans treated after the six 21-day cycles, wherein the CR lasts at least about 1 month to at least about 3 months or more; and achieves a CR during or after the induction phase (as recited in instant claims 1, 11, 12, 24, 26, 70, and 102). Instant SEQ ID NO:36 aligned with Polson SEQ ID NO:36 US-15-440-917-36 Filing date in PALM: 2017-02-23 Sequence 36, US/15440917 Publication No. US20170304438A1 GENERAL INFORMATION APPLICANT: GENENTECH, INC. TITLE OF INVENTION: METHODS OF USING ANTI-CD79B IMMUNOCONJUGATES FILE REFERENCE: P32333-US-4 CURRENT APPLICATION NUMBER: US/15/440,917 CURRENT FILING DATE: 2017-02-23 PRIOR APPLICATION NUMBER: 14/863,125 PRIOR FILING DATE: 2015-09-23 PRIOR APPLICATION NUMBER: 62/136,324 PRIOR FILING DATE: 2015-03-20 PRIOR APPLICATION NUMBER: 62/076,823 PRIOR FILING DATE: 2014-11-07 PRIOR APPLICATION NUMBER: 62/054,257 PRIOR FILING DATE: 2014-09-23 NUMBER OF SEQ ID NOS: 55 SEQ ID NO 36 LENGTH: 446 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: Description of Artificial Sequence: Synthetic polypeptide ALIGNMENT: Query Match 100.0%; Score 2385; Length 446; Best Local Similarity 100.0%; Matches 446; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 EVQLVESGGGLVQPGGSLRLSCAASGYTFSSYWIEWVRQAPGKGLEWIGEILPGGGDTNY 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 EVQLVESGGGLVQPGGSLRLSCAASGYTFSSYWIEWVRQAPGKGLEWIGEILPGGGDTNY 60 Qy 61 NEIFKGRATFSADTSKNTAYLQMNSLRAEDTAVYYCTRRVPIRLDYWGQGTLVTVSSAST120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 NEIFKGRATFSADTSKNTAYLQMNSLRAEDTAVYYCTRRVPIRLDYWGQGTLVTVSSAST120 Qy 121 KGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLY180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 KGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLY180 Qy 181 SLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSV240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 SLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSV240 Qy 241 FLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTY300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 FLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTY300 Qy 301 RVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTK360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 RVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTK360 Qy 361 NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG420 Qy 421 NVFSCSVMHEALHNHYTQKSLSLSPG 446 |||||||||||||||||||||||||| Db 421 NVFSCSVMHEALHNHYTQKSLSLSPG 446 Instant SEQ ID NO:38 aligned with Polson SEQ ID NO:38 US-15-440-917-38 Filing date in PALM: 2017-02-23 Sequence 38, US/15440917 Publication No. US20170304438A1 GENERAL INFORMATION APPLICANT: GENENTECH, INC. TITLE OF INVENTION: METHODS OF USING ANTI-CD79B IMMUNOCONJUGATES FILE REFERENCE: P32333-US-4 CURRENT APPLICATION NUMBER: US/15/440,917 CURRENT FILING DATE: 2017-02-23 PRIOR APPLICATION NUMBER: 14/863,125 PRIOR FILING DATE: 2015-09-23 PRIOR APPLICATION NUMBER: 62/136,324 PRIOR FILING DATE: 2015-03-20 PRIOR APPLICATION NUMBER: 62/076,823 PRIOR FILING DATE: 2014-11-07 PRIOR APPLICATION NUMBER: 62/054,257 PRIOR FILING DATE: 2014-09-23 NUMBER OF SEQ ID NOS: 55 SEQ ID NO 38 LENGTH: 218 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: Description of Artificial Sequence: Synthetic polypeptide ALIGNMENT: Query Match 100.0%; Score 1131; Length 218; Best Local Similarity 100.0%; Matches 218; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 DIQLTQSPSSLSASVGDRVTITCKASQSVDYEGDSFLNWYQQKPGKAPKLLIYAASNLES 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 DIQLTQSPSSLSASVGDRVTITCKASQSVDYEGDSFLNWYQQKPGKAPKLLIYAASNLES 60 Qy 61 GVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSNEDPLTFGQGTKVEIKRTVAAPSVF120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 GVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSNEDPLTFGQGTKVEIKRTVAAPSVF120 Qy 121 IFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLS180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 IFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLS180 Qy 181 STLTLSKADYEKHKVYACEVTHQGLSSPCTKSFNRGEC 218 |||||||||||||||||||||||||||||||||||||| Db 181 STLTLSKADYEKHKVYACEVTHQGLSSPCTKSFNRGEC 218 Claim Rejections - 35 USC § 103 The following is a quotation of 35 U.S.C. 103 which forms the basis for all obviousness rejections set forth in this Office action: A patent for a claimed invention may not be obtained, notwithstanding that the claimed invention is not identically disclosed as set forth in section 102, if the differences between the claimed invention and the prior art are such that the claimed invention as a whole would have been obvious before the effective filing date of the claimed invention to a person having ordinary skill in the art to which the claimed invention pertains. Patentability shall not be negated by the manner in which the invention was made. 4. Claim(s) 1 and 122 are rejected under 35 U.S.C. 103 as being unpatentable over US Patent 2017/0304438, Polson et al; in view of Herrera et al (Blood, 2016, 128(22):4194) and Yazdy et al (2017. Blood and Lymphatic Cancer: Targets and Therapy, 7, 73–83). Polson teaches a method for treating follicular lymphoma (FL) patients as set forth above. Polson does not teach treating the patients with G-CSF if a Grade 3 or 4 adverse event of neutropenia occurs. Herrera teaches treating R/R FL patients with combination therapy encompassing polatuzuamb vedotin administered at 1.8 mg/kg IV and either rituximab or obinutuzumab administered at 1000 mg, wherein the most common Grade 3/4 adverse events in ≥10% of FL patients were neutropenia and thrombocytopenia (Results). Yazdy teaches treating follicular lymphoma patients with obinutuzumab or rituximab combination therapies and teaches (p. 79, col. 2): “Administration of granulocyte colony stimulating factor (G-CSF) should be considered in patients with symptomatic grade 3–4 neutropenia.” It would have been prima facie obvious to one of ordinary skill in the art at the time the invention was filed to administer G-CSF if a Grade 3 or 4 adverse event of neutropenia occurred in the method of Polson. One would have been motivated to, and have a reasonable expectation of success to because Herrera teaches this adverse event occurs in FL patients treated with polatuzuamb vedotin and obinutuzumab; and Yazdy teaches G-CSF is a known treatment for Grade 3 or 4 adverse events of neutropenia in FL patients. 5. Claim(s) 1, 3, 6, 10-12, 20-24, 26, 29-31, 33-35, 38, 70, 102, 128, and 129 are rejected under 35 U.S.C. 103 as being unpatentable over US Patent 2017/0304438, Polson et al; in view of Herrera et al (Blood, 2016, 128(22):4194); and Zinzani et al (Blood, 2016, 128(22): 617). Polson teaches a method for treating R/R follicular lymphoma (FL) patients as set forth above. Polson further teaches efficacy objectives include measuring complete response (CR), partial response (PR), and objective response (CR or PR) after treatment ([151]; [422]; [424]; [452-455]). Although Polson anticipates the instantly claimed methods for the reasons stated above, Polson does not teach or demonstrate the subsequent results of: achieving complete response (CR) during or after administration of the combination; result in a complete response in at least about 55% to at least about 100% of humans during or after administration of the combination; result in an objective response in at least about 70% to at least about 100% of humans during or after administration of the combination; not result in tumor lysis syndrome; result in Grade 3 or 4 adverse event in about 64%, about 59% or about 73% or less of the humans treated; result in a duration of CR at least about 1 month to about 3 months or more; result in a CR after the six 21-day cycles; result in a CR in at least 55% to about 100% of humans treated after the six 21-day cycles, wherein the CR lasts at least about 1 month to at least about 3 months or more; and achieve a CR during or after the induction phase (as recited in instant claims 1, 11, 12, 24, 26, 70, and 102). Herrera teaches treating R/R FL patients with combination therapy encompassing polatuzuamb vedotin administered at 1.8 mg/kg IV and either rituximab or obinutuzumab administered at 1000 mg. Response was assessed after only 3 cycles of treatment. Herrera teaches the treatment resulted in an objective response rate (= complete response (CR) + partial response (PR)) of 100% in R/R FL patients (Table 2; Results). The majority of patients who achieved a CR or PR remained in response (Results). Zinzani teaches treating R/R FL patients by administering venetoclax combined with rituximab. Zinzani teaches objective response with treatment was 33% even in a highly refractory patient population, and 64% among non-refractory patients (Conclusion). Zinzani teaches only 54% to 78% of patients suffered Grade 3-4 adverse events (Table 2), and only 1-6% of patients suffered tumor lysis syndrome (Table 2, meaning most did not suffer tumor lysis syndrome). It would have been prima facie obvious to one of ordinary skill in the art at the time the invention was filed for the method of Polson to achieve complete response (CR) during or after administration of the combination; result in a complete response in at least about 55% to at least about 100% of humans during or after administration of the combination; result in an objective response in at least about 70% to at least about 100% of humans during or after administration of the combination; not result in tumor lysis syndrome; result in Grade 3 or 4 adverse event in about 64%, about 59% or about 73% or less of the humans treated; result in a duration of CR at least about 1 month to about 3 months or more; result in a CR after the six 21-day cycles; result in a CR in at least 55% to about 100% of humans treated after the six 21-day cycles, wherein the CR lasts at least about 1 month to at least about 3 months or more; and achieve a CR during or after the induction phase. One would have been motivated to, and have a reasonable expectation of success to because: (1) Polson provides motivation to achieve CR and PR as efficacy objectives; (2) Herrera teaches that treatment of R/R FL patients with a combination therapy comprising polatuzuamb vedotin and either rituximab or obinutuzumab successfully resulted in an objective response rate of 100% in R/R FL patients, wherein the majority of patients who achieved a CR or PR remained in response, providing reasonable expectation of success to achieve high CR and PR percentages and long lasting response for the method of Polson comprising polatuzuamb vedotin and rituximab or obinutuzumab combination therapies; and (3) Zinzani teaches that treatment of R/R and non-R/R FL patients with a combination therapy comprising venetoclax and rituximab successfully resulted in 33% and 64% objective response rate, respectively, as well as only 54% to 78% of patients suffering Grade 3-4 adverse events and only 1-6% of patients suffering tumor lysis syndrome, providing a reasonable expectation of success to achieve the response rates and minimal Grade 3-4 adverse events and tumor lysis syndrome for the method of Polson comprising venetoclax and rituximab or anti-CD20 antibody combination therapies. 6. Claim(s) 122 is rejected under 35 U.S.C. 103 as being unpatentable over US Patent 2017/0304438, Polson et al; Herrera et al (Blood, 2016, 128(22):4194); and Zinzani et al (Blood, 2016, 128(22): 617); as applied to claims 1, 3, 6, 10-12, 20-24, 26, 29-31, 33-35, 38, 70, 102, 128, and 129 above, and further in view of Herrera et al (Blood, 2016, 128(22):4194); and Zinzani et al (Blood, 2016, 128(22): 617). Polson, Herrera, and Zinzanzi (the combined references) teach a method for treating R/R follicular lymphoma (FL) patients and achieving the CR after treatment, as set forth above. The combined references do not teach treating the patients with G-CSF if a Grade 3 or 4 adverse event of neutropenia occurs. Herrera and Yazdy teach as set forth above. It would have been prima facie obvious to one of ordinary skill in the art at the time the invention was filed to administer G-CSF if a Grade 3 or 4 adverse event of neutropenia occurred in the method of the combined references. One would have been motivated to, and have a reasonable expectation of success to because Herrera teaches this adverse event occurs in FL patients treated with polatuzuamb vedotin and obinutuzumab; and Yazdy teaches G-CSF is a known treatment for Grade 3 or 4 adverse events of neutropenia in FL patients. 7. Conclusion: No claim is allowed. 8. Any inquiry concerning this communication or earlier communications from the examiner should be directed to LAURA B GODDARD whose telephone number is (571)272-8788. The examiner can normally be reached Mon-Fri, 7am-3:30pm. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Samira Jean-Louis can be reached at 571-270-3503. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /Laura B Goddard/ Primary Examiner, Art Unit 1642
Read full office action

Prosecution Timeline

Oct 24, 2022
Application Filed
Feb 13, 2026
Non-Final Rejection — §102, §103 (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12595308
ANTI-B7H3 ANTIBODY AND USE THEREOF
2y 5m to grant Granted Apr 07, 2026
Patent 12582643
TASQUINIMOD OR A PHARMACEUTICALLY ACCEPTABLE SALT THEREOF FOR USE IN COMBINATION THERAPY
2y 5m to grant Granted Mar 24, 2026
Patent 12577318
HUMANIZED ANTI-CA IX ANTIBODIES AND METHODS OF THEIR USE
2y 5m to grant Granted Mar 17, 2026
Patent 12570731
METHODS FOR TREATING CANCER WITH AN ANTI-APO B100 ANTIBODY
2y 5m to grant Granted Mar 10, 2026
Patent 12565531
BISPECIFIC FUSION PROTEIN FOR TUMOR TREATMENT
2y 5m to grant Granted Mar 03, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

AI Strategy Recommendation

Get an AI-powered prosecution strategy using examiner precedents, rejection analysis, and claim mapping.
Powered by AI — typically takes 5-10 seconds

Prosecution Projections

1-2
Expected OA Rounds
51%
Grant Probability
65%
With Interview (+14.6%)
3y 5m
Median Time to Grant
Low
PTA Risk
Based on 1254 resolved cases by this examiner. Grant probability derived from career allow rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month