Prosecution Insights
Last updated: April 19, 2026
Application No. 18/052,172

METHODS OF TREATING CANCERS AND ENHANCING EFFICACY OF GPRC5DXCD3 BISPECIFIC ANTIBODIES

Non-Final OA §103§112§DP
Filed
Nov 02, 2022
Examiner
GUSTILO, ESTELLA M
Art Unit
1646
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
Janssen Biotech Inc.
OA Round
1 (Non-Final)
53%
Grant Probability
Moderate
1-2
OA Rounds
3y 4m
To Grant
87%
With Interview

Examiner Intelligence

Grants 53% of resolved cases
53%
Career Allow Rate
28 granted / 53 resolved
-7.2% vs TC avg
Strong +34% interview lift
Without
With
+34.4%
Interview Lift
resolved cases with interview
Typical timeline
3y 4m
Avg Prosecution
41 currently pending
Career history
94
Total Applications
across all art units

Statute-Specific Performance

§101
2.1%
-37.9% vs TC avg
§103
32.2%
-7.8% vs TC avg
§102
13.4%
-26.6% vs TC avg
§112
26.2%
-13.8% vs TC avg
Black line = Tech Center average estimate • Based on career data from 53 resolved cases

Office Action

§103 §112 §DP
Notice of Pre-AIA or AIA Status The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . Status of the Claims Claims 1 – 20 are currently pending and are the subject of this Office Action. This is the first Office Action on the merits of the claims. Information Disclosure Statement The information disclosure statements (IDSs) submitted on 05/25/2023, 08/04/2023, 04/09/2024, 08/22/2024, 01/31/2025, 05/19/2025, 08/27/2025, and 10/21/2025 are in compliance with the provisions of 37 CFR 1.97 and have been considered. Claim Rejections - 35 USC § 112 The following is a quotation of 35 U.S.C. 112(d): (d) REFERENCE IN DEPENDENT FORMS.—Subject to subsection (e), a claim in dependent form shall contain a reference to a claim previously set forth and then specify a further limitation of the subject matter claimed. A claim in dependent form shall be construed to incorporate by reference all the limitations of the claim to which it refers. The following is a quotation of pre-AIA 35 U.S.C. 112, fourth paragraph: Subject to the following paragraph [i.e., the fifth paragraph of pre-AIA 35 U.S.C. 112], a claim in dependent form shall contain a reference to a claim previously set forth and then specify a further limitation of the subject matter claimed. A claim in dependent form shall be construed to incorporate by reference all the limitations of the claim to which it refers. Claim 6 is rejected under 35 U.S.C. 112(d) or pre-AIA 35 U.S.C. 112, 4th paragraph, as being of improper dependent form for failing to further limit the subject matter of the claim upon which it depends, or for failing to include all the limitations of the claim upon which it depends. Claim 6 depends from claim 5 and has the same scope as claim 5, and thus it fails to further limit claim 5. Applicant may cancel the claim(s), amend the claim(s) to place the claim(s) in proper dependent form, rewrite the claim(s) in independent form, or present a sufficient showing that the dependent claim(s) complies with the statutory requirements. Claim Rejections - 35 USC § 103 In the event the determination of the status of the application as subject to AIA 35 U.S.C. 102 and 103 (or as subject to pre-AIA 35 U.S.C. 102 and 103) is incorrect, any correction of the statutory basis (i.e., changing from AIA to pre-AIA ) for the rejection will not be considered a new ground of rejection if the prior art relied upon, and the rationale supporting the rejection, would be the same under either status. The following is a quotation of 35 U.S.C. 103 which forms the basis for all obviousness rejections set forth in this Office action: A patent for a claimed invention may not be obtained, notwithstanding that the claimed invention is not identically disclosed as set forth in section 102, if the differences between the claimed invention and the prior art are such that the claimed invention as a whole would have been obvious before the effective filing date of the claimed invention to a person having ordinary skill in the art to which the claimed invention pertains. Patentability shall not be negated by the manner in which the invention was made. The factual inquiries for establishing a background for determining obviousness under 35 U.S.C. 103 are summarized as follows: 1. Determining the scope and contents of the prior art. 2. Ascertaining the differences between the prior art and the claims at issue. 3. Resolving the level of ordinary skill in the pertinent art. 4. Considering objective evidence present in the application indicating obviousness or nonobviousness. This application currently names joint inventors. In considering patentability of the claims the examiner presumes that the subject matter of the various claims was commonly owned as of the effective filing date of the claimed invention(s) absent any evidence to the contrary. Applicant is advised of the obligation under 37 CFR 1.56 to point out the inventor and effective filing dates of each claim that was not commonly owned as of the effective filing date of the later invention in order for the examiner to consider the applicability of 35 U.S.C. 102(b)(2)(C) for any potential 35 U.S.C. 102(a)(2) prior art against the later invention. Claims 1 – 20 are rejected under 35 U.S.C. 103 as being unpatentable over ADAMS (US 2019/0352421 A1; published 11/21/2019; see PTO-892: Notice of References Cited) in view of FERTIG (WO 2019/154890 A1, see PTO-892). The present application is directed to a method of treating a cancer in a subject in need thereof, comprising: (1) administering to the subject a GPRC5DxCD3 bispecific antibody at a dose of 60 µg/kg to 1200 µg/kg every 1-2 weeks; and (2) administering to the subject an anti-CD38 antibody at a dose of 1200 mg to 2400 mg every 1-4 weeks. ADAMS is directed to methods of treating cancers and enhancing efficacy of T cell redirecting therapeutics (see abstract). ADAMS discloses a GPRC5DxCD3 bispecific antibody administered to the subject to treat the cancer. See paragraph 0017. Furthermore, ADAMS teaches that the addition of daratumumab (an anti-CD38 antibody) was additive to the anti-GPRC5DxCD3 bispecific antibody (JNJ-7564)-mediated MM cell lysis and that patients were treated with the anti-GPRC5DxCD3 bispecific antibody (0.00128-0.8 μg/mL) alone or in combination with 0.1 μg/mL daratumumab for 48 hours. See paragraph 0066. FERTIG is directed to antibodies that bind to GPRC5D, including bispecific antigen binding molecules e.g. for activating T cells. See abstract. FERTIG teaches a bispecific antigen binding molecule, comprising (a) a first antigen binding moiety that binds to GPRC5D and (b) a second antigen binding moiety which specifically binds to CD3. See claims 8 and 10. FERTIG teaches that The antibody or bispecific antigen binding molecule may be administered at about 1μg/kg to 15 mg/kg (e.g. 0.1 mg/kg - 10 mg/kg) or about 100, 200. 350, 500 or 1000 μg/kg of antibody or bispecific antigen binding molecule can be an initial candidate dosage for administration to the patient. See p. 135, lines 19 – 32. FERTIG also teaches that doses may be administered intermittently, e.g. every week. See p. 136, lines 8 – 9. ADAMS discloses a method of treating a cancer in a subject, comprising administering a therapeutically effective amount of an anti-CD38 antibody and a GPRC5DxCD3 bispecific antibody (see claims 1 and 49) where the anti-CD38 antibody is administered at about 1,800 mg (see claims 55 and 90) and may be repeated after one week, two weeks, three weeks, one month, five weeks, six weeks, seven weeks, two months, three months, four months, five months, six months, or longer. Repeated courses of treatment are also possible, as is chronic administration. (see paragraph 0368). ADAMS further teaches that the T-cell redirecting therapeutic that binds GPRC5D and the anti-CD38 antibody is administered by a subcutaneous injection (see paragraph 0474). Thus, because ADAMS teaches a GPRC5DxCD3 bispecific antibody (which FERTIG teaches may be administered at the doses and regimens recited in the present claims) that is combined with an anti-CD38 antibody at the doses and regimens recited in the present claims to treat cancer and administered subcutaneously, it would have been obvious to combine the methods of ADAMS and FERTIG to arrive to the inventions of present claims 1 – 2 and 4 – 7. There would have been a reasonable expectation of success considering that administering the GPRC5DxCD3 bispecific antibody alone or in combination with an anti-CD38 antibody is known to successfully treat cancer as evidenced by the applied prior art. Furthermore, “where the general conditions of a claim are disclosed in the prior art, it is not inventive to discover the optimum or workable ranges by routine experimentation.” In reAller, 220 F.2d 454, 456, 105 USPQ 233, 235 (CCPA 1955). Similarly, a prima facie case of obviousness exists where the claimed ranges or amounts do not overlap with the prior art but are merely close. Titanium Metals Corp. of Americav.Banner, 778 F.2d 775, 783, 227 USPQ 773, 779 (Fed. Cir. 1985)”. See MPEP 2144.05 (I) and (II). Regarding claim 3, ADAMS discloses that repeated courses of treatment are also possible, and the repeated administration may be at the same dose or at a different dose, with the different dose being lower that of the previous dose. See paragraph 0368. Regarding claim 7, ADAMS discloses that “the anti-CD38 antibody is administered by a subcutaneous injection” (see claim 143) and that “the anti-CD38 antibody is administered or provided for administration in a pharmaceutical composition comprising about 1,800 mg of the anti-CD38 antibody” (see claim 55) and that administration “may be repeated after one day, two days, three days, four days, five days, six days, one week, two weeks, three weeks, one month, five weeks, six weeks, seven weeks, two months, three months, four months, five months, six months, or longer” (see paragraph 0368). Regarding claim 8, ADAMS discloses that “the anti-CD38 antibody is administered or provided for administration in a pharmaceutical composition comprising about 1,800 mg of the anti-CD38 antibody and about 30,000 U of rHuPH20”. See claim 55. Regarding claim 9, ADAMS discloses a GPRC5DxCD3 bispecific antibody with a GPRC5D binding domain with CDRs of SEQ ID NOs: 27 – 29 and 30 – 32 and with a CD3 binding domain with CDRs of SEQ ID NOs: 17 – 19 and 20 – 22 with 100% identity. See Appendix. Regarding claim 10, ADAMS’ SEQ ID NO: 51 is identical to instant SEQ ID NO: 33; ADAMS’ SEQ ID NO: 52 wholly discloses instant SEQ ID NO: 34; ADAMS’ SEQ ID NO: 39 is identical to instant SEQ ID NO: 23; and ADAMS’ SEQ ID NO: 40 is identical to instant SEQ ID NO: 24. See Appendix. Regarding claim 11, ADAMS’ SEQ ID NO: 51 is identical to instant SEQ ID NO: 35; ADAMS’ SEQ ID NO: 52 is identical to instant SEQ ID NO: 36; ADAMS’ SEQ ID NO: 41 is identical to instant SEQ ID NO: 25; and ADAMS’SEQ ID NO: 42 is identical to instant SEQ ID NO: 26. See Appendix. Regarding claim 12, ADAMS discloses an anti-CD38 antibody with HCDRs of SEQ ID NOs: 7 – 9 and LCDRs of SEQ ID NOs: 10 – 12. ADAMS’ SEQ ID NO: 12 discloses instant SEQ ID NOs: 7 – 9 with 100% identity, and ADAMS’ SEQ ID NO: 5 discloses instant SEQ ID NOs: 10 – 12 with 100% identity. See Appendix. Regarding claim 13, ADAMS’ SEQ ID NO: 4 is identical to instant SEQ ID NO: 5; ADAMS’ SEQ ID NO: 5 is identical to instant SEQ ID NO: 6. See Appendix. Regarding claim 14, ADAMS discloses the cancer is multiple myeloma (see claims 29 – 35, 71 – 75, 116, and 120 – 123). See Appendix. Regarding claim 15, ADAMS in view of FERTIG renders a method of treating multiple myeloma with the claimed treatment regimen and antibodies with the claimed SEQ ID NOs as discussed above. Furthermore, Regarding claim 16, FERTIG teaches that the administration of the bispecific antibody may be repeated over several days or longer, depending on the condition, the treatment would generally be sustained until a desired suppression of disease symptoms occurs. One exemplary dosage of the antibody or bispecific antigen binding molecule would be in the range from about 0.005 mg/kg to about 10 mg/kg. In other non-limiting examples, a dose may also comprise from about 1 microgram/kg body weight, about 5 microgram/kg body weight, about 10 microgram/kg body weight, about 50 microgram/kg body weight, about 100 microgram/kg body weight, about 200 microgram/kg body weight, about 350 microgram/kg body weight, about 500 microgram/kg body weight, about 1 milligram/kg body weight. See p. 135, lines 25 – 32. Regarding claim 17, ADAMS discloses that the subject is relapsed or refractory to a prior anti-cancer therapy with immunomodulatory agents. See claims 28 and 118. Regarding claim 18, ADAMS discloses that the subject is relapsed or refractory to treatment with the anti-CD38 antibody, lenalinomide, bortezomib, pomalidomide, carfilzomib, elotozumab, ixazomib, melphalan or thalidomide, or any combination thereof. See claim 118. Regarding claim 19, ADAMS discloses one or more anti-cancer therapies selected from the group consisting of lenalidomide, thalidomide, pomalidomide, bortezomib, carfilzomib, elotozumab, ixazomib, melphalan, dexamethasone or prednisone. See claim 148. Regarding claim 20, ADAMS discloses that CD4+ T cell activation and degranulation was determined by increased surface expression of CD25 (activation). See Fig. 5 and paragraph 0027. Double Patenting The nonstatutory double patenting rejection is based on a judicially created doctrine grounded in public policy (a policy reflected in the statute) so as to prevent the unjustified or improper timewise extension of the “right to exclude” granted by a patent and to prevent possible harassment by multiple assignees. A nonstatutory double patenting rejection is appropriate where the conflicting claims are not identical, but at least one examined application claim is not patentably distinct from the reference claim(s) because the examined application claim is either anticipated by, or would have been obvious over, the reference claim(s). See, e.g., In re Berg, 140 F.3d 1428, 46 USPQ2d 1226 (Fed. Cir. 1998); In re Goodman, 11 F.3d 1046, 29 USPQ2d 2010 (Fed. Cir. 1993); In re Longi, 759 F.2d 887, 225 USPQ 645 (Fed. Cir. 1985); In re Van Ornum, 686 F.2d 937, 214 USPQ 761 (CCPA 1982); In re Vogel, 422 F.2d 438, 164 USPQ 619 (CCPA 1970); In re Thorington, 418 F.2d 528, 163 USPQ 644 (CCPA 1969). A timely filed terminal disclaimer in compliance with 37 CFR 1.321(c) or 1.321(d) may be used to overcome an actual or provisional rejection based on nonstatutory double patenting provided the reference application or patent either is shown to be commonly owned with the examined application, or claims an invention made as a result of activities undertaken within the scope of a joint research agreement. See MPEP § 717.02 for applications subject to examination under the first inventor to file provisions of the AIA as explained in MPEP § 2159. See MPEP § 2146 et seq. for applications not subject to examination under the first inventor to file provisions of the AIA . A terminal disclaimer must be signed in compliance with 37 CFR 1.321(b). The filing of a terminal disclaimer by itself is not a complete reply to a nonstatutory double patenting (NSDP) rejection. A complete reply requires that the terminal disclaimer be accompanied by a reply requesting reconsideration of the prior Office action. Even where the NSDP rejection is provisional the reply must be complete. See MPEP § 804, subsection I.B.1. For a reply to a non-final Office action, see 37 CFR 1.111(a). For a reply to final Office action, see 37 CFR 1.113(c). A request for reconsideration while not provided for in 37 CFR 1.113(c) may be filed after final for consideration. See MPEP §§ 706.07(e) and 714.13. The USPTO Internet website contains terminal disclaimer forms which may be used. Please visit www.uspto.gov/patent/patents-forms. The actual filing date of the application in which the form is filed determines what form (e.g., PTO/SB/25, PTO/SB/26, PTO/AIA /25, or PTO/AIA /26) should be used. A web-based eTerminal Disclaimer may be filled out completely online using web-screens. An eTerminal Disclaimer that meets all requirements is auto-processed and approved immediately upon submission. For more information about eTerminal Disclaimers, refer to www.uspto.gov/patents/apply/applying-online/eterminal-disclaimer. Claims 1 – 20 are rejected on the ground of nonstatutory double patenting as being unpatentable over claims 1 – 9 of U.S. Patent No. 11,685,777 in view of ADAMS and FERTIG. Patented claim 1 recites a An isolated GPRC5D x CD3 bispecific antibody comprising: a) a first heavy chain (HC1); b) a second heavy chain (HC2); c) a first light chain (LC 1); and d) a second light chain (LC2), wherein the HC1 and the LC1 pair to form a first antigen-binding site that specifically binds CD3, and the HC2 and the LC2 pair to form a second antigen-binding site that specifically binds GPRC5D; wherein the HC1 comprises the amino acid sequence of SEQ ID NO: 25 and the LC1 comprises the amino acid sequence of SEQ ID NO: 26, and wherein the HC2 comprises the amino acid sequence of SEQ ID NO: 55 and the LC2 comprises the amino acid sequence of SEQ ID NO: 58. Copending SEQ ID NOs: 25, 55 and 58 disclose present SEQ ID NOs 23, 33 and 34 of present claim 10 with 100% identity. See Appendix. ADAMS discloses present SEQ ID NO: 24 of present claim 10 as discussed in the 103 rejection above. The main difference between the present claims and the patented claims is that the present claims recite a method of administration of the GPRC5DxCD3 bispecific with an anti-CD38 antibody. However, ADAMS in view of FERTIG discloses this difference. The teachings of ADAMS and FERTIG, and how they relate to the claims, are set forth in the rejections under 35 U.S.C. 103 above. Because the patented claims recite a GPRC5D x CD3 bispecific antibody, and ADAMS in view of FERTIG discloses that the GPRC5DxCD3 bispecific antibody may be administered with an anti-CD38 antibody in the dosing regimen of the present claims, it would have been obvious to one having ordinary skill in the art to use the patented claims’ GPRC5DxCD3 bispecific antibody in the method of the present claims. There would have been a reasonable expectation of success considering that administering the GPRC5DxCD3 bispecific antibody alone or in combination with an anti-CD38 antibody is known to successfully treat cancer as evidenced by the applied prior art. Claims 1 – 20 are rejected on the ground of nonstatutory double patenting as being unpatentable over claims 1 – 28 of U.S. Patent No. 12,065,500 in view of ADAMS and FERTIG. Patented claim 1 recites a method of treating a multiple myeloma in a subject, comprising administering a therapeutically effective amount of an anti-CD38 antibody and a T cell redirecting therapeutic to the subject to treat the multiple myeloma, wherein the T cell redirecting therapeutic comprises: a CD3 binding domain and a BCMA binding domain. The main difference between the present claims and the patented claims is that the present claims recite a GPRC5DxCD3 bispecific instead of the patented claims’ BCMAxCD3 bispecific antibody . However, ADAMS in view of FERTIG discloses this difference. The teachings of ADAMS and FERTIG, and how they relate to the claims, are set forth in the rejections under 35 U.S.C. 103 above. Because the patented claims recite a method of treating a multiple myeloma in a subject, comprising administering a therapeutically effective amount of an anti-CD38 antibody and a BCMAxCD3 bispecific antibody, and ADAMS in view of FERTIG discloses a similar method with the GPRC5DxCD3 bispecific instead of BCMAxCD3, it would have been obvious to one having ordinary skill in the art to use the patented claims’ method with ADAMS’ GPRC5DxCD3 bispecific and the dosing regimen rendered obvious by ADAMS in view of FERTIG to arrive to the method of the present claims. Claims 1 – 20 are provisionally rejected on the ground of nonstatutory double patenting as being unpatentable over claims 8 – 9, 11 – 18, and 24 – 32 of copending Application No. 17/477,435 in view of ADAMS and FERTIG. Copending claim 8 recites a method of treating relapsed or refractory multiple myeloma in a human subject in need thereof, comprising subcutaneously administering to the subject 400 µg/kg of a GPRC5DxCD3 bispecific antibody weekly, after the subject has been subcutaneously administered priming doses of the GPRC5DxCD3 bispecific antibody, wherein the priming doses comprise doses of 10 µg/kg and 60 µg/kg, and wherein the GPRC5DxCD3 bispecific antibody comprises a GPRC5D binding domain comprising a HCDR1 of SEQ ID NO: 4, a HCDR2 of SEQ ID NO: 5, a HCDR3 of SEQ ID NO: 6, a LCDR1 of SEQ ID NO: 7, a LCDR2 of SEQ ID NO: 8 and a LCDR3 of SEQ ID NO: 9, and a CD3 binding domain comprising a HCDR1 of SEQ ID NO: 14, a HCDR2 of SEQ ID NO: 15, a HCDR3 of SEQ ID NO: 16, a LCDR1 of SEQ ID NO: 17, a LCDR2 of SEQ ID NO: 18 and a LCDR3 of SEQ ID NO: 19,wherein the method is effective in treating the multiple myeloma by achieving a stringent complete response, a complete response, a very good partial response, or a partial response in the subject, according to International Myeloma Working Group (IMWG) criteria. Copending claim 11 recites that the GPRC5D binding domain comprises a heavy chain variable region (VH) having the amino acid sequence of SEQ ID NO: 10 and a light chain variable region (VL) having the amino acid sequence of SEQ ID NO: 11, and the CD3 binding domain comprises a VH having the amino acid sequence of SEQ ID NO: 20 and a VL having the amino acid sequence of SEQ ID NO: 21. Copending claim 14 recites that the GPRC5DxCD3 bispecific antibody comprises a first heavy chain (HCl) having the amino acid sequence of SEQ ID NO: 12, a first light chain (LCl) having the amino acid sequence of SEQ ID NO: 13, a second heavy chain (HC2) having the amino acid sequence of SEQ ID NO: 22 and a second light chain (LC2) having the amino acid sequence of SEQ ID NO: 23. Copending claim 24 recites that the GPRC5D binding domain comprises a heavy chain variable region (VH) having the amino acid sequence of SEQ ID NO: 10 and a light chain variable region (VL) having the amino acid sequence of SEQ ID NO: 11, and the CD3 binding domain comprises a VH having the amino acid sequence of SEQ ID NO: 20 and a VL having the amino acid sequence of SEQ ID NO: 21. Copending SEQ ID NOs: 10 – 13 and 20 – 23 discloses present SEQ ID NOs: 33 - 34, 23 – 26, and 35 – 36, respectively, with 100% identity. See Appendix. The main difference between the present claims and the copending claims is that the present claims recite the addition an anti-CD38 antibody to the claimed method. However, ADAMS in view of FERTIG discloses this difference. The teachings of ADAMS and FERTIG, and how they relate to the claims, are set forth in the rejections under 35 U.S.C. 103 above. Because the copending claims recite recites a method of treating relapsed or refractory multiple myeloma in a human subject in need thereof, comprising subcutaneously administering to the subject 400 µg/kg of a GPRC5DxCD3 bispecific antibody weekly, after the subject has been subcutaneously administered priming doses of the GPRC5DxCD3 bispecific antibody, wherein the priming doses comprise doses of 10 µg/kg and 60 µg/kg, and ADAMS in view of FERTIG teaches that the GPRC5DxCD3 bispecific antibody may be administered with an anti-CD38 antibody in the dose regimen of the present claims, it would have been obvious to one having ordinary skill in the art to use the copending claims’ method with an anti-CD38 antibody and dosing regimen as taught by ADAMS in view of FERTIG to arrive to the method of the present claims. This is a provisional nonstatutory double patenting rejection. Claims 1 – 20 are provisionally rejected on the ground of nonstatutory double patenting as being unpatentable over claims 213 – 256 of copending Application No. 18/208,361 in view of ADAMS and FERTIG. Copending claim 213 recites a method of treating a cancer in a subject, comprising administering a therapeutically effective amount of a T-cell redirecting therapeutic that binds GPRC5D and an anti-CD38 antibody to the subject to treat the cancer. Copending claim 227 recites that the T-cell redirecting therapeutic comprises a GPRC5D binding domain and a CD3 binding domain. Copending claim 228 recites that the GPRC5D binding domain comprises a heavy chain variable region (VH) of SEQ ID NO: 49 and a light chain variable region (VL) of SEQ ID NO: 50 and the CD3 binding domain comprises a VH of SEQ ID NO: 39 and a VL of SEQ ID NO: 40. Copending claim 236 recites that the multispecific antibody comprises the HC1 of SEQ ID NO: 51, the LC1 of SEQ ID NO: 52, the HC2 of SEQ ID NO: 41 and the LC2 of SEQ ID NO: 42. Copending claim 238 recites that the anti-CD38 antibody comprises a VH of SEQ ID NO: 4 and a VL of SEQ ID NO: 5. Copending claim 240 recites that the anti-CD38 antibody comprises a heavy chain (HC) of SEQ ID NO: 12 and a light chain (LC) of SEQ ID NO: 13. Copending SEQ ID NOs: 49 and 51 each discloses the CDRs of present SEQ ID NOs: 27 - 29 with 100% identity; copending SEQ ID NOs: 50 and 52 each discloses the CDRs of present SEQ ID NOs: 30 – 32 with 100% identity; copending SEQ ID NOs: 39 and 41 each discloses the CDRs of present SEQ ID NOs: 17 – 19 with 100% identity; copending SEQ ID NOs: 40 and 42 each discloses the CDRs of present SEQ ID NOs: 20 – 22 with 100% identity; copending SEQ ID NOs: 4 and 12 each discloses the CDRs of present SEQ ID NOs: 7 – 9 with 100% identity; and copending SEQ ID NOs: 5 and 13 each discloses present SEQ ID NOs: 10 – 12 with 100% identity. See Appendix. The main difference between the present claims and the copending claims is that the present claims recite a dosing regimen. However, ADAMS in view of FERTIG discloses this difference. The teachings of ADAMS and FERTIG, and how they relate to the claims, are set forth in the rejections under 35 U.S.C. 103 above. Because the copending claims recite recites method of treating a cancer by administering a therapeutically effective amount of a GPRC5DxCD3 antibody and an anti-CD38 antibody, and ADAMS and FERTIG discloses the dosing regimen of the present claims, it would have been obvious to one having ordinary skill in the art to use the copending claims’ method with the dosing regimen of ADAMS and FERTIG. This is a provisional nonstatutory double patenting rejection. Conclusion No claim is allowed. Any inquiry concerning this communication or earlier communications from the examiner should be directed to ESTELLA M. GUSTILO whose telephone number is (703)756-1706. The examiner can normally be reached Monday - Friday 9:00 AM - 5:00 PM. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, JANET L. EPPS-SMITH can be reached at 571-272-0757. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /ESTELLA M. GUSTILO/Examiner, Art Unit 1646 /PETER J REDDIG/Primary Examiner, Art Unit 1646 APPENDIX Alignment with SEQ ID NOs: 27 – 29 RESULT 6 US-16-412-701-51 (NOTE: this sequence has 4 duplicates in the database searched. See complete list at the end of this report) Sequence 51, US/16412701 Publication No. US20190352421A1 GENERAL INFORMATION APPLICANT: Adams, Homer APPLICANT: Frerichs, Kris APPLICANT: Gaudet, Francois APPLICANT: Van de Donk, Niels APPLICANT: Verkleij, Christie TITLE OF INVENTION: Methods of treating cancers and enhancing efficacy of T cell TITLE OF INVENTION: redirecting therapeutics FILE REFERENCE: JBI6084USNP1 CURRENT APPLICATION NUMBER: US/16/412,701 CURRENT FILING DATE: 2019-05-15 PRIOR APPLICATION NUMBER: 62672222 PRIOR FILING DATE: 2018-05-16 PRIOR APPLICATION NUMBER: 62736804 PRIOR FILING DATE: 2018-09-26 PRIOR APPLICATION NUMBER: 62842080 PRIOR FILING DATE: 2019-05-02 NUMBER OF SEQ ID NOS: 105 SEQ ID NO 51 LENGTH: 445 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: GC5B596 HC Query Match 84.8%; Score 137.4; Length 445; Best Local Similarity 40.3%; Matches 31; Conservative 0; Mismatches 0; Indels 46; Gaps 2; Qy 1 GYTMN--------------LINPYNSDTNYAQKLQG------------------------ 22 ||||| ||||||||||||||||| Db 31 GYTMNWVRQAPGQGLEWMGLINPYNSDTNYAQKLQGRVTMTTDTSTSTAYMELRSLRSDD 90 Qy 23 --------VALRVALDY 31 ||||||||| Db 91 TAVYYCARVALRVALDY 107 US-18-208-361-49 Filing date in PALM: 2023-06-12 Sequence 49, US/18208361 Publication No. US20240101697A1 GENERAL INFORMATION APPLICANT: Adams, Homer (en) TITLE OF INVENTION: Methods of treating cancers and enhancing efficacy of T cell redirecting therapeutics (en) FILE REFERENCE: P081113US CURRENT APPLICATION NUMBER: US/18/208,361 CURRENT FILING DATE: 2023-06-12 NUMBER OF SEQ ID NOS: 105 SEQ ID NO 49 LENGTH: 118 TYPE: PRT FEATURE: NAME/KEY: REGION LOCATION: 1..118 QUALIFIERS: note = GC5B596 VH FEATURE: NAME/KEY: source LOCATION: 1..118 QUALIFIERS: mol_type = protein organism = synthetic construct ALIGNMENT: Query Match 84.8%; Score 137.4; Length 118; Best Local Similarity 40.3%; Matches 31; Conservative 0; Mismatches 0; Indels 46; Gaps 2; Qy 1 GYTMN--------------LINPYNSDTNYAQKLQG------------------------ 22 ||||| ||||||||||||||||| Db 31 GYTMNWVRQAPGQGLEWMGLINPYNSDTNYAQKLQGRVTMTTDTSTSTAYMELRSLRSDD 90 Qy 23 --------VALRVALDY 31 ||||||||| Db 91 TAVYYCARVALRVALDY 107 US-18-208-361-51 Filing date in PALM: 2023-06-12 Sequence 51, US/18208361 Publication No. US20240101697A1 GENERAL INFORMATION APPLICANT: Adams, Homer (en) TITLE OF INVENTION: Methods of treating cancers and enhancing efficacy of T cell redirecting therapeutics (en) FILE REFERENCE: P081113US CURRENT APPLICATION NUMBER: US/18/208,361 CURRENT FILING DATE: 2023-06-12 NUMBER OF SEQ ID NOS: 105 SEQ ID NO 51 LENGTH: 445 TYPE: PRT FEATURE: NAME/KEY: REGION LOCATION: 1..445 QUALIFIERS: note = GC5B596 HC FEATURE: NAME/KEY: source LOCATION: 1..445 QUALIFIERS: mol_type = protein organism = synthetic construct ALIGNMENT: Query Match 84.8%; Score 137.4; Length 445; Best Local Similarity 40.3%; Matches 31; Conservative 0; Mismatches 0; Indels 46; Gaps 2; Qy 1 GYTMN--------------LINPYNSDTNYAQKLQG------------------------ 22 ||||| ||||||||||||||||| Db 31 GYTMNWVRQAPGQGLEWMGLINPYNSDTNYAQKLQGRVTMTTDTSTSTAYMELRSLRSDD 90 Qy 23 --------VALRVALDY 31 ||||||||| Db 91 TAVYYCARVALRVALDY 107 Alignment with SEQ ID NOs: 30 – 32 RESULT 3 US-16-412-701-52 (NOTE: this sequence has 4 duplicates in the database searched. See complete list at the end of this report) Sequence 52, US/16412701 Publication No. US20190352421A1 GENERAL INFORMATION APPLICANT: Adams, Homer APPLICANT: Frerichs, Kris APPLICANT: Gaudet, Francois APPLICANT: Van de Donk, Niels APPLICANT: Verkleij, Christie TITLE OF INVENTION: Methods of treating cancers and enhancing efficacy of T cell TITLE OF INVENTION: redirecting therapeutics FILE REFERENCE: JBI6084USNP1 CURRENT APPLICATION NUMBER: US/16/412,701 CURRENT FILING DATE: 2019-05-15 PRIOR APPLICATION NUMBER: 62672222 PRIOR FILING DATE: 2018-05-16 PRIOR APPLICATION NUMBER: 62736804 PRIOR FILING DATE: 2018-09-26 PRIOR APPLICATION NUMBER: 62842080 PRIOR FILING DATE: 2019-05-02 NUMBER OF SEQ ID NOS: 105 SEQ ID NO 52 LENGTH: 210 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: GC5B596 LC Query Match 82.8%; Score 119.3; Length 210; Best Local Similarity 36.5%; Matches 27; Conservative 0; Mismatches 0; Indels 47; Gaps 2; Qy 1 KASQNVATHVG---------------SASYRYS--------------------------- 18 ||||||||||| ||||||| Db 24 KASQNVATHVGWYQQKPGKAPKRLIYSASYRYSGVPSRFSGSGSGTEFTLTISNLQPEDF 83 Qy 19 -----QQYNRYPYT 27 ||||||||| Db 84 ATYYCQQYNRYPYT 97 US-18-208-361-50 Filing date in PALM: 2023-06-12 Sequence 50, US/18208361 Publication No. US20240101697A1 GENERAL INFORMATION APPLICANT: Adams, Homer (en) TITLE OF INVENTION: Methods of treating cancers and enhancing efficacy of T cell redirecting therapeutics (en) FILE REFERENCE: P081113US CURRENT APPLICATION NUMBER: US/18/208,361 CURRENT FILING DATE: 2023-06-12 NUMBER OF SEQ ID NOS: 105 SEQ ID NO 50 LENGTH: 107 TYPE: PRT FEATURE: NAME/KEY: REGION LOCATION: 1..107 QUALIFIERS: note = GC5B596 VL FEATURE: NAME/KEY: source LOCATION: 1..107 QUALIFIERS: mol_type = protein organism = synthetic construct ALIGNMENT: Query Match 82.8%; Score 119.3; Length 107; Best Local Similarity 36.5%; Matches 27; Conservative 0; Mismatches 0; Indels 47; Gaps 2; Qy 1 KASQNVATHVG---------------SASYRYS--------------------------- 18 ||||||||||| ||||||| Db 24 KASQNVATHVGWYQQKPGKAPKRLIYSASYRYSGVPSRFSGSGSGTEFTLTISNLQPEDF 83 Qy 19 -----QQYNRYPYT 27 ||||||||| Db 84 ATYYCQQYNRYPYT 97 Alignment with SEQ ID NOs: 17 – 19 US-16-412-701-39 Filing date in PALM: 2019-05-15 Sequence 39, US/16412701 Publication No. US20190352421A1 GENERAL INFORMATION APPLICANT: Adams, Homer APPLICANT: Frerichs, Kris APPLICANT: Gaudet, Francois APPLICANT: Van de Donk, Niels APPLICANT: Verkleij, Christie TITLE OF INVENTION: Methods of treating cancers and enhancing efficacy of T cell TITLE OF INVENTION: redirecting therapeutics FILE REFERENCE: JBI6084USNP1 CURRENT APPLICATION NUMBER: US/16/412,701 CURRENT FILING DATE: 2019-05-15 PRIOR APPLICATION NUMBER: 62672222 PRIOR FILING DATE: 2018-05-16 PRIOR APPLICATION NUMBER: 62736804 PRIOR FILING DATE: 2018-09-26 PRIOR APPLICATION NUMBER: 62842080 PRIOR FILING DATE: 2019-05-02 NUMBER OF SEQ ID NOS: 105 SEQ ID NO 39 LENGTH: 125 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: CD3B219 VH ALIGNMENT: Query Match 88.3%; Score 186.4; Length 125; Best Local Similarity 45.2%; Matches 38; Conservative 0; Mismatches 0; Indels 46; Gaps 2; Qy 1 TYAMN--------------RIRSKYNNYATYYAASVKG---------------------- 24 ||||| ||||||||||||||||||| Db 31 TYAMNWVRQAPGKGLEWVARIRSKYNNYATYYAASVKGRFTISRDDSKNSLYLQMNSLKT 90 Qy 25 ----------HGNFGNSYVSWFAY 38 |||||||||||||| Db 91 EDTAVYYCARHGNFGNSYVSWFAY 114 US-18-208-361-39 Filing date in PALM: 2023-06-12 Sequence 39, US/18208361 Publication No. US20240101697A1 GENERAL INFORMATION APPLICANT: Adams, Homer (en) TITLE OF INVENTION: Methods of treating cancers and enhancing efficacy of T cell redirecting therapeutics (en) FILE REFERENCE: P081113US CURRENT APPLICATION NUMBER: US/18/208,361 CURRENT FILING DATE: 2023-06-12 NUMBER OF SEQ ID NOS: 105 SEQ ID NO 39 LENGTH: 125 TYPE: PRT FEATURE: NAME/KEY: REGION LOCATION: 1..125 QUALIFIERS: note = CD3B219 VH FEATURE: NAME/KEY: source LOCATION: 1..125 QUALIFIERS: mol_type = protein organism = synthetic construct ALIGNMENT: Query Match 88.3%; Score 186.4; Length 125; Best Local Similarity 45.2%; Matches 38; Conservative 0; Mismatches 0; Indels 46; Gaps 2; Qy 1 TYAMN--------------RIRSKYNNYATYYAASVKG---------------------- 24 ||||| ||||||||||||||||||| Db 31 TYAMNWVRQAPGKGLEWVARIRSKYNNYATYYAASVKGRFTISRDDSKNSLYLQMNSLKT 90 Qy 25 ----------HGNFGNSYVSWFAY 38 |||||||||||||| Db 91 EDTAVYYCARHGNFGNSYVSWFAY 114 US-18-208-361-41 Filing date in PALM: 2023-06-12 Sequence 41, US/18208361 Publication No. US20240101697A1 GENERAL INFORMATION APPLICANT: Adams, Homer (en) TITLE OF INVENTION: Methods of treating cancers and enhancing efficacy of T cell redirecting therapeutics (en) FILE REFERENCE: P081113US CURRENT APPLICATION NUMBER: US/18/208,361 CURRENT FILING DATE: 2023-06-12 NUMBER OF SEQ ID NOS: 105 SEQ ID NO 41 LENGTH: 452 TYPE: PRT FEATURE: NAME/KEY: REGION LOCATION: 1..452 QUALIFIERS: note = CD3B219 HC FEATURE: NAME/KEY: source LOCATION: 1..452 QUALIFIERS: mol_type = protein organism = synthetic construct ALIGNMENT: Query Match 88.3%; Score 186.4; Length 452; Best Local Similarity 45.2%; Matches 38; Conservative 0; Mismatches 0; Indels 46; Gaps 2; Qy 1 TYAMN--------------RIRSKYNNYATYYAASVKG---------------------- 24 ||||| ||||||||||||||||||| Db 31 TYAMNWVRQAPGKGLEWVARIRSKYNNYATYYAASVKGRFTISRDDSKNSLYLQMNSLKT 90 Qy 25 ----------HGNFGNSYVSWFAY 38 |||||||||||||| Db 91 EDTAVYYCARHGNFGNSYVSWFAY 114 Alignment with SEQ ID NOs: 20 – 22 RESULT 147 US-16-412-701-40 (NOTE: this sequence has 8 duplicates in the database searched. See complete list at the end of this report) Sequence 40, US/16412701 Publication No. US20190352421A1 GENERAL INFORMATION APPLICANT: Adams, Homer APPLICANT: Frerichs, Kris APPLICANT: Gaudet, Francois APPLICANT: Van de Donk, Niels APPLICANT: Verkleij, Christie TITLE OF INVENTION: Methods of treating cancers and enhancing efficacy of T cell TITLE OF INVENTION: redirecting therapeutics FILE REFERENCE: JBI6084USNP1 CURRENT APPLICATION NUMBER: US/16/412,701 CURRENT FILING DATE: 2019-05-15 PRIOR APPLICATION NUMBER: 62672222 PRIOR FILING DATE: 2018-05-16 PRIOR APPLICATION NUMBER: 62736804 PRIOR FILING DATE: 2018-09-26 PRIOR APPLICATION NUMBER: 62842080 PRIOR FILING DATE: 2019-05-02 NUMBER OF SEQ ID NOS: 105 SEQ ID NO 40 LENGTH: 112 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: CD3BB219 VL Query Match 84.8%; Score 137.3; Length 112; Best Local Similarity 39.0%; Matches 30; Conservative 0; Mismatches 0; Indels 47; Gaps 2; Qy 1 RSSTGAVTTSNYAN---------------GTNKRAP------------------------ 21 |||||||||||||| ||||||| Db 23 RSSTGAVTTSNYANWVQQKPGQAPRGLIGGTNKRAPGTPARFSGSLLGGKAALTLSGVQP 82 Qy 22 --------ALWYSNLWV 30 ||||||||| Db 83 EDEAEYYCALWYSNLWV 99 US-18-208-361-40 Filing date in PALM: 2023-06-12 Sequence 40, US/18208361 Publication No. US20240101697A1 GENERAL INFORMATION APPLICANT: Adams, Homer (en) TITLE OF INVENTION: Methods of treating cancers and enhancing efficacy of T cell redirecting therapeutics (en) FILE REFERENCE: P081113US CURRENT APPLICATION NUMBER: US/18/208,361 CURRENT FILING DATE: 2023-06-12 NUMBER OF SEQ ID NOS: 105 SEQ ID NO 40 LENGTH: 112 TYPE: PRT FEATURE: NAME/KEY: REGION LOCATION: 1..112 QUALIFIERS: note = CD3BB219 VL FEATURE: NAME/KEY: source LOCATION: 1..112 QUALIFIERS: mol_type = protein organism = synthetic construct ALIGNMENT: Query Match 84.8%; Score 137.3; Length 112; Best Local Similarity 39.0%; Matches 30; Conservative 0; Mismatches 0; Indels 47; Gaps 2; Qy 1 RSSTGAVTTSNYAN---------------GTNKRAP------------------------ 21 |||||||||||||| ||||||| Db 23 RSSTGAVTTSNYANWVQQKPGQAPRGLIGGTNKRAPGTPARFSGSLLGGKAALTLSGVQP 82 Qy 22 --------ALWYSNLWV 30 ||||||||| Db 83 EDEAEYYCALWYSNLWV 99 US-18-208-361-42 Filing date in PALM: 2023-06-12 Sequence 42, US/18208361 Publication No. US20240101697A1 GENERAL INFORMATION APPLICANT: Adams, Homer (en) TITLE OF INVENTION: Methods of treating cancers and enhancing efficacy of T cell redirecting therapeutics (en) FILE REFERENCE: P081113US CURRENT APPLICATION NUMBER: US/18/208,361 CURRENT FILING DATE: 2023-06-12 NUMBER OF SEQ ID NOS: 105 SEQ ID NO 42 LENGTH: 215 TYPE: PRT FEATURE: NAME/KEY: REGION LOCATION: 1..215 QUALIFIERS: note = CD3219 LC FEATURE: NAME/KEY: source LOCATION: 1..215 QUALIFIERS: mol_type = protein organism = synthetic construct ALIGNMENT: Query Match 84.8%; Score 137.3; Length 215; Best Local Similarity 39.0%; Matches 30; Conservative 0; Mismatches 0; Indels 47; Gaps 2; Qy 1 RSSTGAVTTSNYAN---------------GTNKRAP------------------------ 21 |||||||||||||| ||||||| Db 23 RSSTGAVTTSNYANWVQQKPGQAPRGLIGGTNKRAPGTPARFSGSLLGGKAALTLSGVQP 82 Qy 22 --------ALWYSNLWV 30 ||||||||| Db 83 EDEAEYYCALWYSNLWV 99 Alignment with SEQ ID NO: 33 RESULT 6 US-16-412-701-51 (NOTE: this sequence has 4 duplicates in the database searched. See complete list at the end of this report) Sequence 51, US/16412701 Publication No. US20190352421A1 GENERAL INFORMATION APPLICANT: Adams, Homer APPLICANT: Frerichs, Kris APPLICANT: Gaudet, Francois APPLICANT: Van de Donk, Niels APPLICANT: Verkleij, Christie TITLE OF INVENTION: Methods of treating cancers and enhancing efficacy of T cell TITLE OF INVENTION: redirecting therapeutics FILE REFERENCE: JBI6084USNP1 CURRENT APPLICATION NUMBER: US/16/412,701 CURRENT FILING DATE: 2019-05-15 PRIOR APPLICATION NUMBER: 62672222 PRIOR FILING DATE: 2018-05-16 PRIOR APPLICATION NUMBER: 62736804 PRIOR FILING DATE: 2018-09-26 PRIOR APPLICATION NUMBER: 62842080 PRIOR FILING DATE: 2019-05-02 NUMBER OF SEQ ID NOS: 105 SEQ ID NO 51 LENGTH: 445 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: GC5B596 HC Query Match 100.0%; Score 614; Length 445; Best Local Similarity 100.0%; Matches 118; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 QVQLVQSGAEVKKPGASVKVSCKASGYSFTGYTMNWVRQAPGQGLEWMGLINPYNSDTNY 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 QVQLVQSGAEVKKPGASVKVSCKASGYSFTGYTMNWVRQAPGQGLEWMGLINPYNSDTNY 60 Qy 61 AQKLQGRVTMTTDTSTSTAYMELRSLRSDDTAVYYCARVALRVALDYWGQGTLVTVSS 118 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 AQKLQGRVTMTTDTSTSTAYMELRSLRSDDTAVYYCARVALRVALDYWGQGTLVTVSS 118 US-16-779-713-55 Filing date in PALM: 2020-02-03 Sequence 55, US/16779713 Patent No. 11685777 GENERAL INFORMATION APPLICANT: JANSSEN PHARMACEUTICA NV TITLE OF INVENTION: ANTI- GPRC5D ANTIBODIES, BISPECIFIC ANTIGEN BINDING MOLECULES TITLE OF INVENTION: THAT BIND GPRC5D AND CD3, AND USES THEREOF FILE REFERENCE: PRD3422USNP CURRENT APPLICATION NUMBER: US/16/779,713 CURRENT FILING DATE: 2020-02-03 PRIOR APPLICATION NUMBER: 62/364,811 PRIOR FILING DATE: 2016-07-20 NUMBER OF SEQ ID NOS: 100 SEQ ID NO 55 LENGTH: 118 TYPE: PRT ORGANISM: Homo sapiens ALIGNMENT: Query Match 100.0%; Score 614; Length 118; Best Local Similarity 100.0%; Matches 118; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 QVQLVQSGAEVKKPGASVKVSCKASGYSFTGYTMNWVRQAPGQGLEWMGLINPYNSDTNY 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 QVQLVQSGAEVKKPGASVKVSCKASGYSFTGYTMNWVRQAPGQGLEWMGLINPYNSDTNY 60 Qy 61 AQKLQGRVTMTTDTSTSTAYMELRSLRSDDTAVYYCARVALRVALDYWGQGTLVTVSS 118 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 AQKLQGRVTMTTDTSTSTAYMELRSLRSDDTAVYYCARVALRVALDYWGQGTLVTVSS 118 US-17-477-435-10 Filing date in PALM: 2021-09-16 Sequence 10, US/17477435 GENERAL INFORMATION APPLICANT: Janssen Phamaceutica NV TITLE OF INVENTION: METHODS FOR TREATING MULTIPLE MYELOMA FILE REFERENCE: PRD4096 CURRENT APPLICATION NUMBER: US/17/477,435 CURRENT FILING DATE: 2021-09-16 PRIOR APPLICATION NUMBER: US 63/079,294 PRIOR FILING DATE: 2020-09-16 PRIOR APPLICATION NUMBER: US 63/116,549 PRIOR FILING DATE: 2020-11-20 PRIOR APPLICATION NUMBER: US 63/187,888 PRIOR FILING DATE: 2021-05-12 NUMBER OF SEQ ID NOS: 24 SEQ ID NO 10 LENGTH: 118 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: GC5B596 VH ALIGNMENT: Query Match 100.0%; Score 614; Length 118; Best Local Similarity 100.0%; Matches 118; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 QVQLVQSGAEVKKPGASVKVSCKASGYSFTGYTMNWVRQAPGQGLEWMGLINPYNSDTNY 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 QVQLVQSGAEVKKPGASVKVSCKASGYSFTGYTMNWVRQAPGQGLEWMGLINPYNSDTNY 60 Qy 61 AQKLQGRVTMTTDTSTSTAYMELRSLRSDDTAVYYCARVALRVALDYWGQGTLVTVSS 118 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 AQKLQGRVTMTTDTSTSTAYMELRSLRSDDTAVYYCARVALRVALDYWGQGTLVTVSS 118 Alignment with SEQ ID NO: 34 RESULT 3 US-16-412-701-52 (NOTE: this sequence has 4 duplicates in the database searched. See complete list at the end of this report) Sequence 52, US/16412701 Publication No. US20190352421A1 GENERAL INFORMATION APPLICANT: Adams, Homer APPLICANT: Frerichs, Kris APPLICANT: Gaudet, Francois APPLICANT: Van de Donk, Niels APPLICANT: Verkleij, Christie TITLE OF INVENTION: Methods of treating cancers and enhancing efficacy of T cell TITLE OF INVENTION: redirecting therapeutics FILE REFERENCE: JBI6084USNP1 CURRENT APPLICATION NUMBER: US/16/412,701 CURRENT FILING DATE: 2019-05-15 PRIOR APPLICATION NUMBER: 62672222 PRIOR FILING DATE: 2018-05-16 PRIOR APPLICATION NUMBER: 62736804 PRIOR FILING DATE: 2018-09-26 PRIOR APPLICATION NUMBER: 62842080 PRIOR FILING DATE: 2019-05-02 NUMBER OF SEQ ID NOS: 105 SEQ ID NO 52 LENGTH: 210 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: GC5B596 LC Query Match 100.0%; Score 255; Length 210; Best Local Similarity 100.0%; Matches 47; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 RFSGSGSGTEFTLTISNLQPEDFATYYCQQYNRYPYTFGQGTKLEIK 47 ||||||||||||||||||||||||||||||||||||||||||||||| Db 61 RFSGSGSGTEFTLTISNLQPEDFATYYCQQYNRYPYTFGQGTKLEIK 107 US-16-779-713-58 Filing date in PALM: 2020-02-03 Sequence 58, US/16779713 Patent No. 11685777 GENERAL INFORMATION APPLICANT: JANSSEN PHARMACEUTICA NV TITLE OF INVENTION: ANTI- GPRC5D ANTIBODIES, BISPECIFIC ANTIGEN BINDING MOLECULES TITLE OF INVENTION: THAT BIND GPRC5D AND CD3, AND USES THEREOF FILE REFERENCE: PRD3422USNP CURRENT APPLICATION NUMBER: US/16/779,713 CURRENT FILING DATE: 2020-02-03 PRIOR APPLICATION NUMBER: 62/364,811 PRIOR FILING DATE: 2016-07-20 NUMBER OF SEQ ID NOS: 100 SEQ ID NO 58 LENGTH: 107 TYPE: PRT ORGANISM: Homo sapiens ALIGNMENT: Query Match 100.0%; Score 255; Length 107; Best Local Similarity 100.0%; Matches 47; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 RFSGSGSGTEFTLTISNLQPEDFATYYCQQYNRYPYTFGQGTKLEIK 47 ||||||||||||||||||||||||||||||||||||||||||||||| Db 61 RFSGSGSGTEFTLTISNLQPEDFATYYCQQYNRYPYTFGQGTKLEIK 107 US-17-477-435-11 Filing date in PALM: 2021-09-16 Sequence 11, US/17477435 GENERAL INFORMATION APPLICANT: Janssen Phamaceutica NV TITLE OF INVENTION: METHODS FOR TREATING MULTIPLE MYELOMA FILE REFERENCE: PRD4096 CURRENT APPLICATION NUMBER: US/17/477,435 CURRENT FILING DATE: 2021-09-16 PRIOR APPLICATION NUMBER: US 63/079,294 PRIOR FILING DATE: 2020-09-16 PRIOR APPLICATION NUMBER: US 63/116,549 PRIOR FILING DATE: 2020-11-20 PRIOR APPLICATION NUMBER: US 63/187,888 PRIOR FILING DATE: 2021-05-12 NUMBER OF SEQ ID NOS: 24 SEQ ID NO 11 LENGTH: 107 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: GC5B596 VL ALIGNMENT: Query Match 100.0%; Score 255; Length 107; Best Local Similarity 100.0%; Matches 47; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 RFSGSGSGTEFTLTISNLQPEDFATYYCQQYNRYPYTFGQGTKLEIK 47 ||||||||||||||||||||||||||||||||||||||||||||||| Db 61 RFSGSGSGTEFTLTISNLQPEDFATYYCQQYNRYPYTFGQGTKLEIK 107 Alignment with SEQ ID NO: 23 US-16-412-701-39 Filing date in PALM: 2019-05-15 Sequence 39, US/16412701 Publication No. US20190352421A1 GENERAL INFORMATION APPLICANT: Adams, Homer APPLICANT: Frerichs, Kris APPLICANT: Gaudet, Francois APPLICANT: Van de Donk, Niels APPLICANT: Verkleij, Christie TITLE OF INVENTION: Methods of treating cancers and
Read full office action

Prosecution Timeline

Nov 02, 2022
Application Filed
Nov 26, 2025
Non-Final Rejection — §103, §112, §DP (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12595306
TREM2 STABILIZING ANTIBODIES
2y 5m to grant Granted Apr 07, 2026
Patent 12583925
BISPECIFIC ANTIBODIES TARGETING PD1 AND VEGF
2y 5m to grant Granted Mar 24, 2026
Patent 12576133
ANTIGEN-BINDING AGENTS THAT SPECIFICALLY BIND EPIDERMAL GROWTH FACTOR RECEPTOR VARIANT III
2y 5m to grant Granted Mar 17, 2026
Patent 12559544
ANTIBODIES THAT BIND HUMAN METAPNEUMOVIRUS FUSION PROTEIN AND THEIR USE
2y 5m to grant Granted Feb 24, 2026
Patent 12558406
ANTI-TIGIT ANTIBODIES AND USE THEREOF
2y 5m to grant Granted Feb 24, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

AI Strategy Recommendation

Get an AI-powered prosecution strategy using examiner precedents, rejection analysis, and claim mapping.
Powered by AI — typically takes 5-10 seconds

Prosecution Projections

1-2
Expected OA Rounds
53%
Grant Probability
87%
With Interview (+34.4%)
3y 4m
Median Time to Grant
Low
PTA Risk
Based on 53 resolved cases by this examiner. Grant probability derived from career allow rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month