Prosecution Insights
Last updated: April 19, 2026
Application No. 18/059,135

COMPOSITIONS OF ADENOSINE DEAMINASE-2 (ADA2), VARIANTS THEREOF AND METHODS OF USING SAME

Final Rejection §112§DP
Filed
Nov 28, 2022
Examiner
BARRON, SEAN C
Art Unit
1653
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
Halozyme Inc.
OA Round
2 (Final)
53%
Grant Probability
Moderate
3-4
OA Rounds
3y 8m
To Grant
85%
With Interview

Examiner Intelligence

Grants 53% of resolved cases
53%
Career Allow Rate
323 granted / 605 resolved
-6.6% vs TC avg
Strong +32% interview lift
Without
With
+31.6%
Interview Lift
resolved cases with interview
Typical timeline
3y 8m
Avg Prosecution
68 currently pending
Career history
673
Total Applications
across all art units

Statute-Specific Performance

§101
6.2%
-33.8% vs TC avg
§103
43.6%
+3.6% vs TC avg
§102
16.0%
-24.0% vs TC avg
§112
22.4%
-17.6% vs TC avg
Black line = Tech Center average estimate • Based on career data from 605 resolved cases

Office Action

§112 §DP
DETAILED ACTION The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . Response to Amendments Applicant's amendments filed 2/05/2026 to claims 1, 2, 13, 35, 43, and 45 have been entered. Claims 40-42 are canceled. Claims 1-39 and 43-47 remain pending, and are being considered on their merits. No claims are withdrawn from consideration at this time. References not included with this Office action can be found in a prior action. The instant amendments to claim 1 have overcome the 35 U.S.C. § 112(a) rejections of record, which are withdrawn. Any other rejections of record not particularly addressed below are withdrawn in light of the claim amendments and/or applicant’s comments. Claim Rejections - 35 USC § 112 The following is a quotation of 35 U.S.C. 112(d): (d) REFERENCE IN DEPENDENT FORMS.—Subject to subsection (e), a claim in dependent form shall contain a reference to a claim previously set forth and then specify a further limitation of the subject matter claimed. A claim in dependent form shall be construed to incorporate by reference all the limitations of the claim to which it refers. The following is a quotation of pre-AIA 35 U.S.C. 112, fourth paragraph: Subject to the following paragraph [i.e., the fifth paragraph of pre-AIA 35 U.S.C. 112], a claim in dependent form shall contain a reference to a claim previously set forth and then specify a further limitation of the subject matter claimed. A claim in dependent form shall be construed to incorporate by reference all the limitations of the claim to which it refers. Claims 2 and 38 are rejected under 35 U.S.C. 112(d) or pre-AIA 35 U.S.C. 112, 4th paragraph, as being of improper dependent form for failing to further limit the subject matter of the claim upon which it depends, or for failing to include all the limitations of the claim upon which it depends. Claim 2 recites “the variant ADA2 protein or catalytically active portion thereof has at least 95% sequence identity with the unmodified ADA2 protein of any of SEQ ID NO: 326-330, and 380-383 or with a catalytically active portion of ADA2 protein of any of SEQ ID NO: 326-330, and 380-383”. Claim 38 recites “wherein the unmodified ADA2 protein comprises the sequence of amino acids set forth in any of SEQ ID NO: 5, 326-330, and 380-383 or is a catalytically active portion thereof”. Both claims 2 and 38 depend from claim 1, but claim 1 is already limited to SEQ ID NO: 5 for the variant or catalytically active portion thereof and the unmodified ADA2 and so claims 2 and 38 broaden the scope of and so fail to further limit claim 1. Applicant may cancel the claim(s), amend the claim(s) to place the claim(s) in proper dependent form, rewrite the claim(s) in independent form, or present a sufficient showing that the dependent claim(s) complies with the statutory requirements. Double Patenting The nonstatutory double patenting rejection is based on a judicially created doctrine grounded in public policy (a policy reflected in the statute) so as to prevent the unjustified or improper timewise extension of the “right to exclude” granted by a patent and to prevent possible harassment by multiple assignees. A nonstatutory double patenting rejection is appropriate where the conflicting claims are not identical, but at least one examined application claim is not patentably distinct from the reference claim(s) because the examined application claim is either anticipated by, or would have been obvious over, the reference claim(s). See, e.g., In re Berg, 140 F.3d 1428, 46 USPQ2d 1226 (Fed. Cir. 1998); In re Goodman, 11 F.3d 1046, 29 USPQ2d 2010 (Fed. Cir. 1993); In re Longi, 759 F.2d 887, 225 USPQ 645 (Fed. Cir. 1985); In re Van Ornum, 686 F.2d 937, 214 USPQ 761 (CCPA 1982); In re Vogel, 422 F.2d 438, 164 USPQ 619 (CCPA 1970); In re Thorington, 418 F.2d 528, 163 USPQ 644 (CCPA 1969). A timely filed terminal disclaimer in compliance with 37 CFR 1.321(c) or 1.321(d) may be used to overcome an actual or provisional rejection based on nonstatutory double patenting provided the reference application or patent either is shown to be commonly owned with the examined application, or claims an invention made as a result of activities undertaken within the scope of a joint research agreement. See MPEP § 717.02 for applications subject to examination under the first inventor to file provisions of the AIA as explained in MPEP § 2159. See MPEP § 2146 et seq. for applications not subject to examination under the first inventor to file provisions of the AIA . A terminal disclaimer must be signed in compliance with 37 CFR 1.321(b). The filing of a terminal disclaimer by itself is not a complete reply to a nonstatutory double patenting (NSDP) rejection. A complete reply requires that the terminal disclaimer be accompanied by a reply requesting reconsideration of the prior Office action. Even where the NSDP rejection is provisional the reply must be complete. See MPEP § 804, subsection I.B.1. For a reply to a non-final Office action, see 37 CFR 1.111(a). For a reply to final Office action, see 37 CFR 1.113(c). A request for reconsideration while not provided for in 37 CFR 1.113(c) may be filed after final for consideration. See MPEP §§ 706.07(e) and 714.13. The USPTO Internet website contains terminal disclaimer forms which may be used. Please visit www.uspto.gov/patent/patents-forms. The actual filing date of the application in which the form is filed determines what form (e.g., PTO/SB/25, PTO/SB/26, PTO/AIA /25, or PTO/AIA /26) should be used. A web-based eTerminal Disclaimer may be filled out completely online using web-screens. An eTerminal Disclaimer that meets all requirements is auto-processed and approved immediately upon submission. For more information about eTerminal Disclaimers, refer to www.uspto.gov/patents/apply/applying-online/eterminal-disclaimer. Claims 1-39 and 43-47 are rejected on the ground of nonstatutory double patenting as being unpatentable over claims 1, 4, 5, and 11-23 of U.S. Patent No. 9,969,998. Although the claims at issue are not identical, they are not patentably distinct from each other because claim 1 of the ‘998 patent is the narrower embodiment of instant claim 1 and recites an ADA2 variant wherein 1) the unmodified ADA2 protein is at least identical to SEQ ID NO: 5 and comprising generic substitutions at positions 219 and 262, 2) wherein SEQ ID NO: 5 in the instant application and the ‘998 patent are 100% identical (see the sequence alignment below), 3) the variant ADA2 protein, when in dimer form, exhibits increased adenosine deaminase activity or increased adenosine deaminase activity and reduced heparin binding compared to the dimer form of the unmodified ADA2 protein of SEQ ID NO:5 or dimer form of the catalytically active portion thereof, 4) and the variant ADA2 protein, when in dimer form, exhibits adenosine deaminase activity to convert adenosine to inosine, reading on instant claims 1, 4, 12, 36, 37, and 45. None of the claims of the ‘998 patent claim positively recite the ADA2 protein and dimer thereof being capable of binding to any species of growth factor receptor, reading on the negative limitation of claim 35. Claims 4 and 5 of the ‘998 patent reads on instant claims 2 and 38. Claim 11 of the ‘998 patent recites The variant ADA2 protein or catalytically active portion thereof of claim 10, selected from among any of: “R219Q/S262N/R20N/V22S, R219Q/S262N/K371N/D373S, R219Q/S262N/K372N/I374S, R219Q/S262N/T403N/H405S, R219Q/S262N/G404N/P406S, R219Q/S262N/C105-T147del→(Gly)7, R219Q/S262N/C105-T147del→(Gly)10, R219Q/S262N/C105-T147del→(Gly)7, R219Q/S262N/C105-T147del→(Gly)5, R219Q/S262N/C105-T147del→(Gly)3, R219Q/S262N/R125N/P126A, R219Q/S262N/S127N/K129S, R219Q/S262N/P126N/E128T, R219Q/S262N/R112N/I114T, R219Q/S262N/I134N/L135C/L136T, R219Q/S262N/I134N/L135S/L136T, R219Q/S262N/R142N/Q144S, R219Q/S262N/E137N/Y139T, R219Q/S262N/P111N/G113S, R219Q/S262N/F119S, R219Q/S262N/F119K, R219Q/S262N/Y224R, R219Q/S262N/Y224N, R219Q/S262N/Y191S, R219Q/S262N/Y191D, R219Q/S262N/F183K, R219Q/S262N/Y191D/Y224R, R219Q/S262N/F109S, R219Q/S262N/F109A, R219Q/S262N/R118D, R219Q/S262N/R118A, R219Q/S262N/Y139T, R219Q/S262N/Y139A, R219Q/S262N/W133S, R219Q/S262N/W133T, R219Q/S262N/P124A, R219Q/S262N/P124S, R219Q/S262N/V99-Q144del→(GGGGS)1, R219Q/S262N/V99-Q144del→(GGGGS)2, R219Q/S262N/V99-Q144del→(GGGGS)3, R219Q/S262N/C105-T147del→(GGGGS)1, R219Q/S262N/C105-T147del→(GGGGS)2, R219Q/S262N/C105-T147del→(GGGGS)3, R219Q/S262N/K371D/V99-Q144del→(GGGGS)1, R219Q/S262N/K371D/V99-Q144del→(GGGGS)2, R219Q/S262N/K371D/V99-Q144del→(GGGGS)3, R219Q/S262N/K371D/C105-T147del→(GGGGS)1, R219Q/S262N/K371D/C105-T147del→(GGGGS)2, R219Q/S262N/K371D/C105-T147del→(GGGGS)3, R219Q/S262N/C105-T147del→(Gly), R219Q/S262N/K11A, R219Q/S262N/K11D, R219Q/S262N/K11E, R219Q/S262N/K13A, R219Q/S262N/K13D, R219Q/S262N/V99-Q144del→(GGGGS),R219Q/S262N/C105-T147del→(GGGGS)n, R219Q/S262N/N98-N156del, R219Q/S262N/C105-E148del, R219Q/S262N/C105-T147del, R219Q/S262N/V99-Q144del, R219Q/S262N/K371D/C105-T147del→(Gly)n, R219Q/S262N/K371D/C105-T147del→(Gly)15, R219Q/S262N/K371D/C105-T147del→(Gly)10, R219Q/S262N/K371D/C105-T147del→(Gly)7, R219Q/S262N/K371D/C105-T147del→(Gly)5, R219Q/S262N/K371D/C105-T147del→(Gly)3, R219Q/S262N/K371D/V99-Q144del→(GGGGS)n, R219Q/S262N/K371D/C105-T147del→(GGGGS)n, R219Q/S262N/K371D/N98-N156del, R219Q/S262N/K371D/C105-E148del, R219Q/S262N/K371D/C105-T147del, R219Q/S262N/K371D/V99-Q144del, R219Q/S262N/K13E, R219Q/S262N/K371A, R219Q/S262N/K372A, R219Q/S262N/K372D, R219Q/S262N/K372E, R219Q/S262N/K452A, R219Q/S262N/K452D, R219Q/S262N/K452E, R219Q/S262N/R20A, R219Q/S262N/R20D, R219Q/S262N/R366A, R219Q/S262N/R366D, R219Q/S262N/R366E, R219Q/S262N/H264A, R219Q/S262N/H264Q, R219Q/S262N/H264N, R219Q/S262N/H264G, R219K/S262N, R219N/S262N, R219A/S262N, R219Q/S262N/L221A, R219Q/S262N/L221V, R219Q/S262N/L221G, R219Q/S262N/E179D, R219Q/S262N/E179A, R219Q/S262N/E179S, R219Q/S262N/E179T, R219Q/S262N/E179V, R219Q/S262N/E179G, R219Q/S262A, R219Q/S262V, R219Q/S262M, R219Q/S262N/K11A/R20A, R219Q/S262N/K11A/R20A/K371A, R219Q/S262N/R20A/K371A, R219Q/S262N/K11A/K371A, R219Q/S262N/K26A, R219Q/S262N/K26D, R219Q/S262N/K26E, R219Q/S262N/R217A, R219Q/S262N/R217D, R219Q/S262N/R217E, R219Q/S262N/K258A, R219Q/S262N/K258D, R219Q/S262N/K258E, R219Q/S262N/R277A, R219Q/S262N/R277D, R219Q/S262N/R277E, R219Q/S262N/R283A, R219Q/S262N/R283D, R219Q/S262N/R283E, R219Q/S262N/K309A, R219Q/S262N/K309D, R219Q/S262N/K309E, R219Q/S262N/K317A, R219Q/S262N/K317D, R219Q/S262N/K317E, R219Q/S262N/K321A, R219Q/S262N/K321D, R219Q/S262N/K321E, R219Q/S262N/R352A, R219Q/S262N/R352D, R219Q/S262N/R352E, R219Q/S262N/R441A, R219Q/S262N/R441D, R219Q/S262N/R441E, R219Q/S262N/K444A, R219Q/S262N/K444D, R219Q/S262N/K444E, R219Q/S262N/K461A, R219Q/S262N/K461D, R219Q/S262N/K461E, R219Q/S262N/K469A, R219Q/S262N/K469D, R219Q/S262N/K469E, R219Q/S262N/K470A, R219Q/S262N/K470D, R219Q/S262N/K470E, R219Q/S262N/D86A, R219Q/S262N/D86C, R219Q/S262N/D86E, R219Q/S262N/D86F, R219Q/S262N/D86G, R219Q/S262N/D86H, R219Q/S262N/D86I, R219Q/S262N/D86K, R219Q/S262N/D86L, R219Q/S262N/D86M, R219Q/S262N/D86N, R219Q/S262N/D86P, R219Q/S262N/D86Q, R219Q/S262N/D86R, R219Q/S262N/D86S, R219Q/S262N/D86T, R219Q/S262N/D86V, R219Q/S262N/D86W, R219Q/S262N/D86Y, R219Q/S262N/E179C, R219Q/S262N/E179F, R219Q/S262N/E179H, R219Q/S262N/E179I, R219Q/S262N/E179K, R219Q/S262N/E179L, R219Q/S262N/E179M, R219Q/S262N/E179N, R219Q/S262N/E179P, R219Q/S262N/E179Q, R219Q/S262N/E179R, R219Q/S262N/E179W, R219Q/S262N/E179Y, R219C/S262N, R219D/S262N, R219E/S262N, R219F/S262N, R219G/S262N, R219H/S262N, R219I/S262N, R219L/S262N, R219M/S262N, R219P/S262N, R219S/S262N, R219T/S262N, R219V/S262N, R219W/S262N, R219Y/S262N, R219Q/S262N/L221C, R219Q/S262N/L221D, R219Q/S262N/L221E, R219Q/S262N/L221F, R219Q/S262N/L221H, R219Q/S262N/L221I, R219Q/S262N/L221K, R219Q/S262N/L221M, R219Q/S262N/L221N, R219Q/S262N/L221P, R219Q/S262N/L221Q, R219Q/S262N/L221R, R219Q/S262N/L221S, R219Q/S262N/L221T, R219Q/S262N/L221W, R219Q/S262N/L221Y, R219Q/S262C, R219Q/S262D, R219Q/S262E, R219Q/S262F, R219Q/S262G, R219Q/S262H, R219Q/S262I, R219Q/S262K, R219Q/S262L, R219Q/S262P, R219Q/S262Q, R219Q/S262R, R219Q/S262T, R219Q/S262W, R219Q/S262Y, R219Q/S262N/H264C, R219Q/S262N/H264D, R219Q/S262N/H264E, R219Q/S262N/H264F, R219Q/S262N/H264I, R219Q/S262N/H264K, R219Q/S262N/H264L, R219Q/S262N/H264M, R219Q/S262N/H264P, R219Q/S262N/H264R, R219Q/S262N/H264S, R219Q/S262N/H264T, R219Q/S262N/H264V, R219Q/S262N/H264W, R219Q/S262N/H264Y, R219Q/S262N/S266A, R219Q/S262N/S266C, R219Q/S262N/S266D, R219Q/S262N/S266E, R219Q/S262N/S266F, R219Q/S262N/S266G, R219Q/S262N/S266H, R219Q/S262N/S266I, R219Q/S262N/S266K, R219Q/S262N/S266L, R219Q/S262N/S266M, R219Q/S262N/S266N, R219Q/S262N/S266P, R219Q/S262N/S266Q, R219Q/S262N/S266R, R219Q/S262N/S266T, R219Q/S262N/S266V, R219Q/S262N/S266W, R219Q/S262N/S266Y, R219Q/S262N/K267A, R219Q/S262N/K267C, R219Q/S262N/K267D, R219Q/S262N/K267E, R219Q/S262N/K267F, R219Q/S262N/K267G, R219Q/S262N/K267H, R219Q/S262N/K267I, R219Q/S262N/K267L, R219Q/S262N/K267M, R219Q/S262N/K267N, R219Q/S262N/K267P, R219Q/S262N/K267Q, R219Q/S262N/K267R, R219Q/S262N/K267S, R219Q/S262N/K267T, R219Q/S262N/K267V, R219Q/S262N/K267W, R219Q/S262N/K267Y, R219Q/S262N/V296A, R219Q/S262N/V296C, R219Q/S262N/V296D, R219Q/S262N/V296E, R219Q/S262N/V296F, R219Q/S262N/V296G, R219Q/S262N/V296H, R219Q/S262N/V2961, R219Q/S262N/V296K, R219Q/S262N/V296L, R219Q/S262N/V296M, R219Q/S262N/V296N, R219Q/S262N/V296P, R219Q/S262N/V296Q, R219Q/S262N/V296R, R219Q/S262N/V296S, R219Q/S262N/V296T, R219Q/S262N/V296W and R219Q/S262N/V296Y.” and so reads on instant claims 3, 5-11, 14-23, 39, and 43-47. Claims 2 and 3 of the ‘998 patent reads on instant claims 25-27. Claim 30 of the ‘998 patent reads on instant claim 24. Claim 27-28 of the ‘998 patent reads on instant claims 28, 29, 31, 33. Claim 22 of the ‘998 patent reads on instant claim 34. Claim 30 of the ‘998 patent reads on instant claims 24, 29, 30, and 31. RESULT 1 US-15-094-908A-5 (NOTE: this sequence has 3 duplicates in the database searched. See complete list at the end of this report) Sequence 5, US/15094908A Patent No. 9969998 GENERAL INFORMATION APPLICANT: Christopher D. Thanos APPLICANT: Lin Wang APPLICANT: H. Michael Shepard TITLE OF INVENTION: COMPOSITIONS OF ADENOSINE DEAMINASE-2 TITLE OF INVENTION: (ADA2), VARIANTS THEREOF AND METHODS OF USING SAME FILE REFERENCE: 33320.03121.US01/3121 CURRENT APPLICATION NUMBER: US/15/094,908A CURRENT FILING DATE: 2016-04-08 PRIOR APPLICATION NUMBER: PCT/US15/55613 PRIOR FILING DATE: 2015-10-14 PRIOR APPLICATION NUMBER: 62/063,936 PRIOR FILING DATE: 2014-10-14 NUMBER OF SEQ ID NOS: 931 SEQ ID NO 5 LENGTH: 482 TYPE: PRT ORGANISM: Homo sapiens FEATURE: OTHER INFORMATION: ADA2 mature protein Query Match 100.0%; Score 2541; Length 482; Best Local Similarity 100.0%; Matches 482; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 IDETRAHLLLKEKMMRLGGRLVLNTKEELANERLMTLKIAEMKEAMRTLIFPPSMHFFQA 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 IDETRAHLLLKEKMMRLGGRLVLNTKEELANERLMTLKIAEMKEAMRTLIFPPSMHFFQA 60 Qy 61 KHLIERSQVFNILRMMPKGAALHLHDIGIVTMDWLVRNVTYRPHCHICFTPRGIMQFRFA 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 KHLIERSQVFNILRMMPKGAALHLHDIGIVTMDWLVRNVTYRPHCHICFTPRGIMQFRFA 120 Qy 121 HPTPRPSEKCSKWILLEDYRKRVQNVTEFDDSLLRNFTLVTQHPEVIYTNQNVVWSKFET 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 HPTPRPSEKCSKWILLEDYRKRVQNVTEFDDSLLRNFTLVTQHPEVIYTNQNVVWSKFET 180 Qy 181 IFFTISGLIHYAPVFRDYVFRSMQEFYEDNVLYMEIRARLLPVYELSGEHHDEEWSVKTY 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 IFFTISGLIHYAPVFRDYVFRSMQEFYEDNVLYMEIRARLLPVYELSGEHHDEEWSVKTY 240 Qy 241 QEVAQKFVETHPEFIGIKIIYSDHRSKDVAVIAESIRMAMGLRIKFPTVVAGFDLVGHED 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 QEVAQKFVETHPEFIGIKIIYSDHRSKDVAVIAESIRMAMGLRIKFPTVVAGFDLVGHED 300 Qy 301 TGHSLHDYKEALMIPAKDGVKLPYFFHAGETDWQGTSIDRNILDALMLNTTRIGHGFALS 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 TGHSLHDYKEALMIPAKDGVKLPYFFHAGETDWQGTSIDRNILDALMLNTTRIGHGFALS 360 Qy 361 KHPAVRTYSWKKDIPIEVCPISNQVLKLVSDLRNHPVATLMATGHPMVISSDDPAMFGAK 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 KHPAVRTYSWKKDIPIEVCPISNQVLKLVSDLRNHPVATLMATGHPMVISSDDPAMFGAK 420 Qy 421 GLSYDFYEVFMGIGGMKADLRTLKQLAMNSIKYSTLLESEKNTFMEIWKKRWDKFIADVA 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 421 GLSYDFYEVFMGIGGMKADLRTLKQLAMNSIKYSTLLESEKNTFMEIWKKRWDKFIADVA 480 Qy 481 TK 482 || Db 481 TK 482 Claims 1-39 and 43-47 are rejected on the ground of nonstatutory double patenting as being unpatentable over claims 2-53 of U.S. Patent No. 11,584,923. Although the claims at issue are not identical, they are not patentably distinct from each other because claims 2 and 51-53 of the ‘923 patent are narrower embodiments of instant claim 1. Claim 2 and 53 of the ‘923 patent and recites an ADA2 variant wherein 1) the unmodified ADA2 protein is at least 95% identical to SEQ ID NO: 5, 2) the variant ADA2 protein comprises one or more amino acid replacements at an amino acid position corresponding to amino acid residue 11, 13, 20, 22, 26, 86, 109, 118, 119, 124, 133, 139, 179, 183, 191, 217, 219, 221, 224, 258, 262, 264, 266, 267, 277, 283, 296, 309, 317, 321, 352, 366, 371, 372, 373, 374, 403, 404, 405, 406, 441, 444, 452, 461, 469 or 470 with reference to amino acid positions set forth in SEQ ID NO:5, 3) when in dimer form, exhibits one or more properties selected from among increased adenosine deaminase activity, reduced heparin binding, longer serum half-life, altered pH optimum, increased thermal stability, altered receptor binding, and hyperglycosylation compared to the corresponding dimer form of the unmodified ADA2 protein of SEQ ID NO:5 or dimer form of the corresponding catalytically activity portion thereof; and the variant ADA2 protein, when in dimer form, exhibits adenosine deaminase activity to convert adenosine to inosine, and 4) wherein SEQ ID NO: 5 in the instant application and the ‘998 patent are 100% identical (see the sequence alignment below), reading on instant claims 1. Claims 14 and 51 of the ‘923 patent recites an variant ADA2 protein or catalytically active portion thereof that comprises deletion of all or a portion of the PRB, reading on instant claim 1. Claim 52 of the ‘923 patent recites an variant ADA2 protein or catalytically active portion thereof that comprises a linker in place of the deleted PRB domain or deleted portion thereof, reading on instant claim 1. In the same order presented, claims 3-50 of the ‘923 patent reads on instant claims 2-38. Claim 7 of the ‘923 patent recites a plurality of amino acid substitutions that reads on instant claim 39. Claims 44-46 of the ‘923 patent reads on instant claims 43-45. Claims 48 and 49 of the ‘923 patent reads on instant claims 46 and 47. RESULT 1 US-15-094-908A-5 (NOTE: this sequence has 3 duplicates in the database searched. See complete list at the end of this report) Sequence 5, US/15094908A Patent No. 9969998 GENERAL INFORMATION APPLICANT: Christopher D. Thanos APPLICANT: Lin Wang APPLICANT: H. Michael Shepard TITLE OF INVENTION: COMPOSITIONS OF ADENOSINE DEAMINASE-2 TITLE OF INVENTION: (ADA2), VARIANTS THEREOF AND METHODS OF USING SAME FILE REFERENCE: 33320.03121.US01/3121 CURRENT APPLICATION NUMBER: US/15/094,908A CURRENT FILING DATE: 2016-04-08 PRIOR APPLICATION NUMBER: PCT/US15/55613 PRIOR FILING DATE: 2015-10-14 PRIOR APPLICATION NUMBER: 62/063,936 PRIOR FILING DATE: 2014-10-14 NUMBER OF SEQ ID NOS: 931 SEQ ID NO 5 LENGTH: 482 TYPE: PRT ORGANISM: Homo sapiens FEATURE: OTHER INFORMATION: ADA2 mature protein =================================== RESULT 1: 3 DUPLICATES: =================================== Result Query Filing No. Score Match Length ID Date Dups Description ------------------------------------------------------------------------------------------------------------- 1 2541 100.0 482 US-15-094-908A-5 2016-04-08 3 COMPOSITIONS OF ADENOSINE DEAMINASE-2 (ADA2), VARIANTS THEREOF AND METHODS OF US ALIGNMENT: Query Match 100.0%; Score 2541; Length 482; Best Local Similarity 100.0%; Matches 482; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 IDETRAHLLLKEKMMRLGGRLVLNTKEELANERLMTLKIAEMKEAMRTLIFPPSMHFFQA 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 IDETRAHLLLKEKMMRLGGRLVLNTKEELANERLMTLKIAEMKEAMRTLIFPPSMHFFQA 60 Qy 61 KHLIERSQVFNILRMMPKGAALHLHDIGIVTMDWLVRNVTYRPHCHICFTPRGIMQFRFA 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 KHLIERSQVFNILRMMPKGAALHLHDIGIVTMDWLVRNVTYRPHCHICFTPRGIMQFRFA 120 Qy 121 HPTPRPSEKCSKWILLEDYRKRVQNVTEFDDSLLRNFTLVTQHPEVIYTNQNVVWSKFET 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 HPTPRPSEKCSKWILLEDYRKRVQNVTEFDDSLLRNFTLVTQHPEVIYTNQNVVWSKFET 180 Qy 181 IFFTISGLIHYAPVFRDYVFRSMQEFYEDNVLYMEIRARLLPVYELSGEHHDEEWSVKTY 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 IFFTISGLIHYAPVFRDYVFRSMQEFYEDNVLYMEIRARLLPVYELSGEHHDEEWSVKTY 240 Qy 241 QEVAQKFVETHPEFIGIKIIYSDHRSKDVAVIAESIRMAMGLRIKFPTVVAGFDLVGHED 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 QEVAQKFVETHPEFIGIKIIYSDHRSKDVAVIAESIRMAMGLRIKFPTVVAGFDLVGHED 300 Qy 301 TGHSLHDYKEALMIPAKDGVKLPYFFHAGETDWQGTSIDRNILDALMLNTTRIGHGFALS 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 TGHSLHDYKEALMIPAKDGVKLPYFFHAGETDWQGTSIDRNILDALMLNTTRIGHGFALS 360 Qy 361 KHPAVRTYSWKKDIPIEVCPISNQVLKLVSDLRNHPVATLMATGHPMVISSDDPAMFGAK 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 KHPAVRTYSWKKDIPIEVCPISNQVLKLVSDLRNHPVATLMATGHPMVISSDDPAMFGAK 420 Qy 421 GLSYDFYEVFMGIGGMKADLRTLKQLAMNSIKYSTLLESEKNTFMEIWKKRWDKFIADVA 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 421 GLSYDFYEVFMGIGGMKADLRTLKQLAMNSIKYSTLLESEKNTFMEIWKKRWDKFIADVA 480 Qy 481 TK 482 || Db 481 TK 482 DUPLICATES: US-15-940-803-5 Filing date in PALM: 2018-03-29 Sequence 5, US/15940803 Patent No. 11584923 GENERAL INFORMATION APPLICANT: Christopher D. Thanos APPLICANT: Lin Wang APPLICANT: H. Michael Shepard TITLE OF INVENTION: COMPOSITIONS OF ADENOSINE DEAMINASE-2 TITLE OF INVENTION: (ADA2), VARIANTS THEREOF AND METHODS OF USING SAME FILE REFERENCE: 33320.03121.US12/3121B CURRENT APPLICATION NUMBER: US/15/940,803 CURRENT FILING DATE: 2018-03-29 PRIOR APPLICATION NUMBER: 15/094,908 PRIOR FILING DATE: 2016-04-08 PRIOR APPLICATION NUMBER: PCT/US15/55613 PRIOR FILING DATE: 2015-10-14 PRIOR APPLICATION NUMBER: 62/063,936 PRIOR FILING DATE: 2014-10-14 NUMBER OF SEQ ID NOS: 931 SEQ ID NO 5 LENGTH: 482 TYPE: PRT ORGANISM: Homo sapiens FEATURE: OTHER INFORMATION: ADA2 mature protein Conclusion No claims are allowed. Applicant's amendment necessitated the new ground(s) of rejection presented in this Office action. Accordingly, THIS ACTION IS MADE FINAL. See MPEP § 706.07(a). Applicant is reminded of the extension of time policy as set forth in 37 CFR 1.136(a). A shortened statutory period for reply to this final action is set to expire THREE MONTHS from the mailing date of this action. In the event a first reply is filed within TWO MONTHS of the mailing date of this final action and the advisory action is not mailed until after the end of the THREE-MONTH shortened statutory period, then the shortened statutory period will expire on the date the advisory action is mailed, and any nonprovisional extension fee (37 CFR 1.17(a)) pursuant to 37 CFR 1.136(a) will be calculated from the mailing date of the advisory action. In no event, however, will the statutory period for reply expire later than SIX MONTHS from the mailing date of this final action. Any inquiry concerning this communication or earlier communications from the examiner should be directed to SEAN C BARRON whose telephone number is (571)270-5111. The examiner can normally be reached 7:30am-3:30pm EDT/EST (M-F). Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Sharmila Landau can be reached at 571-272-0614. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /Sean C. Barron/Primary Examiner, Art Unit 1653
Read full office action

Prosecution Timeline

Nov 28, 2022
Application Filed
Aug 01, 2025
Non-Final Rejection — §112, §DP
Feb 05, 2026
Response Filed
Mar 11, 2026
Final Rejection — §112, §DP (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12584906
COATING AGENT FOR INDUCING DIFFERENTIATION OF PLURIPOTENT STEM CELLS INTO BRAIN MICROVASCULAR ENDOTHELIUM-LIKE CELLS AND USE THEREOF
2y 5m to grant Granted Mar 24, 2026
Patent 12558424
T CELLS HAVING ENHANCED ANTI-TUMOR ACTIVITY
2y 5m to grant Granted Feb 24, 2026
Patent 12550890
SYSTEM AND METHOD FOR MAINTAINING ORGAN VIABILITY
2y 5m to grant Granted Feb 17, 2026
Patent 12551511
METHODS TO DIFFERENTIATE STEM CELLS INTO HORMONE-PRODUCING CELLS
2y 5m to grant Granted Feb 17, 2026
Patent 12544407
FIBROBLAST CELL THERAPY FOR TREATMENT OF OSTEOPOROSIS
2y 5m to grant Granted Feb 10, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

AI Strategy Recommendation

Get an AI-powered prosecution strategy using examiner precedents, rejection analysis, and claim mapping.
Powered by AI — typically takes 5-10 seconds

Prosecution Projections

3-4
Expected OA Rounds
53%
Grant Probability
85%
With Interview (+31.6%)
3y 8m
Median Time to Grant
Moderate
PTA Risk
Based on 605 resolved cases by this examiner. Grant probability derived from career allow rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month