Prosecution Insights
Last updated: April 19, 2026
Application No. 18/080,634

PROSTATE CANCER VACCINES AND USES THEREOF

Non-Final OA §103§112
Filed
Dec 13, 2022
Examiner
BARRERA, IMMACULADA
Art Unit
1671
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
Janssen Biotech Inc.
OA Round
1 (Non-Final)
32%
Grant Probability
At Risk
1-2
OA Rounds
3y 11m
To Grant
99%
With Interview

Examiner Intelligence

Grants only 32% of cases
32%
Career Allow Rate
6 granted / 19 resolved
-28.4% vs TC avg
Strong +81% interview lift
Without
With
+81.3%
Interview Lift
resolved cases with interview
Typical timeline
3y 11m
Avg Prosecution
40 currently pending
Career history
59
Total Applications
across all art units

Statute-Specific Performance

§101
4.6%
-35.4% vs TC avg
§103
32.5%
-7.5% vs TC avg
§102
14.0%
-26.0% vs TC avg
§112
27.6%
-12.4% vs TC avg
Black line = Tech Center average estimate • Based on career data from 19 resolved cases

Office Action

§103 §112
Notice of Pre-AIA or AIA Status The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . Preliminary Amendment The preliminary amendment dated 12/43/2022 has been entered. Claims 1-21 are pending and under examination. Priority Applicant’s claim for the benefit of a prior-filed application under 35 U.S.C. 119(e) or under 35 U.S.C. 120, 121, 365(c), or 386(c) is acknowledged. The earliest possible effective filing date for the instant claims is December 16, 2021 based on the filing date of the provisional application 63/290,164 Claim Rejections - 35 USC § 112 The following is a quotation of 35 U.S.C. 112(b): (b) CONCLUSION.—The specification shall conclude with one or more claims particularly pointing out and distinctly claiming the subject matter which the inventor or a joint inventor regards as the invention. The following is a quotation of 35 U.S.C. 112 (pre-AIA ), second paragraph: The specification shall conclude with one or more claims particularly pointing out and distinctly claiming the subject matter which the applicant regards as his invention. Claims 3-6, 8, 14 and 16-17 are rejected under 35 U.S.C. 112(b) or 35 U.S.C. 112 (pre-AIA ), second paragraph, as being indefinite for failing to particularly point out and distinctly claim the subject matter which the inventor or a joint inventor (or for applications subject to pre-AIA 35 U.S.C. 112, the applicant), regards as the invention. Claims 3-6, 8, 14 and 16-17 all recite the limitation "….vaccines comprising the GAd20 virus, …. comprising the MVA virus, or ….. comprising the GAd20 virus and …. vaccines comprising the MVA virus..”. It is unclear if this recited vaccine GAd20 virus comprises a nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 1. It is unclear if this recited vaccine MVA virus comprises a nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 3. If the recited vaccine GAd20 virus does not comprise a nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 1 and if the recited vaccine MVA virus does not comprise a nucleotide sequence encoding the amino acid sequence of SEQ ID NO:3, there is insufficient antecedent basis for the GAd20 virus and the MVA virus recitation. For the purpose of compact prosecution, it has been interpreted that the recited “vaccine GAd20 virus” means the “vaccine GAd20 virus comprising a nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 1” and that the recited “vaccine MVA virus” means the “vaccine MVA virus comprising a nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 3”. Appropriate correction is required for all the claims reciting the vaccines only as GAd20 virus or MVA virus . Claims 15, 20 and 21 are rejected under 35 U.S.C. 112(b) or 35 U.S.C. 112 (pre-AIA ), second paragraph, as being indefinite for failing to particularly point out and distinctly claim the subject matter which the inventor or a joint inventor (or for applications subject to pre-AIA 35 U.S.C. 112, the applicant), regards as the invention. Claims 15, 20 and 21 all recite “…a vaccine comprising the GAd20….., a vaccine comprising the MVA virus…..”. It is unclear if this recited vaccine GAd20 virus comprises a nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 1. It is unclear if this recited vaccine MVA virus comprises a nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 3. If the recited vaccine GAd20 virus does not comprise a nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 1 and if the recited vaccine MVA virus does not comprise a nucleotide sequence encoding the amino acid sequence of SEQ ID NO:3, there is insufficient antecedent basis for the GAd20 virus and the MVA virus recitation. For the purpose of compact prosecution, it has been interpreted that the recited “vaccine GAd20 virus” means the “vaccine GAd20 virus comprising a nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 1” and that the recited “vaccine MVA virus” means the “vaccine MVA virus comprising a nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 3”. Appropriate correction is required. Claims 6 is rejected under 35 U.S.C. 112(b) or 35 U.S.C. 112 (pre-AIA ), second paragraph, as being indefinite for failing to particularly point out and distinctly claim the subject matter which the inventor or a joint inventor (or for applications subject to pre-AIA 35 U.S.C. 112, the applicant), regards as the invention. Claim 6 recites the limitation "….the anti-CTLA-4 antibody….”. Claim 8 recites the limitation " ….the anti-PD-1 antibody …”. There is insufficient antecedent basis for the “the antibody” limitations in claims 6 and 8. Both claims depend on claim 1 and there is no mention of any antibody in claim 1. Appropriate correction is required. Claim Rejections - 35 USC § 112 The following is a quotation of 35 U.S.C. 112(d): (d) REFERENCE IN DEPENDENT FORMS.—Subject to subsection (e), a claim in dependent form shall contain a reference to a claim previously set forth and then specify a further limitation of the subject matter claimed. A claim in dependent form shall be construed to incorporate by reference all the limitations of the claim to which it refers. The following is a quotation of pre-AIA 35 U.S.C. 112, fourth paragraph: Subject to the following paragraph [i.e., the fifth paragraph of pre-AIA 35 U.S.C. 112], a claim in dependent form shall contain a reference to a claim previously set forth and then specify a further limitation of the subject matter claimed. A claim in dependent form shall be construed to incorporate by reference all the limitations of the claim to which it refers. Claim 10 is rejected under 35 U.S.C. 112(d) or pre-AIA 35 U.S.C. 112, 4th paragraph, as being of improper dependent form for failing to further limit the subject matter of the claim upon which it depends, or for failing to include all the limitations of the claim upon which it depends. Claim 10 is dependent on claim 1. Claim 1 is drawn to a method of treating or preventing prostate cancer, comprising administering a treatment regimen comprising: two or more vaccines comprising a GAd20 virus that, in turn, comprises a nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 1 ….” Claim 10 fails to further limit the subject matter of the claim upon which it depend. Instead, the claim recitation “….wherein each of the: one or more GAd20 virus, …...” is broader in scope. Applicant may cancel the claim(s), amend the claim(s) to place the claim(s) in proper dependent form, rewrite the claim(s) in independent form, or present a sufficient showing that the dependent claim(s) complies with the statutory requirements. Claim Rejections - 35 USC § 112 The following is a quotation of the first paragraph of 35 U.S.C. 112(a): (a) IN GENERAL.—The specification shall contain a written description of the invention, and of the manner and process of making and using it, in such full, clear, concise, and exact terms as to enable any person skilled in the art to which it pertains, or with which it is most nearly connected, to make and use the same, and shall set forth the best mode contemplated by the inventor or joint inventor of carrying out the invention. The following is a quotation of the first paragraph of pre-AIA 35 U.S.C. 112: The specification shall contain a written description of the invention, and of the manner and process of making and using it, in such full, clear, concise, and exact terms as to enable any person skilled in the art to which it pertains, or with which it is most nearly connected, to make and use the same, and shall set forth the best mode contemplated by the inventor of carrying out his invention. Claims 1-21 are rejected under 35 U.S.C. § 112 (a), or 35 U.S.C. § 112 (pre-AIA ) first paragraph, because the specification, while being enabling for a method of treating prostate cancer, it does not reasonably provide enablement for a method of preventing prostate cancer. The specification does not enable any person skilled in the art to which it pertains, or with which it is most nearly connected, to make and use the invention commensurate in scope with these claims. The instant specification fails to provide information that would allow the skilled artisan to fully practice the instant invention without undue experimentation. Attention is directed to In re Wands, 8 USPQ2d 1400 (CAFC 1988) at 1404 where the court set forth the eight factors to consider when assessing if a disclosure would have required undue experimentation. Citing Ex parte Forman, 230 USPQ 546 (BdApls 1986) at 547 the court recited eight factors: (1) the nature of the invention; (2) the state of the prior art; (3) the relative skill of those in the art; (4) the predictability or unpredictability of the art; (5) the breadth of the claims; (6) the amount of direction or guidance presented; (7) the presence or absence of working examples; and (8) the quantity of experimentation necessary. All of the Wands factors have been considered with regard to the instant claims, with the most relevant factors discussed below. Nature of the invention: Claims 1-21 of the instant application are drawn to a method of treating or preventing prostate cancer in a subject, the method comprising administering to the subject a treatment regimen comprising: two or more vaccines comprising a GAd20 virus that comprises a nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 1 and one or more vaccines comprising a Modified Vaccinia Ankara (MVA) virus that comprises a nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 3 to thereby treat or prevent the prostate cancer. This method may further comprise administering a PD-1 antibody or a CTLA-4 antibody. Therefore, the invention encompasses preventing disorders such as any type of prostate cancer. Breadth of the claims: The complex nature of the subject matter of this invention is greatly exacerbated by the breadth of the claims. The rejected claims are extremely broad. Applicant claims that the claimed vaccines (and antibodies) can be used prevent prostate cancer. Thus, the cited claims are deemed very broad since these claims read on essentially preventing any type of prostate cancer in any subject comprising the administration of the claimed vaccines (and PD-1 or CTLA-4 antibodies) which includes subjects at risk of developing any type of prostate cancer. State of the Prior Art: While the state of the art with regard to the treatment of cancer is relatively high, the state of the art with regard to the prevention of cancer is underdeveloped. This is because there would be no way to determine that cancer would have predictably occurred without treatment. Regarding prevention of cancer, the American Cancer Society maintains that “There's no sure way to prevent cancer, but you can help reduce your risk by making healthy choices like eating right, staying active, and not smoking” (American Cancer Society. Cancer Risk and Prevention. https://www.cancer.org/cancer/risk-prevention.html). Predictability/Unpredictability in the Art: It is noted that the vaccine art is unpredictable, requiring each embodiment to be individually assessed for physiological activity in preventing diseases. In re Fisher, 427 F.2d 833, 166 USPQ 18 (CCPA 1970) indicates that the more unpredictable an area is, the more specific enablement is necessary in order to satisfy the statute. In the instant case, the instant claimed invention is highly unpredictable since one skilled in the art would recognize that the recitation encompasses the prevention of prostate cancer and treating subjects that could be at risk of developing and those subjects suspected of having prostate cancer. Thus, the skilled artisan would view that the prevention of prostate cancer encompassed by the claims, (by administering to the subject a treatment regimen comprising: two or more vaccines comprising a GAd20 virus that comprises a nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 1 and one or more vaccines comprising a Modified Vaccinia Ankara (MVA) virus that comprises a nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 3. And this administration may further comprise administering a PD-1 antibody or a CTLA-4 antibody), is highly unpredictable. Guidance of the Specification/Working Examples: Applicant has only provided working examples suggesting that the vaccines and antibodies may treat prostate cancer cells. Thus, the specification fails to provide sufficient evidence in support of prevention of those suspected of having or at risk of developing any type of prostate cancer and recited in the instant claims. Additionally, the examples provided do not demonstrate the prevention of any type of prostate cancer. Additionally, the disclosure does not discuss, or demonstrate through working examples, a method that could be used to determine that recurrence of diseases/disorders was prevented using the claimed agents as there is no disclosed method to determine that recurrence of prostate cancer would have predictably occurred without treatment. The Quantitation of Experimentation Required: In order to practice Applicants invention, it would be necessary for one to design and conduct an exhaustive amount of complex experiments to demonstrate that the claimed compounds could be administered to a subject at risk of developing prostate cancer. The population of subjects could include any subject, and thus the quantitation of experimentation is unreasonably large. Therefore, in order to practice the claimed invention, the amount of experimentation required would be considered undue and burdensome. In conclusion, Genentech, 108 F.3d at 1366, states that “a patent is not a hunting license. It is not a reward for search, but compensation for its successful conclusion” and “[p]atent protection is granted in return for an enabling disclosure of an invention, not for vague intimations of general ideas that may or may not be workable”. The prevention of prostate cancer is not enabled by the instant specification. Claim Rejections - 35 USC § 103 In the event the determination of the status of the application as subject to AIA 35 U.S.C. 102 and 103 (or as subject to pre-AIA 35 U.S.C. 102 and 103) is incorrect, any correction of the statutory basis (i.e., changing from AIA to pre-AIA ) for the rejection will not be considered a new ground of rejection if the prior art relied upon, and the rationale supporting the rejection, would be the same under either status. The following is a quotation of 35 U.S.C. 103 which forms the basis for all obviousness rejections set forth in this Office action: A patent for a claimed invention may not be obtained, notwithstanding that the claimed invention is not identically disclosed as set forth in section 102, if the differences between the claimed invention and the prior art are such that the claimed invention as a whole would have been obvious before the effective filing date of the claimed invention to a person having ordinary skill in the art to which the claimed invention pertains. Patentability shall not be negated by the manner in which the invention was made. This application currently names joint inventors. In considering patentability of the claims the examiner presumes that the subject matter of the various claims was commonly owned as of the effective filing date of the claimed invention(s) absent any evidence to the contrary. Applicant is advised of the obligation under 37 CFR 1.56 to point out the inventor and effective filing dates of each claim that was not commonly owned as of the effective filing date of the later invention in order for the examiner to consider the applicability of 35 U.S.C. 102(b)(2)(C) for any potential 35 U.S.C. 102(a)(2) prior art against the later invention. Claims 1-21 are rejected under 35 U.S.C. 103 as being unpatentable over Bachman (US20230024133A1 published July 16, 2020; issued patent No. US 11,793,843 B2) in view of Tang (Drug Discovery Today d Volume 26, Number 8 d August 2021) Bachman teaches methods of treating and preventing prostate cancer in a subject ({4553], claims, 51, 70 and 71) comprising administering a) a first vaccine derived from GAd20 comprising a polynucleotide encoding a polypeptide of SEQ ID NOs: 541, and b) a second vaccine derived from MVA comprising a polynucleotide encoding a polypeptide of SEQ ID NOs: 543 (Bachman’s claim 51, 70 and 71) as required by instant claims 1, 3, 15 and 20-21. SEQ ID NO: 541 is 100% identical to SEQ ID NO: 1 and SEQ ID NO: 543 is 100% identical to SEQ ID NO: 3. Please see below for sequence alignments between the instant application and Bachman. SEQ ID NO: 1 AND 541 Title: US-18-080-634-1 Sequence: 1 QNLQNGGGSRSSATLPGRRR..........QLTRIAPPRSHCCFWEVNAP 1479 RESULT 1 US-16-737-950-541 (NOTE: this sequence has 5 duplicates in the database searched) Sequence 541, US/16737950 Publication No. US20200222478A1 GENERAL INFORMATION APPLICANT: Janssen Biotech, Inc. TITLE OF INVENTION: Prostate Neoantigens and their uses FILE REFERENCE: JBI6160USNP1 CURRENT APPLICATION NUMBER: US/16/737,950 CURRENT FILING DATE: 2020-01-09 PRIOR APPLICATION NUMBER: 62/913,969 PRIOR FILING DATE: 2019-10-11 PRIOR APPLICATION NUMBER: 62/883,786 PRIOR FILING DATE: 2019-08-07 PRIOR APPLICATION NUMBER: 62/851,273 PRIOR FILING DATE: 2019-05-22 PRIOR APPLICATION NUMBER: 62/790,673 PRIOR FILING DATE: 2019-01-10 NUMBER OF SEQ ID NOS: 980 SEQ ID NO 541 LENGTH: 1479 TYPE: PRT ORGANISM: Artificial sequence FEATURE: OTHER INFORMATION: Heterologous protein Query Match 100.0%; Score 8084; Length 1479; Best Local Similarity 100.0%; Matches 1479; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 QNLQNGGGSRSSATLPGRRRRRWLRRRRQPISVAPAGPPRRPNQKPNPPGGARCVIMRPT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 QNLQNGGGSRSSATLPGRRRRRWLRRRRQPISVAPAGPPRRPNQKPNPPGGARCVIMRPT Qy 61 WPGTSAFTKRSFAVTERIIDYWAQKEKGSSSFLRPSCDYWAQKEKISIPRTHLCLVLGVL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 WPGTSAFTKRSFAVTERIIDYWAQKEKGSSSFLRPSCDYWAQKEKISIPRTHLCLVLGVL Qy 121 SGHSGSRLYEAGMTLGGKILFFLFLLLPLSPFSLIFTEISCCTLSSEENEYLPRPEWQLQ |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 SGHSGSRLYEAGMTLGGKILFFLFLLLPLSPFSLIFTEISCCTLSSEENEYLPRPEWQLQ Qy 181 VPFRELKNVSVLEGLRQGRLGGPCSCHCPRPSQARLTPVDVAGPFLCLGDPGLFPPVKSS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 VPFRELKNVSVLEGLRQGRLGGPCSCHCPRPSQARLTPVDVAGPFLCLGDPGLFPPVKSS Qy 241 ITGGKSTCSAPGPQSLPSTPFSTYPQWVILITELGMECTLGQVGAPSPRREEDGWRGGHS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 ITGGKSTCSAPGPQSLPSTPFSTYPQWVILITELGMECTLGQVGAPSPRREEDGWRGGHS Qy 301 RFKADVPAPQGPCWGGQPGSAPSSAPPEQSLLDWKFEMSYTVGGPPPHVHARPRHWKTDR |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 RFKADVPAPQGPCWGGQPGSAPSSAPPEQSLLDWKFEMSYTVGGPPPHVHARPRHWKTDR Qy 361 DGHSYTSKVNCLLLQDGFHGCVSITGAAGRRNLSIFLFLMLCKLEFHACKIQNKNCPDFK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 DGHSYTSKVNCLLLQDGFHGCVSITGAAGRRNLSIFLFLMLCKLEFHACKIQNKNCPDFK Qy 421 KFDGPCGERGGGRTARALWARGDSVLTPALDPQTPVRAPSLTRAAAAVHYKLIQQPISLF |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 421 KFDGPCGERGGGRTARALWARGDSVLTPALDPQTPVRAPSLTRAAAAVHYKLIQQPISLF Qy 481 SITDRLHKTFSQLPSVHLCSITFQWGHPPIFCSTNDICVTANFCISVTFLKPCFLLHEAS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 481 SITDRLHKTFSQLPSVHLCSITFQWGHPPIFCSTNDICVTANFCISVTFLKPCFLLHEAS Qy 541 ASQCHLFLQPQVGTPPPHTASARAPSGPPHPHESCPAGRRPARAAQTCARRQHGLPGCEE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 541 ASQCHLFLQPQVGTPPPHTASARAPSGPPHPHESCPAGRRPARAAQTCARRQHGLPGCEE Qy 601 AGTARVPSLHLHLHQAALGAGRGRGWGEACAQVPPSRGVLRFLDLKVRYLHSQWQHYHRS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 601 AGTARVPSLHLHLHQAALGAGRGRGWGEACAQVPPSRGVLRFLDLKVRYLHSQWQHYHRS Qy 661 GEAAGTPLWRPTRNVPFRELKNQRTAQGAPGIHHAASPVAANLCDPARHAQHTRIPCGAG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 661 GEAAGTPLWRPTRNVPFRELKNQRTAQGAPGIHHAASPVAANLCDPARHAQHTRIPCGAG Qy 721 QVRAGRGPEAGGGVLQPQRPAPEKPGCPCRRGQPRLHTVKMWRAVAMMVPDRQVHYDFGL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 721 QVRAGRGPEAGGGVLQPQRPAPEKPGCPCRRGQPRLHTVKMWRAVAMMVPDRQVHYDFGL Qy 781 GVPGDSTRRAVRRMNTFYEAGMTLGEKFRVGNCKHLKMTRPNSKMALNSEALSVVSECGA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 781 GVPGDSTRRAVRRMNTFYEAGMTLGEKFRVGNCKHLKMTRPNSKMALNSEALSVVSECGA Qy 841 SACDVSLIAMDSAFVQGKDWGVKKFIRRDFYAYKDFLWCFPFSLVFLQEIQICCHVSCLC |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 841 SACDVSLIAMDSAFVQGKDWGVKKFIRRDFYAYKDFLWCFPFSLVFLQEIQICCHVSCLC Qy 901 CICCSTRICLGCLLELFLSRALRALHVLWNGFQLHCQTEYNQKLQVNQFSESKSLYHREK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 901 CICCSTRICLGCLLELFLSRALRALHVLWNGFQLHCQTEYNQKLQVNQFSESKSLYHREK Qy 961 QLIAMDSAICEERGAAGSLISCETMPAILKLQKNCLLSLRTALTHNQDFSIYRLCCKRGS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 961 QLIAMDSAICEERGAAGSLISCETMPAILKLQKNCLLSLRTALTHNQDFSIYRLCCKRGS Qy 1021 LCHASQARSPAFPKPVRPLPAPITRITPQLGGQSDSSQPLLTTGRPQGWQDQALRHTQQA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1021 LCHASQARSPAFPKPVRPLPAPITRITPQLGGQSDSSQPLLTTGRPQGWQDQALRHTQQA Qy 1081 SPASCATITIPIHSAALGDHSGDPGPAWDTCPPLPLTTLIPRAPPPYGDSTARSWPSRCG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1081 SPASCATITIPIHSAALGDHSGDPGPAWDTCPPLPLTTLIPRAPPPYGDSTARSWPSRCG Qy 1141 PLGGNTTLQQLGEASQAPSGSLIPLRLPLLWEVRGQPDSFAALHSSLNELGEIARELHQF |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1141 PLGGNTTLQQLGEASQAPSGSLIPLRLPLLWEVRGQPDSFAALHSSLNELGEIARELHQF Qy 1201 AFDLLIKSHFVQGKDWGLKKFIRRDFWGMELAASRRFSWDHHSAGGPPRVPSVRSGAAQV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1201 AFDLLIKSHFVQGKDWGLKKFIRRDFWGMELAASRRFSWDHHSAGGPPRVPSVRSGAAQV Qy 1261 QPKDPLPLRTLAGCLARTAHLRPGAESLPQPQLHCTLWFQSSELSPTGAPWPSRRPTWRG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1261 QPKDPLPLRTLAGCLARTAHLRPGAESLPQPQLHCTLWFQSSELSPTGAPWPSRRPTWRG Qy 1321 TTVSPRTATSSARTCCGTKWPSSQEAALGLGSGLLRFSCGTAAIRKMHFSLKEHPPPPCP |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1321 TTVSPRTATSSARTCCGTKWPSSQEAALGLGSGLLRFSCGTAAIRKMHFSLKEHPPPPCP Qy 1381 PEAFQRAAGEGGPGRGGARRGARVLQSPFCRAGAGEWLGHQSLRHVVGYGHLDTSGSSSS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1381 PEAFQRAAGEGGPGRGGARRGARVLQSPFCRAGAGEWLGHQSLRHVVGYGHLDTSGSSSS Qy 1441 SSWPNSKMALNSLNSIDDAQLTRIAPPRSHCCFWEVNAP 1479 ||||||||||||||||||||||||||||||||||||||| Db 1441 SSWPNSKMALNSLNSIDDAQLTRIAPPRSHCCFWEVNAP 1479 SEQ ID NO: 3 AND 543 Title: US-18-080-634-3 Sequence: 1 QNLQNGGGSRSSATLPGRRR..........AALGLGSGLLRFSCGTAAIR 1479 RESULT 2 US-16-737-950-543 Sequence 543, US/16737950 Publication No. US20200222478A1 GENERAL INFORMATION APPLICANT: Janssen Biotech, Inc. TITLE OF INVENTION: Prostate Neoantigens and their uses FILE REFERENCE: JBI6160USNP1 CURRENT APPLICATION NUMBER: US/16/737,950 CURRENT FILING DATE: 2020-01-09 PRIOR APPLICATION NUMBER: 62/913,969 PRIOR FILING DATE: 2019-10-11 PRIOR APPLICATION NUMBER: 62/883,786 PRIOR FILING DATE: 2019-08-07 PRIOR APPLICATION NUMBER: 62/851,273 PRIOR FILING DATE: 2019-05-22 PRIOR APPLICATION NUMBER: 62/790,673 PRIOR FILING DATE: 2019-01-10 NUMBER OF SEQ ID NOS: 980 SEQ ID NO 543 LENGTH: 1480 TYPE: PRT ORGANISM: Artificial sequence FEATURE: OTHER INFORMATION: Heterologous protein Query Match 100.0%; Score 8084; Length 1480; Best Local Similarity 100.0%; Matches 1479; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 QNLQNGGGSRSSATLPGRRRRRWLRRRRQPISVAPAGPPRRPNQKPNPPGGARCVIMRPT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 QNLQNGGGSRSSATLPGRRRRRWLRRRRQPISVAPAGPPRRPNQKPNPPGGARCVIMRPT Qy 61 WPGTSAFTGMECTLGQVGAPSPRREEDGWRGGHSRFKADVPAPQGPCWGGQPGSAPSSAP |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 WPGTSAFTGMECTLGQVGAPSPRREEDGWRGGHSRFKADVPAPQGPCWGGQPGSAPSSAP Qy 121 PEQSLLDDYWAQKEKISIPRTHLCWKFEMSYTVGGPPPHVHARPRHWKTDRDYWAQKEKG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 PEQSLLDDYWAQKEKISIPRTHLCWKFEMSYTVGGPPPHVHARPRHWKTDRDYWAQKEKG Qy 181 SSSFLRPSCVPFRELKNVSVLEGLRQGRLGGPCSCHCPRPSQARLTPVDVAGPFLCLGDP |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 SSSFLRPSCVPFRELKNVSVLEGLRQGRLGGPCSCHCPRPSQARLTPVDVAGPFLCLGDP Qy 241 GLFPPVKSSITEISCCTLSSEENEYLPRPEWQLQYEAGMTLGGKILFFLFLLLPLSPFSL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 GLFPPVKSSITEISCCTLSSEENEYLPRPEWQLQYEAGMTLGGKILFFLFLLLPLSPFSL Qy 301 IFLVLGVLSGHSGSRLKRSFAVTERIITGGKSTCSAPGPQSLPSTPFSTYPQWVILITEL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 IFLVLGVLSGHSGSRLKRSFAVTERIITGGKSTCSAPGPQSLPSTPFSTYPQWVILITEL Qy 361 DGHSYTSKVNCLLLQDGFHGCVSITGAAGRRNLSIFLFLMLCKLEFHACQWQHYHRSGEA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 DGHSYTSKVNCLLLQDGFHGCVSITGAAGRRNLSIFLFLMLCKLEFHACQWQHYHRSGEA Qy 421 AGTPLWRPTRNVAMMVPDRQVHYDFGLKIQNKNCPDVLRFLDLKVRYLHSVPFRELKNQR |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 421 AGTPLWRPTRNVAMMVPDRQVHYDFGLKIQNKNCPDVLRFLDLKVRYLHSVPFRELKNQR Qy 481 TAQGAPGIHHAASPVAANLCDPARHAQHTRIPCGAGQVRAGRGPEAGGGVLQPQRPAPEK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 481 TAQGAPGIHHAASPVAANLCDPARHAQHTRIPCGAGQVRAGRGPEAGGGVLQPQRPAPEK Qy 541 PGCPCRRGQPRLHTVKMWRACHLFLQPQVGTPPPHTASARAPSGPPHPHESCPAGRRPAR |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 541 PGCPCRRGQPRLHTVKMWRACHLFLQPQVGTPPPHTASARAPSGPPHPHESCPAGRRPAR Qy 601 AAQTCARRQHGLPGCEEAGTARVPSLHLHLHQAALGAGRGRGWGEACAQVPPSRGHYKLI |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 601 AAQTCARRQHGLPGCEEAGTARVPSLHLHLHQAALGAGRGRGWGEACAQVPPSRGHYKLI Qy 661 QQPISLFSITDRLHKTFSQLPSVHLCSITFQWGHPPIFCSTNDICVTANFCISVTFLKPC |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 661 QQPISLFSITDRLHKTFSQLPSVHLCSITFQWGHPPIFCSTNDICVTANFCISVTFLKPC Qy 721 FLLHEASASQFKKFDGPCGERGGGRTARALWARGDSVLTPALDPQTPVRAPSLTRAAAAV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 721 FLLHEASASQFKKFDGPCGERGGGRTARALWARGDSVLTPALDPQTPVRAPSLTRAAAAV Qy 781 GVPGDSTRRAVRRMNTFCGASACDVSLIAMDSACEERGAAGSLISCESLYHREKQLIAMD |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 781 GVPGDSTRRAVRRMNTFCGASACDVSLIAMDSACEERGAAGSLISCESLYHREKQLIAMD Qy 841 SAIFVQGKDWGVKKFIRRDFTMPAILKLQKNCLLSLNSKMALNSEALSVVSEYEAGMTLG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 841 SAIFVQGKDWGVKKFIRRDFTMPAILKLQKNCLLSLNSKMALNSEALSVVSEYEAGMTLG Qy 901 EKFRVGNCKHLKMTRPTEYNQKLQVNQFSESKRTALTHNQDFSIYRLCCKRGSLCHASQA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 901 EKFRVGNCKHLKMTRPTEYNQKLQVNQFSESKRTALTHNQDFSIYRLCCKRGSLCHASQA Qy 961 RSPAFPKPVRPLPAPITRITPQLGGQSDSSQPLLTTGRPQGWQDQALRHTQQASPASCAT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 961 RSPAFPKPVRPLPAPITRITPQLGGQSDSSQPLLTTGRPQGWQDQALRHTQQASPASCAT Qy 1021 ITIPIHSAALGDHSGDPGPAWDTCPPLPLTTLIPRAPPPYGDSTARSWPSRCGPLGYAYK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1021 ITIPIHSAALGDHSGDPGPAWDTCPPLPLTTLIPRAPPPYGDSTARSWPSRCGPLGYAYK Qy 1081 DFLWCFPFSLVFLQEIQICCHVSCLCCICCSTRICLGCLLELFLSRALRALHVLWNGFQL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1081 DFLWCFPFSLVFLQEIQICCHVSCLCCICCSTRICLGCLLELFLSRALRALHVLWNGFQL Qy 1141 HCQGNTTLQQLGEASQAPSGSLIPLRLPLLWEVRGNSKMALNSLNSIDDAQLTRIAPPRS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1141 HCQGNTTLQQLGEASQAPSGSLIPLRLPLLWEVRGNSKMALNSLNSIDDAQLTRIAPPRS Qy 1201 HCCFWEVNAPFVQGKDWGLKKFIRRDFEAFQRAAGEGGPGRGGARRGARVLQSPFCRAGA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1201 HCCFWEVNAPFVQGKDWGLKKFIRRDFEAFQRAAGEGGPGRGGARRGARVLQSPFCRAGA Qy 1261 GEWLGHQSLRWGMELAASRRFSWDHHSAGGPPRVPSVRSGAAQVQPKDPLPLRTLAGCLA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1261 GEWLGHQSLRWGMELAASRRFSWDHHSAGGPPRVPSVRSGAAQVQPKDPLPLRTLAGCLA Qy 1321 RTAHLRPGAESLPQPQLHCTIARELHQFAFDLLIKSHKMHFSLKEHPPPPCPPHVVGYGH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1321 RTAHLRPGAESLPQPQLHCTIARELHQFAFDLLIKSHKMHFSLKEHPPPPCPPHVVGYGH Qy 1381 LDTSGSSSSSSWPQPDSFAALHSSLNELGELWFQSSELSPTGAPWPSRRPTWRGTTVSPR |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1381 LDTSGSSSSSSWPQPDSFAALHSSLNELGELWFQSSELSPTGAPWPSRRPTWRGTTVSPR Qy 1441 TATSSARTCCGTKWPSSQEAALGLGSGLLRFSCGTAAIR 1479 ||||||||||||||||||||||||||||||||||||||| Db 1441 TATSSARTCCGTKWPSSQEAALGLGSGLLRFSCGTAAIR 1479 Bachman also teaches that each vaccine can be administered one or more times to the subject (claims 76 and 77) which encompasses the required two or more times of instant claim 2. The GAd20 vaccine may be administered in an amount of about 1x109 to about 1x1012 viral particles (vp) to a human subject during one administration [46072] and this range is similar to the required range of GAd20 VP as required in instant claim 4 and includes the dose of 1x1011 of instant claims 15 and 20-21. The MVA vaccine comprises about 1xl07 to 1x109 TCID50 (50% Tissue Culture Infective Dose) or IFU [4603] similar to the required range for MVA IFU required by instant claim 5 and includes the dose of 1x108 of instant claims 15 and 20-21. Bachman also teaches the administration of an additional cancer therapeutic agent being a CTLA-4 antibody and a PD-1 axis inhibitor, PD-1 antagonist that can be an antibody (claims 35, 36 72, 74, 76 and [4743]) as required by instant claims 6, 8, 16-17 and 20-21. Bachman also discloses the nucleotide sequences found in GAd20, SEQ ID NO: 542, which is 100% identical to the SEQ ID NO: 2 of instant claims 10 and 18 and the nucleotide sequence found in MVA, SEQ ID NO: 544 which is 100% identical to SEQ ID NO: 4 of instant claim 12 and 19 (see sequence alignments below). In addition, the polynucleotides can encode a T cell enhancer (TCE) and a histidine tag for the GAd20 vaccine ([4764] [4769]) (instant claim 11) and for the MVA vaccine ([4779] [4784]) (instant claim 13). SEQ ID NO: 2 AND 542 Title: US-18-080-634-2 Sequence: 1 cagaacctgcagaacggcgg..........tttgggaagtgaacgcccca 4437 RESULT 1 US-16-737-950-542 (NOTE: this sequence has 5 duplicates in the database searched) Sequence 542, US/16737950 Publication No. US20200222478A1 GENERAL INFORMATION APPLICANT: Janssen Biotech, Inc. APPLICANT: Bachman, Kurtis APPLICANT: Bhargava, Vipul APPLICANT: Davis, Darryl APPLICANT: Krishna, Vinod APPLICANT: Leoni, Guido APPLICANT: Pocalyko, David APPLICANT: Safabakhsh, Pegah APPLICANT: Sepulveda, Manuel APPLICANT: Siegel, Derick TITLE OF INVENTION: Prostate Neoantigens and their uses FILE REFERENCE: JBI6160USNP1 CURRENT APPLICATION NUMBER: US/16/737,950 CURRENT FILING DATE: 2020-01-09 PRIOR APPLICATION NUMBER: 62/913,969 PRIOR FILING DATE: 2019-10-11 PRIOR APPLICATION NUMBER: 62/883,786 PRIOR FILING DATE: 2019-08-07 PRIOR APPLICATION NUMBER: 62/851,273 PRIOR FILING DATE: 2019-05-22 PRIOR APPLICATION NUMBER: 62/790,673 PRIOR FILING DATE: 2019-01-10 NUMBER OF SEQ ID NOS: 980 SEQ ID NO 542 LENGTH: 4437 TYPE: DNA ORGANISM: Artificial sequence FEATURE: OTHER INFORMATION: Heterologous polynucleotide Query Match 100.0%; Score 4437; Length 4437; Best Local Similarity 100.0%; Matches 4437; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 CAGAACCTGCAGAACGGCGGAGGCTCTAGAAGCTCTGCTACACTTCCTGGCAGGCGGCGG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 CAGAACCTGCAGAACGGCGGAGGCTCTAGAAGCTCTGCTACACTTCCTGGCAGGCGGCGG Qy 61 AGAAGATGGCTGAGAAGAAGGCGGCAGCCTATCTCTGTGGCTCCTGCTGGACCTCCTAGA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 AGAAGATGGCTGAGAAGAAGGCGGCAGCCTATCTCTGTGGCTCCTGCTGGACCTCCTAGA Qy 121 CGGCCCAACCAGAAGCCTAATCCTCCTGGCGGAGCCAGATGCGTGATCATGAGGCCTACA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 CGGCCCAACCAGAAGCCTAATCCTCCTGGCGGAGCCAGATGCGTGATCATGAGGCCTACA Qy 181 TGGCCTGGCACCAGCGCCTTCACCAAGAGAAGCTTTGCCGTGACCGAGCGGATCATCGAC |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 TGGCCTGGCACCAGCGCCTTCACCAAGAGAAGCTTTGCCGTGACCGAGCGGATCATCGAC Qy 241 TATTGGGCTCAAAAAGAGAAGGGCAGCAGCAGCTTCCTGCGGCCTAGCTGTGATTATTGG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 TATTGGGCTCAAAAAGAGAAGGGCAGCAGCAGCTTCCTGCGGCCTAGCTGTGATTATTGG Qy 301 GCCCAGAAAGAAAAGATCAGCATCCCCAGAACACACCTGTGCCTGGTGCTGGGAGTGCTG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 GCCCAGAAAGAAAAGATCAGCATCCCCAGAACACACCTGTGCCTGGTGCTGGGAGTGCTG Qy 361 TCTGGACACTCTGGCAGCAGACTGTATGAGGCCGGCATGACACTCGGCGGCAAGATCCTG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 TCTGGACACTCTGGCAGCAGACTGTATGAGGCCGGCATGACACTCGGCGGCAAGATCCTG Qy 421 TTCTTCCTGTTCCTGCTGCTCCCTCTGAGCCCCTTCAGCCTGATCTTCACCGAGATCAGC |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 421 TTCTTCCTGTTCCTGCTGCTCCCTCTGAGCCCCTTCAGCCTGATCTTCACCGAGATCAGC Qy 481 TGCTGCACCCTGAGCAGCGAGGAAAACGAGTACCTGCCTAGACCTGAGTGGCAGCTGCAG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 481 TGCTGCACCCTGAGCAGCGAGGAAAACGAGTACCTGCCTAGACCTGAGTGGCAGCTGCAG Qy 541 GTCCCCTTCAGAGAGCTGAAGAACGTTTCCGTGCTGGAAGGCCTGAGACAGGGCAGACTT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 541 GTCCCCTTCAGAGAGCTGAAGAACGTTTCCGTGCTGGAAGGCCTGAGACAGGGCAGACTT Qy 601 GGCGGCCCTTGTAGCTGTCACTGCCCCAGACCTAGTCAGGCCAGACTGACACCTGTGGAT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 601 GGCGGCCCTTGTAGCTGTCACTGCCCCAGACCTAGTCAGGCCAGACTGACACCTGTGGAT Qy 661 GTGGCCGGACCTTTCCTGTGTCTGGGAGATCCTGGCCTGTTTCCACCTGTGAAGTCCAGC |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 661 GTGGCCGGACCTTTCCTGTGTCTGGGAGATCCTGGCCTGTTTCCACCTGTGAAGTCCAGC Qy 721 ATCACAGGCGGCAAGTCCACATGTTCTGCCCCTGGACCTCAGAGCCTGCCTAGCACACCC |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 721 ATCACAGGCGGCAAGTCCACATGTTCTGCCCCTGGACCTCAGAGCCTGCCTAGCACACCC Qy 781 TTCAGCACATACCCTCAGTGGGTCATCCTGATCACCGAACTCGGCATGGAATGCACCCTG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 781 TTCAGCACATACCCTCAGTGGGTCATCCTGATCACCGAACTCGGCATGGAATGCACCCTG Qy 841 GGACAAGTGGGAGCCCCATCTCCTAGAAGAGAAGAGGATGGCTGGCGCGGAGGCCACTCT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 841 GGACAAGTGGGAGCCCCATCTCCTAGAAGAGAAGAGGATGGCTGGCGCGGAGGCCACTCT Qy 901 AGATTCAAAGCTGATGTGCCCGCTCCTCAGGGCCCTTGTTGGGGAGGACAACCTGGATCT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 901 AGATTCAAAGCTGATGTGCCCGCTCCTCAGGGCCCTTGTTGGGGAGGACAACCTGGATCT Qy 961 GCCCCATCTTCTGCCCCACCTGAACAGTCCCTGCTGGATTGGAAGTTCGAGATGAGCTAC |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 961 GCCCCATCTTCTGCCCCACCTGAACAGTCCCTGCTGGATTGGAAGTTCGAGATGAGCTAC Qy 1021 ACCGTCGGCGGACCTCCACCTCATGTTCATGCCAGACCTCGGCACTGGAAAACCGACAGA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1021 ACCGTCGGCGGACCTCCACCTCATGTTCATGCCAGACCTCGGCACTGGAAAACCGACAGA Qy 1081 GATGGCCACAGCTACACCAGCAAAGTGAACTGCCTCCTGCTGCAGGATGGCTTCCACGGC |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1081 GATGGCCACAGCTACACCAGCAAAGTGAACTGCCTCCTGCTGCAGGATGGCTTCCACGGC Qy 1141 TGTGTGTCTATTACTGGCGCCGCTGGCAGACGGAACCTGAGCATCTTTCTGTTTCTGATG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1141 TGTGTGTCTATTACTGGCGCCGCTGGCAGACGGAACCTGAGCATCTTTCTGTTTCTGATG Qy 1201 CTGTGCAAGCTCGAGTTCCACGCCTGCAAGATCCAGAACAAGAACTGCCCCGACTTCAAG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1201 CTGTGCAAGCTCGAGTTCCACGCCTGCAAGATCCAGAACAAGAACTGCCCCGACTTCAAG Qy 1261 AAGTTCGACGGCCCTTGCGGAGAAAGAGGCGGAGGCAGAACAGCTAGAGCCCTTTGGGCT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1261 AAGTTCGACGGCCCTTGCGGAGAAAGAGGCGGAGGCAGAACAGCTAGAGCCCTTTGGGCT Qy 1321 AGAGGCGACAGCGTTCTGACACCAGCTCTGGACCCTCAGACACCTGTTAGGGCCCCTAGC |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1321 AGAGGCGACAGCGTTCTGACACCAGCTCTGGACCCTCAGACACCTGTTAGGGCCCCTAGC Qy 1381 CTGACAAGAGCTGCCGCCGCTGTGCACTACAAGCTGATCCAGCAGCCAATCAGCCTGTTC |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1381 CTGACAAGAGCTGCCGCCGCTGTGCACTACAAGCTGATCCAGCAGCCAATCAGCCTGTTC Qy 1441 AGCATCACCGACCGGCTGCACAAGACATTCAGCCAGCTGCCAAGCGTGCACCTGTGCTCC |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1441 AGCATCACCGACCGGCTGCACAAGACATTCAGCCAGCTGCCAAGCGTGCACCTGTGCTCC Qy 1501 ATCACCTTCCAGTGGGGACACCCTCCTATCTTTTGCTCCACCAACGACATCTGCGTGACC |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1501 ATCACCTTCCAGTGGGGACACCCTCCTATCTTTTGCTCCACCAACGACATCTGCGTGACC Qy 1561 GCCAACTTCTGTATCAGCGTGACCTTCCTGAAGCCTTGCTTTCTGCTGCACGAGGCCAGC |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1561 GCCAACTTCTGTATCAGCGTGACCTTCCTGAAGCCTTGCTTTCTGCTGCACGAGGCCAGC Qy 1621 GCCTCTCAGTGCCACTTGTTTCTGCAGCCCCAAGTGGGCACACCTCCTCCACATACAGCC |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1621 GCCTCTCAGTGCCACTTGTTTCTGCAGCCCCAAGTGGGCACACCTCCTCCACATACAGCC Qy 1681 TCTGCTAGAGCACCTAGCGGCCCTCCACATCCTCACGAATCTTGTCCTGCCGGAAGAAGG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1681 TCTGCTAGAGCACCTAGCGGCCCTCCACATCCTCACGAATCTTGTCCTGCCGGAAGAAGG Qy 1741 CCTGCCAGAGCCGCTCAAACATGTGCCAGACGACAGCACGGACTGCCTGGATGTGAAGAG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1741 CCTGCCAGAGCCGCTCAAACATGTGCCAGACGACAGCACGGACTGCCTGGATGTGAAGAG Qy 1801 GCTGGAACAGCCAGAGTGCCTAGCCTGCACCTCCATCTGCATCAGGCTGCTCTTGGAGCC |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1801 GCTGGAACAGCCAGAGTGCCTAGCCTGCACCTCCATCTGCATCAGGCTGCTCTTGGAGCC Qy 1861 GGAAGAGGTAGAGGATGGGGCGAAGCTTGTGCTCAGGTGCCACCTTCTAGAGGCGTGCTG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1861 GGAAGAGGTAGAGGATGGGGCGAAGCTTGTGCTCAGGTGCCACCTTCTAGAGGCGTGCTG Qy 1921 AGATTCCTGGACCTGAAAGTGCGCTACCTGCACAGCCAGTGGCAGCACTATCACAGATCT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1921 AGATTCCTGGACCTGAAAGTGCGCTACCTGCACAGCCAGTGGCAGCACTATCACAGATCT Qy 1981 GGCGAAGCCGCCGGAACACCCCTTTGGAGGCCAACAAGAAACGTGCCCTTCCGGGAACTG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1981 GGCGAAGCCGCCGGAACACCCCTTTGGAGGCCAACAAGAAACGTGCCCTTCCGGGAACTG Qy 2041 AAGAACCAGAGAACAGCTCAGGGCGCTCCTGGAATCCACCATGCTGCTTCTCCAGTGGCC |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 2041 AAGAACCAGAGAACAGCTCAGGGCGCTCCTGGAATCCACCATGCTGCTTCTCCAGTGGCC Qy 2101 GCCAACCTGTGTGATCCTGCCAGACATGCCCAGCACACCAGGATTCCTTGTGGCGCTGGA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 2101 GCCAACCTGTGTGATCCTGCCAGACATGCCCAGCACACCAGGATTCCTTGTGGCGCTGGA Qy 2161 CAAGTGCGCGCTGGAAGAGGACCTGAAGCAGGCGGAGGTGTTCTGCAACCTCAAAGACCC |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 2161 CAAGTGCGCGCTGGAAGAGGACCTGAAGCAGGCGGAGGTGTTCTGCAACCTCAAAGACCC Qy 2221 GCTCCTGAGAAGCCTGGCTGCCCTTGCAGAAGAGGACAGCCTAGACTGCACACCGTGAAA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 2221 GCTCCTGAGAAGCCTGGCTGCCCTTGCAGAAGAGGACAGCCTAGACTGCACACCGTGAAA Qy 2281 ATGTGGCGAGCCGTGGCCATGATGGTGCCCGATAGACAGGTCCACTACGACTTTGGACTG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 2281 ATGTGGCGAGCCGTGGCCATGATGGTGCCCGATAGACAGGTCCACTACGACTTTGGACTG Qy 2341 GGCGTGCCAGGCGATAGCACTCGGAGAGCCGTCAGACGGATGAACACCTTTTACGAAGCC |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 2341 GGCGTGCCAGGCGATAGCACTCGGAGAGCCGTCAGACGGATGAACACCTTTTACGAAGCC Qy 2401 GGGATGACCCTGGGCGAGAAGTTCAGAGTGGGCAACTGCAAGCACCTGAAGATGACCCGG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 2401 GGGATGACCCTGGGCGAGAAGTTCAGAGTGGGCAACTGCAAGCACCTGAAGATGACCCGG Qy 2461 CCTAACAGCAAGATGGCCCTGAATAGCGAGGCCCTGTCTGTGGTGTCTGAATGTGGCGCC |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 2461 CCTAACAGCAAGATGGCCCTGAATAGCGAGGCCCTGTCTGTGGTGTCTGAATGTGGCGCC Qy 2521 TCTGCCTGTGACGTGTCCCTGATCGCTATGGACTCCGCCTTTGTGCAGGGCAAAGACTGG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 2521 TCTGCCTGTGACGTGTCCCTGATCGCTATGGACTCCGCCTTTGTGCAGGGCAAAGACTGG Qy 2581 GGCGTGAAGAAGTTCATCCGGCGGGACTTCTACGCCTACAAGGACTTCCTGTGGTGCTTC |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 2581 GGCGTGAAGAAGTTCATCCGGCGGGACTTCTACGCCTACAAGGACTTCCTGTGGTGCTTC Qy 2641 CCCTTCTCTCTGGTGTTCCTGCAAGAGATCCAGATCTGCTGTCATGTGTCCTGCCTGTGC |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 2641 CCCTTCTCTCTGGTGTTCCTGCAAGAGATCCAGATCTGCTGTCATGTGTCCTGCCTGTGC Qy 2701 TGCATCTGCTGTAGCACCAGAATCTGCCTGGGCTGTCTGCTGGAACTGTTCCTGAGCAGA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 2701 TGCATCTGCTGTAGCACCAGAATCTGCCTGGGCTGTCTGCTGGAACTGTTCCTGAGCAGA Qy 2761 GCCCTGAGAGCACTGCACGTGCTGTGGAACGGATTCCAGCTGCACTGCCAGACCGAGTAC |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 2761 GCCCTGAGAGCACTGCACGTGCTGTGGAACGGATTCCAGCTGCACTGCCAGACCGAGTAC Qy 2821 AACCAGAAACTGCAAGTGAACCAGTTCAGCGAGAGCAAGAGCCTGTACCACCGGGAAAAG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 2821 AACCAGAAACTGCAAGTGAACCAGTTCAGCGAGAGCAAGAGCCTGTACCACCGGGAAAAG Qy 2881 CAGCTCATTGCCATGGACAGCGCCATCTGCGAAGAGAGAGGCGCCGCAGGATCTCTGATC |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 2881 CAGCTCATTGCCATGGACAGCGCCATCTGCGAAGAGAGAGGCGCCGCAGGATCTCTGATC Qy 2941 TCCTGCGAAACAATGCCCGCCATCCTGAAGCTGCAGAAGAATTGCCTCCTAAGCCTGCGA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 2941 TCCTGCGAAACAATGCCCGCCATCCTGAAGCTGCAGAAGAATTGCCTCCTAAGCCTGCGA Qy 3001 ACCGCTCTGACACACAACCAGGACTTCAGCATCTACAGACTGTGTTGCAAGCGGGGCTCC |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3001 ACCGCTCTGACACACAACCAGGACTTCAGCATCTACAGACTGTGTTGCAAGCGGGGCTCC Qy 3061 CTGTGCCATGCAAGCCAAGCTAGAAGCCCCGCCTTTCCTAAACCTGTGCGACCTCTGCCA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3061 CTGTGCCATGCAAGCCAAGCTAGAAGCCCCGCCTTTCCTAAACCTGTGCGACCTCTGCCA Qy 3121 GCTCCAATCACCAGAATTACCCCTCAGCTCGGCGGCCAGAGCGATTCATCTCAACCTCTG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3121 GCTCCAATCACCAGAATTACCCCTCAGCTCGGCGGCCAGAGCGATTCATCTCAACCTCTG Qy 3181 CTGACCACCGGCAGACCTCAAGGCTGGCAAGACCAAGCTCTGAGACACACCCAGCAGGCT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3181 CTGACCACCGGCAGACCTCAAGGCTGGCAAGACCAAGCTCTGAGACACACCCAGCAGGCT Qy 3241 AGCCCTGCCTCTTGTGCCACCATCACAATCCCCATCCACTCTGCCGCTCTGGGCGATCAT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3241 AGCCCTGCCTCTTGTGCCACCATCACAATCCCCATCCACTCTGCCGCTCTGGGCGATCAT Qy 3301 TCTGGCGATCCTGGACCAGCCTGGGACACATGTCCTCCACTGCCACTCACAACACTGATC |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3301 TCTGGCGATCCTGGACCAGCCTGGGACACATGTCCTCCACTGCCACTCACAACACTGATC Qy 3361 CCTAGGGCTCCTCCACCTTACGGCGATTCTACCGCTAGAAGCTGGCCCAGCAGATGTGGA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3361 CCTAGGGCTCCTCCACCTTACGGCGATTCTACCGCTAGAAGCTGGCCCAGCAGATGTGGA Qy 3421 CCACTCGGAGGCAACACAACCCTCCAGCAACTGGGAGAAGCCTCTCAGGCTCCTAGCGGC |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3421 CCACTCGGAGGCAACACAACCCTCCAGCAACTGGGAGAAGCCTCTCAGGCTCCTAGCGGC Qy 3481 TCTCTGATCCCTCTCAGACTGCCTCTCCTGTGGGAAGTTCGGGGCCAGCCTGATTCTTTT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3481 TCTCTGATCCCTCTCAGACTGCCTCTCCTGTGGGAAGTTCGGGGCCAGCCTGATTCTTTT Qy 3541 GCCGCACTGCACAGCTCCCTGAACGAGCTGGGAGAGATCGCTAGAGAGCTGCACCAGTTC |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3541 GCCGCACTGCACAGCTCCCTGAACGAGCTGGGAGAGATCGCTAGAGAGCTGCACCAGTTC Qy 3601 GCCTTCGACCTGCTGATCAAGAGCCACTTCGTGCAAGGCAAGGATTGGGGCCTCAAAAAG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3601 GCCTTCGACCTGCTGATCAAGAGCCACTTCGTGCAAGGCAAGGATTGGGGCCTCAAAAAG Qy 3661 TTTATCCGCAGAGACTTCTGGGGCATGGAACTGGCCGCCAGCAGAAGATTCAGCTGGGAT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3661 TTTATCCGCAGAGACTTCTGGGGCATGGAACTGGCCGCCAGCAGAAGATTCAGCTGGGAT Qy 3721 CATCATAGCGCAGGCGGCCCACCTAGAGTGCCATCTGTTAGAAGCGGAGCTGCCCAGGTG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3721 CATCATAGCGCAGGCGGCCCACCTAGAGTGCCATCTGTTAGAAGCGGAGCTGCCCAGGTG Qy 3781 CAGCCTAAAGATCCTCTGCCACTGAGAACACTGGCCGGCTGCCTTGCTAGAACAGCCCAT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3781 CAGCCTAAAGATCCTCTGCCACTGAGAACACTGGCCGGCTGCCTTGCTAGAACAGCCCAT Qy 3841 CTTAGACCTGGCGCCGAGTCTCTGCCTCAGCCACAACTGCACTGTACCCTGTGGTTCCAG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3841 CTTAGACCTGGCGCCGAGTCTCTGCCTCAGCCACAACTGCACTGTACCCTGTGGTTCCAG Qy 3901 TCCAGCGAGCTGTCTCCTACTGGTGCCCCTTGGCCATCTAGACGCCCTACTTGGAGAGGC |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3901 TCCAGCGAGCTGTCTCCTACTGGTGCCCCTTGGCCATCTAGACGCCCTACTTGGAGAGGC Qy 3961 ACCACCGTGTCACCAAGAACCGCCACAAGCAGCGCCAGAACCTGTTGTGGCACAAAGTGG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3961 ACCACCGTGTCACCAAGAACCGCCACAAGCAGCGCCAGAACCTGTTGTGGCACAAAGTGG Qy 4021 CCCTCCAGCCAAGAAGCCGCTCTCGGACTTGGAAGCGGACTGCTGAGGTTCTCTTGTGGA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 4021 CCCTCCAGCCAAGAAGCCGCTCTCGGACTTGGAAGCGGACTGCTGAGGTTCTCTTGTGGA Qy 4081 ACCGCCGCCATTCGGAAGATGCACTTTAGCCTGAAAGAACACCCTCCACCACCTTGTCCT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 4081 ACCGCCGCCATTCGGAAGATGCACTTTAGCCTGAAAGAACACCCTCCACCACCTTGTCCT Qy 4141 CCAGAGGCTTTCCAAAGAGCTGCTGGCGAAGGCGGACCTGGTAGAGGTGGTGCTAGAAGA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 4141 CCAGAGGCTTTCCAAAGAGCTGCTGGCGAAGGCGGACCTGGTAGAGGTGGTGCTAGAAGA Qy 4201 GGTGCTAGGGTGCTGCAGAGCCCATTCTGTAGAGCAGGCGCAGGCGAATGGCTGGGCCAT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 4201 GGTGCTAGGGTGCTGCAGAGCCCATTCTGTAGAGCAGGCGCAGGCGAATGGCTGGGCCAT Qy 4261 CAGAGTCTGAGACATGTCGTCGGCTACGGCCACCTGGATACAAGCGGAAGCAGCTCTAGC |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 4261 CAGAGTCTGAGACATGTCGTCGGCTACGGCCACCTGGATACAAGCGGAAGCAGCTCTAGC Qy 4321 TCCAGCTGGCCTAACTCAAAAATGGCTCTGAACAGCCTGAACTCCATCGACGACGCCCAG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 4321 TCCAGCTGGCCTAACTCAAAAATGGCTCTGAACAGCCTGAACTCCATCGACGACGCCCAG Qy 4381 CTGACAAGAATCGCCCCTCCTAGATCTCACTGCTGCTTTTGGGAAGTGAACGCCC
Read full office action

Prosecution Timeline

Dec 13, 2022
Application Filed
Aug 25, 2025
Non-Final Rejection — §103, §112 (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12595313
MODIFIED FC-REGIONS TO ENHANCE FUNCTIONAL AFFINITY OF ANTIBODIES AND ANTIGEN BINDING FRAGMENTS THEREOF
2y 5m to grant Granted Apr 07, 2026
Patent 12552866
INTERNALIZING BINDING MOLECULES TARGETING RECEPTORS INVOLVED IN CELL PROLIFERATION OR IN CELL DIFFERENTIATION
2y 5m to grant Granted Feb 17, 2026
Patent 12545746
ANTI-BCMA CAR ANTIBODIES, CONJUGATES, AND METHODS OF USE
2y 5m to grant Granted Feb 10, 2026
Patent 12527843
IMMUNE-CELL TARGETED BISPECIFIC CHIMERIC PROTEINS AND USES THEREOF
2y 5m to grant Granted Jan 20, 2026
Patent 12441789
DLL3-TARGETING ANTIBODIES AND USES THEREOF
2y 5m to grant Granted Oct 14, 2025
Study what changed to get past this examiner. Based on 5 most recent grants.

AI Strategy Recommendation

Get an AI-powered prosecution strategy using examiner precedents, rejection analysis, and claim mapping.
Powered by AI — typically takes 5-10 seconds

Prosecution Projections

1-2
Expected OA Rounds
32%
Grant Probability
99%
With Interview (+81.3%)
3y 11m
Median Time to Grant
Low
PTA Risk
Based on 19 resolved cases by this examiner. Grant probability derived from career allow rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month