Prosecution Insights
Last updated: July 05, 2026
Application No. 18/152,895

MODIFIED MGLUR6 PROMOTER AND METHODS OF USE

Final Rejection §112§DOUBLEPATENT§DP
Filed
Jan 11, 2023
Priority
Mar 11, 2014 — provisional 61/951,360 +4 more
Examiner
NGUYEN, QUANG
Art Unit
1631
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
Wayne State University
OA Round
2 (Final)
38%
Grant Probability
At Risk
3-4
OA Rounds
6m
Est. Remaining
91%
With Interview

Examiner Intelligence

Grants only 38% of cases
38%
Career Allowance Rate
281 granted / 739 resolved
-22.0% vs TC avg
Strong +53% interview lift
Without
With
+52.8%
Interview Lift
resolved cases with interview
Typical timeline
4y 0m
Avg Prosecution
54 currently pending
Career history
805
Total Applications
across all art units

Statute-Specific Performance

§101
0.4%
-39.6% vs TC avg
§103
57.9%
+17.9% vs TC avg
§102
6.6%
-33.4% vs TC avg
§112
9.9%
-30.1% vs TC avg
Black line = Tech Center average estimate • Based on career data from 739 resolved cases

Office Action

§112 §DOUBLEPATENT §DP
DETAILED ACTION Notice of Pre-AIA or AIA Status The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . Applicant’s amendment filed on 03/03/2026 has been entered. Amended claims 1-20 are pending in the present application. Applicant elected previously without traverse the following species: (i) a channelrhodopsin as a species of a transgene encoding an opsin; (ii) SEQ ID NO: 13 as a species of a channelrhodopsin; (iii) SEQ ID NO: 24 as a species of a capsid protein; (iv) AAV2 as a species of an AAV expression vector; and (v) SEQ ID NO: 35 as a species of a peptide in a capsid protein. Claims 9-10, 15-16 and 19-20 are withdrawn from further considerations because they are directed to non-elected species. Therefore, amended claims 1-8, 11-14 and 17-18 are examined on the merits herein with the above elected species. Response to Amendment 1. The rejection under 35 U.S.C. 112(a) or 35 U.S.C. 112 (pre-AIA ), first paragraph, for Enablement was withdrawn in light of currently amended independent claim 1, particularly with the deletion of the limitation “a nucleic acid sequence encoding a capsid protein”. 2. All non-statutory double patenting rejections over claims 1-9 and 12-21 of U.S. Patent No. 11,583,595 were withdrawn in light of currently amended independent claim 1, particularly with the limitation “an mGluR6 promoter comprising SEQ ID NO: 5”. Claim Rejections - 35 USC § 112 (Lack of Written Description) The following is a quotation of the first paragraph of 35 U.S.C. 112(a): (a) IN GENERAL.—The specification shall contain a written description of the invention, and of the manner and process of making and using it, in such full, clear, concise, and exact terms as to enable any person skilled in the art to which it pertains, or with which it is most nearly connected, to make and use the same, and shall set forth the best mode contemplated by the inventor or joint inventor of carrying out the invention. The following is a quotation of the first paragraph of pre-AIA 35 U.S.C. 112: The specification shall contain a written description of the invention, and of the manner and process of making and using it, in such full, clear, concise, and exact terms as to enable any person skilled in the art to which it pertains, or with which it is most nearly connected, to make and use the same, and shall set forth the best mode contemplated by the inventor of carrying out his invention. Claims 1-3, 5-8, 11-14 and 17-18 are rejected under 35 U.S.C. 112(a) or 35 U.S.C. 112 (pre-AIA ), first paragraph, as failing to comply with the written description requirement. The claim(s) contains subject matter which was not described in the specification in such a way as to reasonably convey to one skilled in the relevant art that the inventor or a joint inventor, or for applications subject to pre-AIA 35 U.S.C. 112, the inventor(s), at the time the application was filed, had possession of the claimed invention. This is a new ground of rejection necessitated by Applicant’s amendment. MPEP 2163 - 35 U.S.C. 112(a) and the first paragraph of pre-AIA 35 U.S.C. 112 require that the “specification shall contain a written description of the invention ....” This requirement is separate and distinct from the enablement requirement. Ariad Pharm., Inc. v. Eli Lilly & Co., 598 F.3d 1336, 1340, 94 USPQ2d 1161, 1167 (Fed. Cir. 2010) (en banc). Vas-Cath Inc. v. Mahurkar, 19USPQ2d 1111 (Fed. Cir. 1991), clearly states that “applicant must convey with reasonable clarity to those skilled in the art that, as of the filing date sought, he or she was in possession of the invention. The invention is, for purposes of the ‘written description’ inquiry, whatever is now claimed.” Vas-Cath Inc. v. Mahurkar, 19USPQ2d at 1117. The specification does not “clearly allow persons of ordinary skill in the art to recognize that [he or she] invented what is claimed. ”Vas-Cath Inc. v. Mahurkar, 19USPQ2d at 1116. The instant claims encompass a composition comprising adeno-associated virus (AAV) or recombinant adeno-associated virus (rAAV) virions carrying an expression vector comprising a nucleic acid sequence comprising an mGluR6 promoter comprising SEQ ID NO: 5 (500-nucleotide sequence) or a sequence having at least 70% identity thereto (up to 150 nucleotide modifications that include insertion(s), deletion(s), substitution(s), or a combination thereof), operably linked to a transgene encoding an opsin selected from the group consisting of a channelrhodopsin, a halorhodopsin, and a melanopsin (e.g., 737-amino-acid Chop2 of SEQ ID NO: 12 or the elected 313-amino-acid Chop2 fragment of SEQ ID NO: 13); the same expression vector further comprising an mGluR6 enhancer comprising the nucleic acid sequence of SEQ ID NO: 1 (202-nucleotide sequence), or a sequence having at least 70% identity thereto (up to 61 nucleotide modifications that include insertion(s), deletion(s), substitution(s), or a combination thereof); the same composition wherein the virions comprising a capsid protein comprising an amino acid sequence selected from the group consisting of SEQ ID NOS: 23-35 (e.g., including a wild-type AAV2 capsid protein of SEQ ID NO: 24 which is the elected 727-amino-acid sequence, or an AAV2 capsid protein comprising the elected insertion peptide of SEQ ID NO: 35); and a pharmaceutical composition comprising the same composition and a pharmaceutically acceptable carrier or excipient. Apart from disclosing the 500 bp human mGluR6 promoter of SEQ ID NO: 5 which is a fragment of a mouse mGluR6 promoter region (paragraphs [0021], [0029]; Example 1 and Figs. 3-4), the instant specification fails to provide sufficient description for any other promoter sequence having at least 70% identity to SEQ ID NO: 5 (up to 150 nucleotide modifications that include insertion(s), deletion(s), substitution(s), or a combination thereof), and yet such modified promoter sequence still retains its promoter activity as encompassed broadly by the instant claims. For example, which specific substitution(s), deletion(s) and/or insertion(s) at which particular position(s) along the sequence of SEQ ID NO: 5 should a modification(s) being made so that the resulting sequence still possesses promoter activity? Hashimoto et al (European Journal of Neuroscience 9:1226-1235, 1997; IDS) already isolated genomic clones containing the human mGluR6 gene, and stated “Neither the TATA box nor the CCAAT box, both of which are thought to serve RNA polymerase selection signals (Breathnach and Chambon, 1981), is detected at the putative promoter region preceding exon 1 of the mGluR6 gene (Fig. 2A). An unusual feature with an extremely high content (>80%) of C + G is seen in the sequence of exon 1 and its preceding putative promoter region as depicted in Figure 4. Furthermore, an about 1kb island rich in CpG doublets, which is rare in vertebrate genomic sequences but present in the promoter region of some tissue-specific genes together with the ‘housekeeping’ genes (Bird, 1986), is observed over this region (Fig. 4). There are also many potential promoter, enhancer and regulatory DNA elements in the 5’ flanking region of the mGluR6 gene” (paragraph bridging left and right columns at page 1230). However, Ueda et al noted that the nucleotide sequences of the 5’ untranslated region and its upstream 5’ flanking region diverge considerably between the human and mouse mGluR6 genes, and that the transcription initiation of the mouse mGluR6 gene could not be assigned definitely (paragraph bridging pages 3015-3016). Moreover, a promoter function and/or transcription rate activity has also been demonstrated to be critically dependent on proper alignment and spacing/ distance of cis-DNA elements or domains for various promoters such as lung surfactant B promoter (Alam et al, Gene 282:103-111, 2002) and rat rDNA promoter (Xie et al, Molecular and Cellular Biology 12:1266-1275, 1992). Similarly, apart from disclosing the 202-bp mouse mGluR6 enhancer of SEQ ID NO: 1 the instant specification fails to provide sufficient description for any other enhancer sequence having at least 70% identity to SEQ ID NO: 1 (up to 61 nucleotide modifications that include insertion(s), deletion(s), substitution(s), or a combination thereof), and yet such modified enhancer sequence still retains its enhancer activity at any location and/or in any orientation relative at least to the mGluR6 promoter of SEQ ID NO: 5 as encompassed broadly by the instant claims. Once again, which specific substitution(s), deletion(s) and/or insertion(s) at which particular position(s) along the sequence of SEQ ID NO: 1 should a modification(s) being made so that the resulting modified sequence still possesses enhancer activity? Please also note that the physiological art is recognized as unpredictable (MPEP 2164.03). Since the prior art before the effective filing date of the present application (03/11/2014) did not provide any guidance regarding the issues discussed above as evidenced at least by the teachings of Pan et al (US 2010/0015095; IDS), Ueda et al (Journal of Neuroscience 17:3014-3023, 1997; IDS); Hashimoto et al (European Journal of Neuroscience 9:1226-1235, 1997; IDS), and Doroudchi et al (Molecular Therapy 19:1220-1229, 2011; IDS); it is incumbent upon the present application to do so. The instant specification also fails to provide at least a sufficient number of a representative number of species for a broad genus of a composition comprising AAV or rAAV virions carrying an expression vector having the recited elements as claimed broadly. The claimed invention as a whole is not adequately described if the claims require essential or critical elements which are not adequately described in the specification and which are not conventional in the art as of Applicants’ filing date. Possession may be shown by actual reduction to practice, clear depiction of the invention in a detailed drawing, or by describing the invention with sufficient relevant identifying characteristics such that a person skilled in the art would recognize that the inventor had possession of the claimed invention. Pfaff v. Wells Electronics, Inc., 48 USPQ2d 1641, 1646 (1998). The skilled artisan cannot envision the detailed structure at least of a representative number of species for a broad genus of a composition comprising AAV or rAAV virions carrying an expression vector having the recited elements as claimed broadly, and therefore conception is not achieved until reduction to practice has occurred, regardless of the complexity or simplicity of the method. Adequate written description requires more than a mere statement that it is part of the invention and reference to a method of isolating it. See Fiers v. Revel, 25 USPQ2d 1601, 1606 (Fed. Cir. 1993) and Amgen Inc. v. Chugai Pharmaceutical Co. Ltd., 18 USPQ2d 1016 (Fed. Cir. 1991). One cannot describe what one has not conceived. See Fiddes v. Baird, 30 USPQ2d 1481, 1483. Applicant is reminded that Vas-Cath makes clear that the written description provision of 35 U.S.C. §112 is severable from its enablement provision (see page 1115). Double Patenting The nonstatutory double patenting rejection is based on a judicially created doctrine grounded in public policy (a policy reflected in the statute) so as to prevent the unjustified or improper timewise extension of the “right to exclude” granted by a patent and to prevent possible harassment by multiple assignees. A nonstatutory double patenting rejection is appropriate where the conflicting claims are not identical, but at least one examined application claim is not patentably distinct from the reference claim(s) because the examined application claim is either anticipated by, or would have been obvious over, the reference claim(s). See, e.g., In re Berg, 140 F.3d 1428, 46 USPQ2d 1226 (Fed. Cir. 1998); In re Goodman, 11 F.3d 1046, 29 USPQ2d 2010 (Fed. Cir. 1993); In re Longi, 759 F.2d 887, 225 USPQ 645 (Fed. Cir. 1985); In re Van Ornum, 686 F.2d 937, 214 USPQ 761 (CCPA 1982); In re Vogel, 422 F.2d 438, 164 USPQ 619 (CCPA 1970); In re Thorington, 418 F.2d 528, 163 USPQ 644 (CCPA 1969). A timely filed terminal disclaimer in compliance with 37 CFR 1.321(c) or 1.321(d) may be used to overcome an actual or provisional rejection based on nonstatutory double patenting provided the reference application or patent either is shown to be commonly owned with the examined application, or claims an invention made as a result of activities undertaken within the scope of a joint research agreement. See MPEP § 717.02 for applications subject to examination under the first inventor to file provisions of the AIA as explained in MPEP § 2159. See MPEP § 2146 et seq. for applications not subject to examination under the first inventor to file provisions of the AIA . A terminal disclaimer must be signed in compliance with 37 CFR 1.321(b). The filing of a terminal disclaimer by itself is not a complete reply to a nonstatutory double patenting (NSDP) rejection. A complete reply requires that the terminal disclaimer be accompanied by a reply requesting reconsideration of the prior Office action. Even where the NSDP rejection is provisional the reply must be complete. See MPEP § 804, subsection I.B.1. For a reply to a non-final Office action, see 37 CFR 1.111(a). For a reply to final Office action, see 37 CFR 1.113(c). A request for reconsideration while not provided for in 37 CFR 1.113(c) may be filed after final for consideration. See MPEP §§ 706.07(e) and 714.13. The USPTO Internet website contains terminal disclaimer forms which may be used. Please visit www.uspto.gov/patent/patents-forms. The actual filing date of the application in which the form is filed determines what form (e.g., PTO/SB/25, PTO/SB/26, PTO/AIA /25, or PTO/AIA /26) should be used. A web-based eTerminal Disclaimer may be filled out completely online using web-screens. An eTerminal Disclaimer that meets all requirements is auto-processed and approved immediately upon submission. For more information about eTerminal Disclaimers, refer to www.uspto.gov/patents/apply/applying-online/eterminal-disclaimer. Claims 1-7, 11-14 and 17-18 are rejected on the ground of nonstatutory double patenting as being unpatentable over claims 1-15 of U.S. Patent No. 10,307,492. This is a new ground of rejection necessitated by Applicant’s amendment. Although the claims at issue are not identical, they are not patentably distinct from each other because an adeno-associated virus (AAV) vector or a recombinant adeno-associated virus (rAAV) vector (e.g., AAV1, AAV2, AAV3, dependent claims 4, 7-8) comprising an isolated nucleic acid molecule comprising at least: (a) an mGluR6 enhancer or a variant thereof at least 70% identical to SEQ ID NO: 1; and (b) an mGluR6 promoter or a variant thereof at least 70% identical to SEQ ID NO: 5; operably linked to a transgene (e.g., an opsin gene such as a channelrhodopsin gene, a melanopsin gene; claims 1, 4, 12-13); the same AAV or rAAV comprises a capsid protein comprising at least one mutation and the capsid protein comprises the peptide insert of SEQ ID NO: 35 (dependent claims 9-11); and a pharmaceutical composition comprising the same AAV or rAAV and a pharmaceutically acceptable excipient (dependent claim 15) in claims 1-15 of U.S. Patent No. 10,307,492 anticipate and/or encompass a composition comprising AAV or rAAV virion, and a pharmaceutical composition comprising the same composition in the application being examined and, therefore, a patent to the genus would, necessarily, extend the rights of the species or sub- should the genus issue as a patent after the species of sub-genus. It is noted that since the pharmaceutical composition of U.S. Patent No. 10,307,492 has the same components as that in the application being examined, such pharmaceutical composition is suitable for intravitreal delivery. Claims 1, 8 and 13 are rejected on the ground of nonstatutory double patenting as being unpatentable over claims 1-15 of U.S. Patent No. 10,307,492 in view of Pan et al (US 2010/0015095; IDS) and Shrivastava et al (US 2013/0310443). The instant claims differ from claims 1-15 of U.S. Patent No. 10,307,492 in reciting specifically that the channelrhodopsin is the 315-amino-acid Chop2 fragment of SEQ ID NO: 13 (elected species, claim 8) and the capsid protein has the amino acid sequence of SEQ ID NO: 24 (elected species, claim 13). Before the effective filing date of the present application, Pan et al already taught using nucleic acid vectors encoding light-gated cation-selective membrane channels, particular channelrhodopsin-2 (Chop2) that includes Chop2 fragment of SEQ ID NO: 3 that is 100% identical to SEQ ID NO: 13 of the present application (see attached sequence search below), to convert inner retinal neurons to photosensitive cells for restoration of visual responses in a subject in need thereof via intravitreal or subretinal injection, wherein the nucleic acid vectors include rAAV vectors (see at least Abstract; Summary of the Invention; particularly paragraphs [0092] and [0095]). Additionally, Shrivastava et al already disclosed at least the capsid protein of wild-type AAV2 of SEQ ID NO: 2 that is 100% identical to SEQ ID NO: 24 of the present application (see attached sequence search below), as well as AAV capsid proteins comprising modification of one or a combination of the surface exposed lysine, serine, threonine and/or tyrosine residues in the VP3 region thereof (Abstract; and Figs. 2A-D). Accordingly, it would have been obvious for an ordinary skilled artisan before the effective filing date of the present application to modify the adeno-associated virus (AAV) or a recombinant adeno-associated virus (rAAV) nucleic acid expression vector in claims 1-15 of U.S. Patent No. 10,307,492 by also selecting the Chop2 fragment of SEQ ID NO: 3 as a channelrhodopsin and/or using the capsid protein of wild-type AAV2 of SEQ ID NO: 2; in light of the teachings of Pan et al and Srivastava et al as set forth above with a reasonable expectation of success. An ordinary skilled artisan would have been motivated to carry out the above modifications because: (i) Pan et al already taught successfully using nucleic acid vectors encoding channelrhodopsin-2 (Chop2) that includes Chop2 fragment of SEQ ID NO: 3, to convert inner retinal neurons to photosensitive cells for restoration of visual responses in a subject in need thereof via intravitreal or subretinal injection; and (ii) Shrivastava et al also disclosed at least the capsid protein of wild-type AAV2 of SEQ ID NO: 2, as well as AAV2 capsid proteins comprising modification of one or a combination of the surface exposed lysine, serine, threonine and/or tyrosine residues in the VP3 region. The modified composition resulting from claims 1-15 of U.S. Patent No. 10,307,492 along with teachings of Pan et al and Srivastava et al is indistinguishable and encompassed by the presently claimed invention. Therefore, the claimed invention as a whole was prima facie obvious in the absence of evidence to the contrary. The prior art made of record and not relied upon is considered pertinent to applicant's disclosure. 1. Trinklein et al (US 2007/0161031) disclosed the expression transcriptional regulatory element of SEQ ID NO: 35126 (2300 nucleotides) that is 100% identical to SEQ ID NO: 6 of the present application (Abstract; particularly paragraphs [0008], [0011], [0013] and [0016]; and attached sequence search below). 2. Schaffer et al (US 2014/0294771) disclosed AAV virions with altered capsid protein, including one with the insertion peptide of LGETTRP (SEQ ID NO: 13) that is 100% identical to SEQ ID NO: 35 of the present application, wherein the AAV virions exhibit greater infectivity to retinal cells when administered via intravitreal injection, compared to wild-type AAV (Abstract; and paragraph [0091]; and attached sequence search below). Examiner’s Comment The closest prior art is Pan et al (US 2010/0015095; IDS) which disclosed generically the use of a promoter from a mGluR6 promoter-region of the Grm6 gene (GenBank accession number BC041684), and a preferred example of this mGluR6 promoter-region is SEQ ID NO:9 consisting of 11023 nucleotides as shown in FIG. 8; or part of a promoter sequence of SEQ ID NO: 9 in a nucleic acid vector encoding light-gated cation-selective membrane channels (e.g., Chop2) to convert inner retinal neurons to photosensitive cells in photoreceptor-degenerated retinal in an animal model (Abstract; and particularly paragraphs [0027], [0033], [0067] and [0087]). However, Pan et al did not teach or fairly suggest any specific part of the promoter-region of SEQ ID NO: 9 (11023-bp sequence), especially any particular truncated version of SEQ ID NO: 9 of a size that is suitable to be packaged in a recombinant AAV vector, let alone an mGluR6 promoter comprising the specific 500-bp promoter sequence of SEQ ID NO: 5 of the present application. Conclusion No claim is allowed. Applicant's amendment necessitated the new ground(s) of rejection presented in this Office action. Accordingly, THIS ACTION IS MADE FINAL. See MPEP § 706.07(a). Applicant is reminded of the extension of time policy as set forth in 37 CFR 1.136(a). A shortened statutory period for reply to this final action is set to expire THREE MONTHS from the mailing date of this action. In the event a first reply is filed within TWO MONTHS of the mailing date of this final action and the advisory action is not mailed until after the end of the THREE-MONTH shortened statutory period, then the shortened statutory period will expire on the date the advisory action is mailed, and any nonprovisional extension fee (37 CFR 1.17(a)) pursuant to 37 CFR 1.136(a) will be calculated from the mailing date of the advisory action. In no event, however, will the statutory period for reply expire later than SIX MONTHS from the mailing date of this final action. Any inquiry concerning this communication or earlier communications from the examiner should be directed to Quang Nguyen, Ph.D., whose telephone number is (571) 272-0776. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s SPE, James Douglas (Doug) Schultz, Ph.D., may be reached at (571) 272-0763. To aid in correlating any papers for this application, all further correspondence regarding this application should be directed to Group Art Unit 1631; Central Fax No. (571) 273-8300. Any inquiry of a general nature or relating to the status of this application or proceeding should be directed to (571) 272-0547. Patent applicants with problems or questions regarding electronic images that can be viewed in the Patent Application Information Retrieval system (PAIR) can now contact the USPTO’s Patent Electronic Business Center (Patent EBC) for assistance. Representatives are available to answer your questions daily from 6 am to midnight (EST). The toll-free number is (866) 217-9197. When calling please have your application serial or patent number, the type of document you are having an image problem with, the number of pages and the specific nature of the problem. The Patent Electronic Business Center will notify applicants of the resolution of the problem within 5-7 business days. Applicants can also check PAIR to confirm that the problem has been corrected. The USPTO’s Patent Electronic Business Center is a complete service center supporting all patent business on the Internet. The USPTO’s PAIR system provides Internet-based access to patent application status and history information. It also enables applicants to view the scanned images of their own application file folder(s) as well as general patent information available to the public. /QUANG NGUYEN/Primary Examiner, Art Unit 1631 Sequence 3, Publication No. US20100015095A1 Synthetic fragment of Chlamydomonas reinhardtii Chop2 protein Query Match 100.0%; Score 1686; Length 315; Best Local Similarity 100.0%; Matches 315; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 MDYGGALSAVGRELLFVTNPVVVNGSVLVPEDQCYCAGWIESRGTNGAQTASNVLQWLAA 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MDYGGALSAVGRELLFVTNPVVVNGSVLVPEDQCYCAGWIESRGTNGAQTASNVLQWLAA 60 Qy 61 GFSILLLMFYAYQTWKSTCGWEEIYVCAIEMVKVILEFFFEFKNPSMLYLATGHRVQWLR 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 GFSILLLMFYAYQTWKSTCGWEEIYVCAIEMVKVILEFFFEFKNPSMLYLATGHRVQWLR 120 Qy 121 YAEWLLTCPVILIHLSNLTGLSNDYSRRTMGLLVSDIGTIVWGATSAMATGYVKVIFFCL 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 YAEWLLTCPVILIHLSNLTGLSNDYSRRTMGLLVSDIGTIVWGATSAMATGYVKVIFFCL 180 Qy 181 GLCYGANTFFHAAKAYIEGYHTVPKGRCRQVVTGMAWLFFVSWGMFPILFILGPEGFGVL 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 GLCYGANTFFHAAKAYIEGYHTVPKGRCRQVVTGMAWLFFVSWGMFPILFILGPEGFGVL 240 Qy 241 SVYGSTVGHTIIDLMSKNCWGLLGHYLRVLIHEHILIHGDIRKTTKLNIGGTEIEVETLV 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 SVYGSTVGHTIIDLMSKNCWGLLGHYLRVLIHEHILIHGDIRKTTKLNIGGTEIEVETLV 300 Qy 301 EDEAEAGAVNKGTGK 315 ||||||||||||||| Db 301 EDEAEAGAVNKGTGK 315 Sequence 2, Publication No. US20130310443A1 Query Match 100.0%; Score 3954; Length 727; Best Local Similarity 100.0%; Matches 727; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 AADGYLPDWLEDTLSEGIRQWWKLKPGPPPPKPAERHKDDSRGLVLPGYKYLGPFNGLDK 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 AADGYLPDWLEDTLSEGIRQWWKLKPGPPPPKPAERHKDDSRGLVLPGYKYLGPFNGLDK 60 Qy 61 GEPVNEADAAALEHDKAYDRQLDSGDNPYLKYNHADAEFERLKEDTSFGGNLGRAVFQAK 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 GEPVNEADAAALEHDKAYDRQLDSGDNPYLKYNHADAEFERLKEDTSFGGNLGRAVFQAK 120 Qy 121 KRVLEPLGLVEEPVKTAPGKKRPVEHSPVEPDSSSGTGKAGQQPARKRLNFGQTGDADSV 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 KRVLEPLGLVEEPVKTAPGKKRPVEHSPVEPDSSSGTGKAGQQPARKRLNFGQTGDADSV 180 Qy 181 PDPQPLGQPPAAPSGLGNTMATGSGAPMADNNEGADGVGNSSGNWHCDSTWMGDRVITTS 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 PDPQPLGQPPAAPSGLGNTMATGSGAPMADNNEGADGVGNSSGNWHCDSTWMGDRVITTS 240 Qy 241 TRTWALPTYNNHLYKQISSQSGASNDNHYFGYSTPWGYFDFNRFHCHFSPRDWQLINNNW 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 TRTWALPTYNNHLYKQISSQSGASNDNHYFGYSTPWGYFDFNRFHCHFSPRDWQLINNNW 300 Qy 301 GFRPKRLNFKLFNIQVKEVTQNDGTTTIANNLTSTVQVFTDSEYQLPYVLGSAHQGCLPP 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 GFRPKRLNFKLFNIQVKEVTQNDGTTTIANNLTSTVQVFTDSEYQLPYVLGSAHQGCLPP 360 Qy 361 FPADVFMVPQYGYLTLNNGSQAVGRSSFYCEYFPSQMLRTGNNFTFSYTFEDVPFHSSYA 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 FPADVFMVPQYGYLTLNNGSQAVGRSSFYCEYFPSQMLRTGNNFTFSYTFEDVPFHSSYA 420 Qy 421 HSQSLDRLMNPLIDQYLYYLSRTNTPSGTTTQSRLQFSQAGASDIRDQSRNWLPGPCYRQ 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 421 HSQSLDRLMNPLIDQYLYYLSRTNTPSGTTTQSRLQFSQAGASDIRDQSRNWLPGPCYRQ 480 Qy 481 QRVSKTSANNNSEYSWTGATKYHLNGRDSLVNPGPAMASHKDDEEKFFPQSGVLIFGKQG 540 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 481 QRVSKTSANNNSEYSWTGATKYHLNGRDSLVNPGPAMASHKDDEEKFFPQSGVLIFGKQG 540 Qy 541 SEKTNVDIEKVMITDEEEIRTTNPVATEQYGSVSTNLQRNRQAATADVNTQGVLPGMVWQ 600 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 541 SEKTNVDIEKVMITDEEEIRTTNPVATEQYGSVSTNLQRNRQAATADVNTQGVLPGMVWQ 600 Qy 601 DRDVYLQGPIWAKIPHTDGHFHPSPLMGGFGLKHPPPQILIKNTPVPANPSTTFSAAKFA 660 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 601 DRDVYLQGPIWAKIPHTDGHFHPSPLMGGFGLKHPPPQILIKNTPVPANPSTTFSAAKFA 660 Qy 661 SFITQYSTGQVSVEIEWEQKENSKRWNPEIQYTSNYNKSVNVDFTVDTNGVYSEPRPIGT 720 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 661 SFITQYSTGQVSVEIEWEQKENSKRWNPEIQYTSNYNKSVNVDFTVDTNGVYSEPRPIGT 720 Qy 721 RYLTRNL 727 ||||||| Db 721 RYLTRNL 727 Sequence 35126, Publication No. US20070161031A1 Query Match 100.0%; Score 547; Length 2300; Best Local Similarity 100.0%; Matches 547; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 CCAAAGACAAGAAAACAGGAAAACAGACCCAGAGATTGGGAGAGGGAGGGGAAGGAGATG 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1733 CCAAAGACAAGAAAACAGGAAAACAGACCCAGAGATTGGGAGAGGGAGGGGAAGGAGATG 1792 Qy 61 CGGGGAGAGCCAGCACCGCCACCCCCCACACTCAGGAGGGGTCTCCACCCTCGGAGCGGT 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1793 CGGGGAGAGCCAGCACCGCCACCCCCCACACTCAGGAGGGGTCTCCACCCTCGGAGCGGT 1852 Qy 121 CTCTCATCCCTCCCTAGAATCCTTAAATCCTCTCTCGCTCAGGGCCTCGGCCGCATCTGT 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1853 CTCTCATCCCTCCCTAGAATCCTTAAATCCTCTCTCGCTCAGGGCCTCGGCCGCATCTGT 1912 Qy 181 CACAGACTTGTCCTGAACCGACAGCGGCTGGCGCAGGTGACTGGCTTGGGGCGGGAGCCT 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1913 CACAGACTTGTCCTGAACCGACAGCGGCTGGCGCAGGTGACTGGCTTGGGGCGGGAGCCT 1972 Qy 241 GGGTGTGCGCTGGGGATGGACCCCGAGGAAGAGGGGCCAAGCTGTCGGGAAGCGGCAGGG 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1973 GGGTGTGCGCTGGGGATGGACCCCGAGGAAGAGGGGCCAAGCTGTCGGGAAGCGGCAGGG 2032 Qy 301 CTGGAGGGGTGGAGGCAGTGGTCGGGCGGGACCCCGGGCGACAGGGTTCGGCGCTTGTAA 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 2033 CTGGAGGGGTGGAGGCAGTGGTCGGGCGGGACCCCGGGCGACAGGGTTCGGCGCTTGTAA 2092 Qy 361 GAGCGAGACGGAGGCCCGGGCAGGCCGGCTGAGCTAACTCCCCAGAGCCGAAGTGGAAGG 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 2093 GAGCGAGACGGAGGCCCGGGCAGGCCGGCTGAGCTAACTCCCCAGAGCCGAAGTGGAAGG 2152 Qy 421 CGCGCCCCGAGCGCCTTCTCCCCAGGACCCCGGTGTCCCTCCCCGCGCCCCGAGCCCGCG 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 2153 CGCGCCCCGAGCGCCTTCTCCCCAGGACCCCGGTGTCCCTCCCCGCGCCCCGAGCCCGCG 2212 Qy 481 CTCTCCTTCCCCCGCCCTCAGAGCGCTCCCCGCCCCTCTGTCTCCCCGCAGCCCGCTAGA 540 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 2213 CTCTCCTTCCCCCGCCCTCAGAGCGCTCCCCGCCCCTCTGTCTCCCCGCAGCCCGCTAGA 2272 Qy 541 CGAGCCG 547 ||||||| Db 2273 CGAGCCG 2279 Sequence 13, Publication No. US20140294771A1 Query Match 100.0%; Score 37; Length 7; Best Local Similarity 100.0%; Matches 7; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 LGETTRP 7 ||||||| Db 1 LGETTRP 7
Read full office action

Prosecution Timeline

Jan 11, 2023
Application Filed
Oct 23, 2025
Non-Final Rejection mailed — §112, §DOUBLEPATENT, §DP
Dec 17, 2025
Response after Non-Final Action
Dec 17, 2025
Response Filed
Mar 03, 2026
Response Filed
May 13, 2026
Final Rejection mailed — §112, §DOUBLEPATENT, §DP
Jun 17, 2026
Examiner Interview Summary
Jun 17, 2026
Applicant Interview (Telephonic)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12655427
Recombinant Adeno-Associated Virus Delivery of Exon 2-Targeted U7SNRNA Polynucleotide Constructs
4y 6m to grant Granted Jun 16, 2026
Patent 12649928
RNA-Guided Human Genome Engineering
6y 0m to grant Granted Jun 09, 2026
Patent 12640251
METHODS OF TREATING DEMENTIA ASSOCIATED WITH ALZHEIMER'S DISEASE WITH PROTECTIVE PROTEIN/CATHEPSIN A (PPCA)
3y 9m to grant Granted May 26, 2026
Patent 12630805
Compositions and Methods of Treatment
3y 2m to grant Granted May 19, 2026
Patent 12612643
RNA-Guided Human Genome Engineering
5y 2m to grant Granted Apr 28, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

Strategy Recommendation AI-generated — please review before filing

Get a prosecution strategy drawn from examiner precedents, rejection analysis, and claim mapping.
Typically takes 5-10 seconds — AI-generated, attorney review required before filing

Prosecution Projections

3-4
Expected OA Rounds
38%
Grant Probability
91%
With Interview (+52.8%)
4y 0m (~6m remaining)
Median Time to Grant
Moderate
PTA Risk
Based on 739 resolved cases by this examiner. Grant probability derived from career allowance rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month