Prosecution Insights
Last updated: October 04, 2026
Application No. 18/176,819

CAS9 PROTEIN FOR GENOME EDITING

Non-Final OA §102§103§112
Filed
Mar 01, 2023
Priority
Mar 01, 2022 — provisional 63/268,745
Examiner
BORGEEST, CHRISTINA M
Art Unit
Tech Center
Assignee
Centre Of Oncology And Immunology Limited
OA Round
1 (Non-Final)
56%
Grant Probability
Moderate
1-2
OA Rounds
0m
Est. Remaining
77%
With Interview

Examiner Intelligence

Grants 56% of resolved cases
56%
Career Allowance Rate
403 granted / 725 resolved
-4.4% vs TC avg
Strong +21% interview lift
Without
With
+21.4%
Interview Lift
resolved cases with interview
Typical timeline
3y 2m
Avg Prosecution
53 currently pending
Career history
766
Total Applications
across all art units

Statute-Specific Performance

§101
9.1%
-30.9% vs TC avg
§103
26.0%
-14.0% vs TC avg
§102
15.1%
-24.9% vs TC avg
§112
31.8%
-8.2% vs TC avg
Black line = Tech Center average estimate • Based on career data from 725 resolved cases

Office Action

§102 §103 §112
DETAILED ACTION Notice of Pre-AIA or AIA Status The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . Election/Restrictions Applicant’s election without traverse of Group I (claims 1-7) in the reply filed on 08/17/2026 is acknowledged. Claims 8-37 are withdrawn from further consideration pursuant to 37 CFR 1.142(b) as being drawn to a nonelected invention, there being no allowable generic or linking claim. Election was made without traverse in the reply filed on 08/17/2026. The location of your application in the USPTO has changed. To aid in correlating any papers for this application, all further correspondence regarding this application should be directed to Examiner Christina Borgeest, Art Unit 1675. Priority Applicant’s claim for the benefit of a prior-filed application under 35 U.S.C. 119(e) is acknowledged. The examiner has concluded that the subject matter defined in instant claims 1-6 is supported by the disclosure in provisional application serial no. 63/268,745. However, the ‘745 provisional does not appear to disclose the N888G mutation recited in claim 7. Thus, the priority date of claims 1-6 is 03/01/2022 and that of claim 7 is 03/01/2023. Drawings The drawings are objected to because there has been no granted petition to include color drawings in this application. Corrected drawing sheets in compliance with 37 CFR 1.121(d) are required in reply to the Office action to avoid abandonment of the application. Any amended replacement drawing sheet should include all of the figures appearing on the immediate prior version of the sheet, even if only one figure is being amended. The figure or figure number of an amended drawing should not be labeled as “amended.” If a drawing figure is to be canceled, the appropriate figure must be removed from the replacement sheet, and where necessary, the remaining figures must be renumbered and appropriate changes made to the brief description of the several views of the drawings for consistency. Additional replacement sheets may be necessary to show the renumbering of the remaining figures. Each drawing sheet submitted after the filing date of an application must be labeled in the top margin as either “Replacement Sheet” or “New Sheet” pursuant to 37 CFR 1.121(d). If the changes are not accepted by the examiner, the applicant will be notified and informed of any required corrective action in the next Office action. The objection to the drawings will not be held in abeyance. Figures 1, 3, 4, 6, 7 and 9-13 contain color drawings. Color photographs and color drawings are not accepted in utility applications unless a petition filed under 37 CFR 1.84(a)(2) is granted. Any such petition must be accompanied by the appropriate fee set forth in 37 CFR 1.17(h), one set of color drawings or color photographs, as appropriate, if submitted via the USPTO patent electronic filing system or three sets of color drawings or color photographs, as appropriate, if not submitted via the via USPTO patent electronic filing system, and, unless already present, an amendment to include the following language as the first paragraph of the brief description of the drawings section of the specification: The patent or application file contains at least one drawing executed in color. Copies of this patent or patent application publication with color drawing(s) will be provided by the Office upon request and payment of the necessary fee. Color photographs will be accepted if the conditions for accepting color drawings and black and white photographs have been satisfied. See 37 CFR 1.84(b)(2). More specifically, 37 C.F.R. 1.84(a)(2) states: . . . On rare occasions, color drawings may be necessary as the only practical medium by which to disclose the subject matter sought to be patented in a utility patent application…The Office will accept color drawings in utility patent applications only after granting a petition filed under this paragraph explaining why the color drawings are necessary. Any such petition must include the following: (i) The fee set forth in § 1.17(h); (ii) One (1) set of color drawings if submitted via the Office electronic filing system, or three (3) sets of color drawings if not submitted via the Office electronic filing system; and (iii) An amendment to the specification to insert (unless the specification contains or has been previously amended to contain) the following language as the first paragraph of the brief description of the drawings: The patent or application file contains at least one drawing executed in color. Copies of this patent or patent application publication with color drawing(s) will be provided by the Office upon request and payment of the necessary fee. (Emphases added.) MPEP 608.02, part VIII, states: Color drawings and color photographs are not accepted in utility applications filed under 35 U.S.C. 111 unless a petition filed under 37 CFR 1.84(a)(2) or (b)(2) is granted. Color drawings and color photographs are not permitted in international applications (see PCT Rule 11.13 ). Unless a petition is filed and granted, color drawings or color photographs will not be accepted in a utility patent application filed under 35 U.S.C. 111. The examiner must object to the color drawings or color photographs as being improper and require applicant either to cancel the drawings or to provide substitute black and white drawings. Claim Rejections - 35 USC § 112(b) The following is a quotation of 35 U.S.C. 112(b): (b) CONCLUSION.—The specification shall conclude with one or more claims particularly pointing out and distinctly claiming the subject matter which the inventor or a joint inventor regards as the invention. The following is a quotation of 35 U.S.C. 112 (pre-AIA ), second paragraph: The specification shall conclude with one or more claims particularly pointing out and distinctly claiming the subject matter which the applicant regards as his invention. Claims 2-7 are rejected under 35 U.S.C. 112(b) or 35 U.S.C. 112 (pre-AIA ), second paragraph, as being indefinite for failing to particularly point out and distinctly claim the subject matter which the inventor or a joint inventor (or for applications subject to pre-AIA 35 U.S.C. 112, the applicant), regards as the invention. Claim 1 recites a Cas9 protein comprising SEQ ID NOs: 3 or 4 with mutations(s) at residues 888, 889, 988 or 989. The transitional term “comprising” in this context is interpreted as meaning that the Cas9 protein must share 100% sequence identity to either SEQ ID NO: 3 or SEQ ID NO: 4, however, it may also include additional residues outside of the recited sequences, for instance, at the N- or C-terminus. Claims 2-7 depend from claim 1 and recite the following sequences that comprise the following substitutions, respectively: Sequence Description 40 E782K, N888Q, N968K & R1015H mutations – shares >99% identity with SEQ ID NO: 4 and ~7% identity with SEQ ID NO: 3 41 E782K, N888Q, A889S, N968K & R1015H mutations – shares >99% identity with SEQ ID NO: 4 and ~7% identity with SEQ ID NO: 3 42 E782K, N888H, A889Q, N968K & R1015H mutations – shares > 99% identity with SEQ ID NO: 4 and ~7% identity with SEQ ID NO: 3 43 E782K, N888S, A889Q, N968K, R1015H mutations – shares > 99% identity with SEQ ID NO: 4 and ~7% identity with SEQ ID NO: 3 44 E782K, N888R, A889Q, N968K & R1015H mutations – shares > 99% identity with SEQ ID NO: 4and ~7% identity with SEQ ID NO: 3 50 E782K N888G, N968K & R1015H mutations – shares > 99% identity with SEQ ID NO: 4 and ~7% identity with SEQ ID NO: 3 The sequences listed in dependent claims 2-7 recite substitutions other than those recited in claim 1, therefore it is not clear whether the sequences recited in claims 2-7 comprise the full sequence of SEQ ID NO: 4 with the exception of residues 888, 889, 988 and 989. For instance, one skilled in the art would not be able to determine whether a Cas9 sharing the N888Q mutation with SEQ ID NO; 40, but not the E782K, N968K and R1015H mutations would be infringing upon the claimed protein. Furthermore, claims 2-7 are confusing because the sequences recited therein share only about 7% sequence identity with SEQ ID NO: 3. The claims must particularly point out and distinctly define the metes and bounds of the subject matter that will be protected by the patent grant (see MPEP 2171). Finally, SEQ ID NOs: 40-44 and 50 comprise the mutations listed in the respective claims, i.e., SEQ ID NO: 40 comprises the N888Q mutation recited in claim 2; SEQ ID NO: 41 recites the N888Q and A889S mutations recited in claim 3; etc. The wording “wherein the mutation at residue” in claims 2-7 is confusing because it suggests that the recited mutation is in addition to each of the recited sequences, when in fact, the recited mutations are already incorporated in the sequences. Claim Rejections - 35 USC § 112(d) The following is a quotation of 35 U.S.C. 112(d): (d) REFERENCE IN DEPENDENT FORMS.—Subject to subsection (e), a claim in dependent form shall contain a reference to a claim previously set forth and then specify a further limitation of the subject matter claimed. A claim in dependent form shall be construed to incorporate by reference all the limitations of the claim to which it refers. The following is a quotation of pre-AIA 35 U.S.C. 112, fourth paragraph: Subject to the following paragraph [i.e., the fifth paragraph of pre-AIA 35 U.S.C. 112], a claim in dependent form shall contain a reference to a claim previously set forth and then specify a further limitation of the subject matter claimed. A claim in dependent form shall be construed to incorporate by reference all the limitations of the claim to which it refers. Claims 2-7 are rejected under 35 U.S.C. 112(d) or pre-AIA 35 U.S.C. 112, 4th paragraph, as being of improper dependent form for failing to further limit the subject matter of the claim upon which it depends, or for failing to include all the limitations of the claim upon which it depends. Claim 1 recites a Cas9 protein comprising SEQ ID NO: 3 or SEQ ID NO: 4. Claims 2-7 depend from claim 1 and recite the following sequences that comprise the following substitutions, respectively: Sequence Description 40 E782K, N888Q, N968K & R1015H mutations – shares >99% identity with SEQ ID NO: 4 and ~7% identity with SEQ ID NO: 3 41 E782K, N888Q, A889S, N968K & R1015H mutations – shares >99% identity with SEQ ID NO: 4 and ~7% identity with SEQ ID NO: 3 42 E782K, N888H, A889Q, N968K & R1015H mutations – shares > 99% identity with SEQ ID NO: 4 and ~7% identity with SEQ ID NO: 3 43 E782K, N888S, A889Q, N968K, R1015H mutations – shares > 99% identity with SEQ ID NO: 4 and ~7% identity with SEQ ID NO: 3 44 E782K, N888R, A889Q, N968K & R1015H mutations – shares > 99% identity with SEQ ID NO: 4and ~7% identity with SEQ ID NO: 3 50 E782K N888G, N968K & R1015H mutations – shares > 99% identity with SEQ ID NO: 4 and ~7% identity with SEQ ID NO: 3 The sequences listed in dependent claims 2-7 recite substitutions other than those recited in claim 1. In addition, the dependent claims share only about 7% sequence identity with SEQ ID NO: 3. Therefore, the dependent claims do not properly limit the claims upon which they depend. Applicant may cancel the claims, amend the claims to place them in proper dependent form, rewrite the claims in independent form, or present a sufficient showing that the dependent claims comply with the statutory requirements. Notice for all US Patent Applications filed on or after March 16, 2013: In the event the determination of the status of the application as subject to AIA 35 U.S.C. 102 and 103 (or as subject to pre-AIA 35 U.S.C. 102 and 103) is incorrect, any correction of the statutory basis (i.e., changing from AIA to pre-AIA ) for the rejection will not be considered a new ground of rejection if the prior art relied upon, and the rationale supporting the rejection, would be the same under either status. Claim Rejections - 35 USC § 102 The following is a quotation of the appropriate paragraphs of 35 U.S.C. 102 that form the basis for the rejections under this section made in this Office action: A person shall be entitled to a patent unless – (a)(1) the claimed invention was patented, described in a printed publication, or in public use, on sale, or otherwise available to the public before the effective filing date of the claimed invention. Claims 1-3 are rejected under 35 U.S.C. 102(a)(1) as being anticipated by Nureki et al. (WO2019049913A1, published 03/14/2019; in Japanese, English equivalent published as US20210163907). Nureki et al. teach the Cas9 protein comprising instant SEQ ID NO: 4. See the alignment between SEQ ID NO: 2 of Nureki and colleagues and instant SEQ ID NO: 4 in the APPENDIX. Nureki et al. contemplate mutations at the 888 and 889 positions (see paragraphs [0025]; [0034]; [0043]; [0076]; [0091]-[0092] and claims 1, 6, 8 and 13 of the English equivalent), thereby meeting the limitation of claim 1. For instance, Nureki et al. teach that the asparagine (N) at residue 888 of Cas9 may be substituted with a glutamine or Q (paragraph [0076] of the English equivalent). Further, Nureki et al. teach that the alanine at residue 889 may be substituted with serine or S (paragraph [0092] of the English equivalent), thereby meeting the limitations of claims 2 and 3. Incidentally, Nureki et al. teach substitutions at the 988 position (see paragraphs [0108]-[0113]; claims 1, 6, 8 and 13 of the English equivalent). Claim Rejections - 35 USC § 103 The following is a quotation of 35 U.S.C. 103 which forms the basis for all obviousness rejections set forth in this Office action: A patent for a claimed invention may not be obtained, notwithstanding that the claimed invention is not identically disclosed as set forth in section 102, if the differences between the claimed invention and the prior art are such that the claimed invention as a whole would have been obvious before the effective filing date of the claimed invention to a person having ordinary skill in the art to which the claimed invention pertains. Patentability shall not be negated by the manner in which the invention was made. The factual inquiries for establishing a background for determining obviousness under 35 U.S.C. 103 are summarized as follows: 1. Determining the scope and contents of the prior art. 2. Ascertaining the differences between the prior art and the claims at issue. 3. Resolving the level of ordinary skill in the pertinent art. 4. Considering objective evidence present in the application indicating obviousness or nonobviousness. This application currently names joint inventors. In considering patentability of the claims the examiner presumes that the subject matter of the various claims was commonly owned as of the effective filing date of the claimed invention(s) absent any evidence to the contrary. Applicant is advised of the obligation under 37 CFR 1.56 to point out the inventor and effective filing dates of each claim that was not commonly owned as of the effective filing date of the later invention in order for the examiner to consider the applicability of 35 U.S.C. 102(b)(2)(C) for any potential 35 U.S.C. 102(a)(2) prior art against the later invention. Claims 1-7 are rejected under 35 U.S.C. 103 as being unpatentable over Nureki et al. (WO2019049913A1, published 03/14/2019; in Japanese, English equivalent published as US20210163907) in view of Cong (WO2020219908). The first factor to consider when making a rejection under 35 U.S.C. 103(a) is to determine the scope and contents of the prior art. Nureki et al. teach the Cas9 protein comprising instant SEQ ID NO: 4. See the alignment between SEQ ID NO: 2 of Nureki and colleagues and instant SEQ ID NO: 4 in the APPENDIX. Nureki et al. contemplate mutations at the 888 and 889 positions (see paragraphs [0025]; [0034]; [0043]; [0076]; [0091]-[0092] and claims 1, 6, 8 and 13 of the English equivalent), thereby meeting the limitation of claim 1. For instance, Nureki et al. teach that residue 888 of Cas9 may be substituted “with an amino acid selected from the group consisting of lysine (K), arginine (R), asparagine (N), glutamine (Q), histidine (H) and serine (S)”, thereby meeting the limitation of claim 2 (paragraph [0076] of the English equivalent). Further, Nureki et al. teach that residue 889 may be substituted “with asparagine (N), serine (S), lysine (K), arginine (R) or histidine (H)” (paragraph [0092] of the English equivalent), thereby meeting the limitations of claims 2 and 3. Incidentally, Nureki et al. teach substitutions at the 988 position (see paragraphs [0108]-[0113]; claims 1, 6, 8 and 13 of the English equivalent). The second factor to consider is to ascertain the differences between the prior art and the instant claims. While Nureki et al. teach that the Cas9 protein may have a substitution at residue 888 of N to Q, N to H, N to S and N to R, and a substitution at residue 889 of A to S, they do not teach residue 889 may have a substitution from A to Q. Further, Nureki et al. do not teach residue 888 has a substitution from N to G. Cong teaches making substitutions at residues 888 and 889 of Cas9 (see paragraph [0053]). In addition, Cong teaches certain substitutions within amino acid types may be made (see paragraph [0046]): [T]he variant SaCas9 protein comprises the amino acid sequence of SEQ ID NO: 1, but further comprises a substitution of one or more amino acid residues…An amino acid “replacement” or “substitution” refers to the replacement of one amino acid at a given position or residue by another amino acid at the same position or residue within a polypeptide sequence. Amino acids are broadly grouped as “aromatic” or “aliphatic”…Examples of “aliphatic” amino acids include glycine (G or Gly), alanine (A or Ala), valine (V or Val), leucine (L or Leu), isoleucine (I or Ile), methionine (M or Met), serine (S or Ser), threonine (T or Thr), cysteine (C or Cys), proline (P or Pro), glutamic acid (E or Glu), aspartic acid (A or Asp), asparagine (N or Asn), glutamine (Q or Gln), lysine (K or Lys), and arginine (R or Arg). Therefore, Cong suggests the alanine (A) at residue 889 could be substituted with another aliphatic amino acid, glutamine or Q. Further, Cong suggests that the glutamine (N) at residue 888 could be substituted with another aliphatic amino acid, glycine (G). As noted above, Nureki et al. teach that residue 889 may be substituted with asparagine or N. According to Cong, asparagine and glutamine (Q) are conservative substitutions, meaning that the amino acids have common properties (see paragraphs [0049]-[0050]). It would have been obvious to the person of ordinary skill in the art at the time the invention was made to modify the teachings of Nureki et al. by making the substitutions of aliphatic amino acids for other aliphatic amino acids because it represents a conventional combinatorial mutation or substitution selected from a finite list of options. Nureki et al. disclose that amino acid substitution (along with deletion or addition) was a well-known and conventional technique (see paragraph [0099]). The person of ordinary skill in the art would have been motivated to make the substitution because there is a general motivation to optimize protein activity and function in the art and there are a limited number of aliphatic amino acids. See paragraph [0073] of Cong: Molecular dynamic simulation allows for the identification of potential amino acid substitutions in a Cas9 protein that may alter (e.g., improve or broaden) PAM specificity. Thus, following molecularly simulating binding of one or more mutant Cas9 proteins to a desired PAM sequence: the method comprises synthetically generating one or more mutant Cas9 proteins that bind to the desired PAM sequence in the simulation of (a). The one or more mutant Cas9 proteins may be synthetically generated using recombinant DNA techniques and/or in vitro protein synthesis methods known in the art (see, e.g., Sambrook et al., supra)…For example, mutations may be introduced into a nucleic acid sequence encoding a wild-type Cas9 protein randomly or in a site-specific manner. Random mutations may be generated, for example, by error-prone PCR of a Cas9 template sequence. The person of ordinary skill in the art could have reasonably expected success because he or she would be choosing from a finite number of identified predictable solutions and has good reason to pursue the known options within his or her technical grasp (see paragraph [0073] of Cong, above). Thus, the claims do not contribute anything non-obvious over the prior art. Conclusion No claim is allowed. Any inquiry concerning this communication or earlier communications from the examiner should be directed to CHRISTINA M BORGEEST whose telephone number is (571)272-4482. The examiner can normally be reached M-F 9-5:30 EDT. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Jeffrey Stucker can be reached at 5712720911. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /CHRISTINA M BORGEEST/Primary Examiner, Art Unit 1675 APPENDIX Query Match 100.0%; Score 5433; DB 1; Length 1053; Best Local Similarity 100.0%; Matches 1053; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 MKRNYILGLDIGITSVGYGIIDYETRDVIDAGVRLFKEANVENNEGRRSKRGARRLKRRR 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MKRNYILGLDIGITSVGYGIIDYETRDVIDAGVRLFKEANVENNEGRRSKRGARRLKRRR 60 Qy 61 RHRIQRVKKLLFDYNLLTDHSELSGINPYEARVKGLSQKLSEEEFSAALLHLAKRRGVHN 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 RHRIQRVKKLLFDYNLLTDHSELSGINPYEARVKGLSQKLSEEEFSAALLHLAKRRGVHN 120 Qy 121 VNEVEEDTGNELSTKEQISRNSKALEEKYVAELQLERLKKDGEVRGSINRFKTSDYVKEA 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 VNEVEEDTGNELSTKEQISRNSKALEEKYVAELQLERLKKDGEVRGSINRFKTSDYVKEA 180 Qy 181 KQLLKVQKAYHQLDQSFIDTYIDLLETRRTYYEGPGEGSPFGWKDIKEWYEMLMGHCTYF 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 KQLLKVQKAYHQLDQSFIDTYIDLLETRRTYYEGPGEGSPFGWKDIKEWYEMLMGHCTYF 240 Qy 241 PEELRSVKYAYNADLYNALNDLNNLVITRDENEKLEYYEKFQIIENVFKQKKKPTLKQIA 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 PEELRSVKYAYNADLYNALNDLNNLVITRDENEKLEYYEKFQIIENVFKQKKKPTLKQIA 300 Qy 301 KEILVNEEDIKGYRVTSTGKPEFTNLKVYHDIKDITARKEIIENAELLDQIAKILTIYQS 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 KEILVNEEDIKGYRVTSTGKPEFTNLKVYHDIKDITARKEIIENAELLDQIAKILTIYQS 360 Qy 361 SEDIQEELTNLNSELTQEEIEQISNLKGYTGTHNLSLKAINLILDELWHTNDNQIAIFNR 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 SEDIQEELTNLNSELTQEEIEQISNLKGYTGTHNLSLKAINLILDELWHTNDNQIAIFNR 420 Qy 421 LKLVPKKVDLSQQKEIPTTLVDDFILSPVVKRSFIQSIKVINAIIKKYGLPNDIIIELAR 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 421 LKLVPKKVDLSQQKEIPTTLVDDFILSPVVKRSFIQSIKVINAIIKKYGLPNDIIIELAR 480 Qy 481 EKNSKDAQKMINEMQKRNRQTNERIEEIIRTTGKENAKYLIEKIKLHDMQEGKCLYSLEA 540 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 481 EKNSKDAQKMINEMQKRNRQTNERIEEIIRTTGKENAKYLIEKIKLHDMQEGKCLYSLEA 540 Qy 541 IPLEDLLNNPFNYEVDHIIPRSVSFDNSFNNKVLVKQEENSKKGNRTPFQYLSSSDSKIS 600 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 541 IPLEDLLNNPFNYEVDHIIPRSVSFDNSFNNKVLVKQEENSKKGNRTPFQYLSSSDSKIS 600 Qy 601 YETFKKHILNLAKGKGRISKTKKEYLLEERDINRFSVQKDFINRNLVDTRYATRGLMNLL 660 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 601 YETFKKHILNLAKGKGRISKTKKEYLLEERDINRFSVQKDFINRNLVDTRYATRGLMNLL 660 Qy 661 RSYFRVNNLDVKVKSINGGFTSFLRRKWKFKKERNKGYKHHAEDALIIANADFIFKEWKK 720 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 661 RSYFRVNNLDVKVKSINGGFTSFLRRKWKFKKERNKGYKHHAEDALIIANADFIFKEWKK 720 Qy 721 LDKAKKVMENQMFEEKQAESMPEIETEQEYKEIFITPHQIKHIKDFKDYKYSHRVDKKPN 780 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 721 LDKAKKVMENQMFEEKQAESMPEIETEQEYKEIFITPHQIKHIKDFKDYKYSHRVDKKPN 780 Qy 781 RELINDTLYSTRKDDKGNTLIVNNLNGLYDKDNDKLKKLINKSPEKLLMYHHDPQTYQKL 840 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 781 RELINDTLYSTRKDDKGNTLIVNNLNGLYDKDNDKLKKLINKSPEKLLMYHHDPQTYQKL 840 Qy 841 KLIMEQYGDEKNPLYKYYEETGNYLTKYSKKDNGPVIKKIKYYGNKLNAHLDITDDYPNS 900 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 841 KLIMEQYGDEKNPLYKYYEETGNYLTKYSKKDNGPVIKKIKYYGNKLNAHLDITDDYPNS 900 Qy 901 RNKVVKLSLKPYRFDVYLDNGVYKFVTVKNLDVIKKENYYEVNSKCYEEAKKLKKISNQA 960 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 901 RNKVVKLSLKPYRFDVYLDNGVYKFVTVKNLDVIKKENYYEVNSKCYEEAKKLKKISNQA 960 Qy 961 EFIASFYNNDLIKINGELYRVIGVNNDLLNRIEVNMIDITYREYLENMNDKRPPRIIKTI 1020 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 961 EFIASFYNNDLIKINGELYRVIGVNNDLLNRIEVNMIDITYREYLENMNDKRPPRIIKTI 1020 Qy 1021 ASKTQSIKKYSTDILGNLYEVKSKKHPQIIKKG 1053 ||||||||||||||||||||||||||||||||| Db 1021 ASKTQSIKKYSTDILGNLYEVKSKKHPQIIKKG 1053
Read full office action

Prosecution Timeline

Mar 01, 2023
Application Filed
Sep 22, 2026
Non-Final Rejection mailed — §102, §103, §112 (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12747282
Process for Preparing Immunoglobulin Compositions
4y 5m to grant Granted Sep 29, 2026
Patent 12742764
METHODS FOR PREDICTING CANCER DRUG RESPONSIVENESS
6y 2m to grant Granted Sep 22, 2026
Patent 12742012
HUMANIZED ANTI-TRKA ANTIBODIES AND USES THEREOF
4y 0m to grant Granted Sep 22, 2026
Patent 12723070
ANTIBODY SPECIFICALLY BINDING TO STREP-TAG II TAG AND USE THEREOF
3y 2m to grant Granted Sep 01, 2026
Patent 12715908
TAU EPITOPE AND BINDING MOLECULES
4y 8m to grant Granted Aug 25, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

Strategy Recommendation AI-generated — please review before filing

Get a prosecution strategy drawn from examiner precedents, rejection analysis, and claim mapping.
Typically takes 5-10 seconds — AI-generated, attorney review required before filing

Prosecution Projections

1-2
Expected OA Rounds
56%
Grant Probability
77%
With Interview (+21.4%)
3y 2m (~0m remaining)
Median Time to Grant
Low
PTA Risk
Based on 725 resolved cases by this examiner. Grant probability derived from career allowance rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month