Prosecution Insights
Last updated: July 28, 2026
Application No. 18/247,235

PARTICLE BASED FORMULATION OF SARS-COV-2 RECEPTOR BINDING DOMAIN

Non-Final OA §103
Filed
Mar 29, 2023
Priority
Sep 30, 2020 — provisional 63/085,734 +2 more
Examiner
CHANDRA, GYAN
Art Unit
1674
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
The Research Foundation for the State University of New York
OA Round
1 (Non-Final)
71%
Grant Probability
Favorable
1-2
OA Rounds
0m
Est. Remaining
99%
With Interview

Examiner Intelligence

Grants 71% — above average
71%
Career Allowance Rate
707 granted / 994 resolved
+11.1% vs TC avg
Strong +28% interview lift
Without
With
+27.6%
Interview Lift
resolved cases with interview
Typical timeline
2y 6m
Avg Prosecution
40 currently pending
Career history
1027
Total Applications
across all art units

Statute-Specific Performance

§101
3.0%
-37.0% vs TC avg
§103
40.6%
+0.6% vs TC avg
§102
8.8%
-31.2% vs TC avg
§112
20.5%
-19.5% vs TC avg
Black line = Tech Center average estimate • Based on career data from 994 resolved cases

Office Action

§103
DETAILED ACTION Notice of Pre-AIA or AIA Status The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . Election/Restrictions Applicant’s election without traverse of Group 1 (claims 1-13) in the reply filed on 3/2/2026 is acknowledged. The examiner confirmed with the attorney of record, John DiMaio, that claim 14 belongs to Group 2. The requirement is still deemed proper and is therefore made FINAL. Status of Application, Amendments, And/Or Claims Claims 1-41 are pending. Claims 14-41 are withdrawn for being drawn to non-elected inventions (i.e., Group 2-3). Claims 1-13 are under consideration. Priority The instant application is a 371 of PCT/US21/52907 filed on 9/30/2021. Information Disclosure Statement The Information Disclosure Statements (IDSs) filed on 3/29/2023 and 11/26/2024 have been considered. Claim Objections Claims 1 and 10 is objected to because of the following informalities: claim 1 is objected for the use of an abbreviated phrase (SARS-CoV-2) and claim 10 is objected for the use of an abbreviated phrase (QS21), which should be described for the first time followed by an abbreviated form placed in a bracket. . Appropriate correction is required. Claim Rejections - 35 USC § 103 The following is a quotation of 35 U.S.C. 103 which forms the basis for all obviousness rejections set forth in this Office action: A patent for a claimed invention may not be obtained, notwithstanding that the claimed invention is not identically disclosed as set forth in section 102, if the differences between the claimed invention and the prior art are such that the claimed invention as a whole would have been obvious before the effective filing date of the claimed invention to a person having ordinary skill in the art to which the claimed invention pertains. Patentability shall not be negated by the manner in which the invention was made. The factual inquiries for establishing a background for determining obviousness under 35 U.S.C. 103 are summarized as follows: 1. Determining the scope and contents of the prior art. 2. Ascertaining the differences between the prior art and the claims at issue. 3. Resolving the level of ordinary skill in the pertinent art. 4. Considering objective evidence present in the application indicating obviousness or nonobviousness. Claim(s) 1-13 are rejected under 35 U.S.C. 103 as being unpatentable over Lovell et al. (IDS, US Pub. No. 2018/0085473) in view of Babb et al. (IDS, US Patent No. 10,787,501). The instantly claimed invention is broadly drawn to a method for generating neutralizing antibodies against SARS-CoV-2 virus in subject comprising administering to the subject a vaccine composition comprising: a) liposomes comprising i) a bilayer, wherein the bilayer comprises phospholipid, and porphyrin having cobalt coordinated thereto forming cobalt-porphyrin; and ii) a polyhistidine- tagged amino acid sequence of receptor-binding-domain (RBD) of Spike protein from SARS- CoV-2, wherein at least a portion of the polyhistidine tag resides in the hydrophobic portion of the bilayer and one or more histidines of the polyhistidine tag are coordinated to the cobalt in the cobalt-porphyrin, and wherein at least a portion of the amino acid sequence is exposed to the outside of the liposome; and b) a pharmaceutical carrier(claim 1), wherein the RBD has a sequence depicted as SEQ ID NO: 1 or a variant thereof which has at least 90% identity with the sequence of SEQ ID NO: 1 (claim 2), wherein the cobalt porphyrin is conjugated to a phospholipid to form a cobalt porphyrin-phospholipid conjugate (claim 3), wherein the cobalt porphyrin-phospholipid conjugate makes up from 0.1 to 25 mol % of the bilayer (claim 4), wherein the cobalt porphyrin-phospholipid conjugate makes up from 5 to 10 mol % of the bilayer (claim 5), wherein the bilayer further comprises cholesterol (claim 6), wherein the polyhistidine-tag comprises 6 to 10 histidine residues (claim 7), wherein size of the liposome is 50 nm to 200 nm (claim 8), wherein the liposomes further comprise one or more adjuvants (claim 9), wherein the one or more adjuvants are attenuated lipid A derivatives, phosphorylated hexaacyl disaccharides, and/or QS21 (claim 10). The method of claim 1, further comprising one or more adjuvants which are not associated with the liposomes (claim 11). The method of claim 1, wherein the subject is a human (claim 12), and wherein the composition is administered multiple times (claim 13). Regarding claim 1, Lovell et al. teach a method for generating neutralizing antibodies against a virus in subject comprising administering to the subject a vaccine composition (claim 19 "A method for generating an immune response in a host individual comprising administering to the individual"; and paragraph [0125] - "Many of the monoclonal antibodies that broadly neutralize HIV viral entry, such as 2F5, Z13 and 4E10, target a conserved linear epitope in the membrane proximal external region (MPER) of the gp41 envelope protein, making the MPER a prime target for HIV peptide vaccines") comprising: a. liposomes (claim 19 "a composition comprising the liposomes of claim 1"; claim 1 teaches "A liposome comprising i) a bilayer, wherein the bilayer comprises phospholipid, and porphyrin having cobalt coordinated thereto forming cobalt-porphyrin (claim 1 "a) a bilayer, wherein the bilayer comprises: i) phospholipid, and ii) porphyrin having cobalt coordinated thereto forming cobalt-porphyrin"); and b) a polyhistidine-tagged presentation molecule wherein at least a portion of the polyhistidine tag resides in the hydrophobic portion of the monolayer or the bilayer and one or more histidines of the polyhistidine tag are coordinated to the cobalt in the cobalt-porphyrin, wherein at least a portion of the polyhistidine-tagged presentation molecule is exposed to the outside of the liposome". Regarding claims 3-4, Lovell et al. teach cobalt- phospholipid conjugate that makes 1 to 25% of the monolayer or the bilayer (claims 2-3). Regarding claim 5, Lovell et al. teach that cobalt porphyrin-phospholipid conjugate makes up from 5 to 10% of the monolayer or the bilayer (see claim 4). Regarding claim 6, Lovell et at teach that phospholipid further comprises cholesterol (see claim 5) Regarding claim 7, Lovell et al teach having a polyhistidine-tag of 6-10 residues. Regarding claim 8, Lovell et al teach a liposome having a size of 50 to 200 nm (see claim 8). Regarding claim 9, Lovell et al. teach that bilayer further comprises an adjuvant comprises therein (see claim 19). Regarding claim 12, Lovell et al teach that subject is a human (see claim 18). Regarding claim 13, Lovell suggests that the administration of a composition can be a single administration or multiple administration (see paragraph [0075]). Lovel et al. do not teach that the neutralizing antibody is against SARS-CoV-2 virus, wherein the receptor binding-domain (RBD) of spike protein is histidine tagged, wherein at least a portion or the polyhistidine tag residues in the hydrophobic portion of the bilayer and one or more histidine of the polyhistidine tag are coordinating tag are coordinated to the cobalt in the cobalt porphyrin. Babb et al. disclose antibodies and antigen-binding fragments thereof that bind specifically to a coronavirus spike protein and methods of using such antibodies and fragments for treating or preventing viral infections (abstract); comprising SARS-CoV-2 (claim 1 "An isolated antibody or antigen-binding fragment thereof that binds a SARS-CoV-2 spike protein") and amino acid sequence of receptor-binding- domain (RBD) of Spike protein from SARS-CoV-2 (claim 1 "An isolated antibody or antigen-binding fragment thereof that binds a SARS-CoV-2 spike protein"; col 72, In 14-15 (see search results 10 below). RESULT 10 US-16-912-678-829 (NOTE: this sequence has 5 duplicates in the database searched) Sequence 829, US/16912678 Patent No. 10787501 GENERAL INFORMATION APPLICANT: Regeneron Pharmaceuticals, Inc. TITLE OF INVENTION: ANTI-SARS-COV-2-SPIKE GLYCOPROTEIN TITLE OF INVENTION: ANTIBODIES AND ANTIGEN-BINDING FRAGMENTS FILE REFERENCE: 10753US01 CURRENT APPLICATION NUMBER: US/16/912,678 CURRENT FILING DATE: 2020-06-25 NUMBER OF SEQ ID NOS: 850 SEQ ID NO 829 LENGTH: 251 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: Synthetic Query Match 100.0%; Score 1211; Length 251; Best Local Similarity 100.0%; Matches 223; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFK 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFK 60 Qy 61 CYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNS 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 CYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNS 120 Qy 121 NNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQ 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 NNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQ 180 Qy 181 PTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF 223 ||||||||||||||||||||||||||||||||||||||||||| Db 181 PTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF 223 Therefore, it would have been prima facie obvious at the time of invention was made to use SARS-CoV-2 spike protein as taught by Babb et al to generate antibodies to generate an immune response in a host individual as taught by Lovell et al. Additionally, it would have been motivating to one of ordinary skill in the art because the SARS-CoV-2 spike protein of Babb et al would have been combined with the method of Lovell et al to provide a vaccine with greater efficacy than an antibody alone. Further, one would have a reasonable expectation of success in using an antigen having RBD polypeptide having amino acid sequence of 100% sequence identity to SEQ ID NO: 1 as taught by Babb et al to raise antibodies as a vaccine as taught by Lovell et al. Therefore, it would have been obvious to one ordinary skill in the art over the combined teachings of the prior art. Conclusion No claim is allowed. Any inquiry concerning this communication or earlier communications from the examiner should be directed to GYAN CHANDRA whose telephone number is (571)272-2922. The examiner can normally be reached Mon-Friday 8:30AM-5:00P. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Vanessa Ford can be reached at 571-272-0857. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /GYAN CHANDRA/Primary Examiner, Art Unit 1674
Read full office action

Prosecution Timeline

Mar 29, 2023
Application Filed
May 06, 2026
Non-Final Rejection mailed — §103 (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12685760
IL2 MUTEINS
4y 1m to grant Granted Jul 21, 2026
Patent 12679878
CRF2 RECEPTOR AGONISTS AND THEIR USE IN THERAPY
3y 4m to grant Granted Jul 14, 2026
Patent 12653865
DUAL-AGONIST COMPOUND FOR BOTH GLP-1 AND GIP RECEPTORS AND APPLICATION THEREOF
3y 6m to grant Granted Jun 16, 2026
Patent 12642851
SELF-ASSEMBLING NANOPARTICLES
1y 3m to grant Granted Jun 02, 2026
Patent 12636339
HYDROLYZED COLLAGEN FOR USE IN REDUCING BLOOD GLUCOSE
1y 5m to grant Granted May 26, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

Strategy Recommendation AI-generated — please review before filing

Get a prosecution strategy drawn from examiner precedents, rejection analysis, and claim mapping.
Typically takes 5-10 seconds — AI-generated, attorney review required before filing

Prosecution Projections

1-2
Expected OA Rounds
71%
Grant Probability
99%
With Interview (+27.6%)
2y 6m (~0m remaining)
Median Time to Grant
Low
PTA Risk
Based on 994 resolved cases by this examiner. Grant probability derived from career allowance rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month