Prosecution Insights
Last updated: April 19, 2026
Application No. 18/248,865

NOVEL PIGGYBAC TRANSPOSON SYSTEM AND USE THEREOF

Non-Final OA §103§112
Filed
Apr 12, 2023
Examiner
HOLLAND, PAUL J
Art Unit
1656
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
Shanghai Juncell Therapeutics Co. Ltd.
OA Round
1 (Non-Final)
58%
Grant Probability
Moderate
1-2
OA Rounds
3y 1m
To Grant
99%
With Interview

Examiner Intelligence

Grants 58% of resolved cases
58%
Career Allow Rate
439 granted / 764 resolved
-2.5% vs TC avg
Strong +65% interview lift
Without
With
+65.3%
Interview Lift
resolved cases with interview
Typical timeline
3y 1m
Avg Prosecution
55 currently pending
Career history
819
Total Applications
across all art units

Statute-Specific Performance

§101
8.0%
-32.0% vs TC avg
§103
31.6%
-8.4% vs TC avg
§102
18.6%
-21.4% vs TC avg
§112
29.5%
-10.5% vs TC avg
Black line = Tech Center average estimate • Based on career data from 764 resolved cases

Office Action

§103 §112
DETAILED CORRESPONDENCE Application Status 1. The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . 2. Applicants’ amendment to the claims filed on 12/29/2025 in response to the restriction requirement mailed on 11/03/2025 is acknowledged. This listing of claims replaces all prior listings of claims in the application. 3. Claims 1-8 and 10-21 are pending. Election/Restrictions 4. Applicant’s election without traverse of Group I, claims 1-8 and 12-20 in the reply filed on 12/29/2025 is acknowledged. 5. Claims 10-11 and 21 stand withdrawn from further consideration pursuant to 37 CFR 1.142(b) as being drawn to a nonelected invention, there being no allowable generic or linking claim. Election was made without traverse in the reply filed on 12/29/2025. Claims 1-8 and 12-20 are pending and examined on the merits. Priority 6. Acknowledgement is made of applicant’s claim for foreign priority under 35 U.S.C. 119(a)-(d) to China Patent Application No. CN202011085981.6, filing date 10/12/2020. The certified copy has been filed in the present application, filed on 04/12/2023. Information Disclosure Statement 7. The IDS filed on 05/05/2023 has been considered by the examiner and a copy of the Form PTO/SB/08 is attached to the office action. Drawings 8. The Drawings filed on 04/12/2023 are acknowledged and accepted by the examiner. Claim Rejections - 35 USC § 112(b) 9. The following is a quotation of 35 U.S.C. 112(b): (b) CONCLUSION.—The specification shall conclude with one or more claims particularly pointing out and distinctly claiming the subject matter which the inventor or a joint inventor regards as the invention. The following is a quotation of 35 U.S.C. 112 (pre-AIA ), second paragraph: The specification shall conclude with one or more claims particularly pointing out and distinctly claiming the subject matter which the applicant regards as his invention. 10. Claims 7 and 8 are rejected under 35 U.S.C. 112(b) or 35 U.S.C. 112 (pre-AIA ), second paragraph, as being indefinite for failing to particularly point out and distinctly claim the subject matter which the inventor or a joint inventor (or for applications subject to pre-AIA 35 U.S.C. 112, the applicant), regards as the invention. Regarding claims 7 and 8, there is insufficient antecedent basis for the limitation “the sequence between the transposon 3’ terminal repeat sequence…” and furthermore, it is unclear what sequence between the transposon 3’ terminal repeat sequence the limitation is referring to. It is suggested that applicants clarify the meaning of the claims. Claim Rejections - 35 USC § 103 11. The following is a quotation of 35 U.S.C. 103 which forms the basis for all obviousness rejections set forth in this Office action: A patent for a claimed invention may not be obtained, notwithstanding that the claimed invention is not identically disclosed as set forth in section 102, if the differences between the claimed invention and the prior art are such that the claimed invention as a whole would have been obvious before the effective filing date of the claimed invention to a person having ordinary skill in the art to which the claimed invention pertains. Patentability shall not be negated by the manner in which the invention was made. 12. Claim(s) 1-8 and 12-20 is/are rejected under 35 U.S.C. 103 as being unpatentable over Qian et al. (US Patent Application Publication 2018/0265890 A1; cited on PTO-892 mailed on 11/03/2025) in view of Mossine et al. (PLoS One, 2013; examiner cited) and Gasanov et al. (Acta Natural, 2015; examiner cited). 13. Claims 1-6 and 12-17 are drawn to a nucleic acid construct, comprising or consisting of the following elements: a transposon 3’ terminal repeat sequence, a first polyA sequence, an insulator sequence with transcription termination function, a transposon 5’ terminal repeat sequence. Claims 7-8 and 18-20 are drawn to a host cell comprising: (1) the nucleic acid construct according to claim 1, and/or (2) the sequence between the transposon 3’ terminal repeat sequence and the transposon 5’ terminal repeat sequence of the nucleic acid construct according to claim 1. 14. With respect to claim 1, Qian et al. teach a nucleic acid construct comprising a transposon 3’ terminal repeat sequence, a first polyA signal sequence, and a transposon 5’ terminal repeat sequence [see Abstract; paragraphs 0011-0029; 0069]. With respect to claim 2, Qian et al. teach the nucleic acid construct comprising a transposon 3’ terminal repeat sequence, a first polyA signal sequence, a transposon 5’ terminal repeat sequence, a transposase encoding sequence and a promoter controlling the expression of the transposase [see Abstract; paragraphs 0011-0029; 0069]. With respect to claim 3, Qian et al. teach the nucleic acid construct comprising a transposon 3’ terminal repeat sequence, a multiple cloning insertion site, a first polyA signal sequence, a transposon 5’ terminal repeat sequence, a transposase encoding sequence and a promoter controlling the expression of the transposase [see Abstract; paragraphs 0011-0029; 0069]. With respect to claim 4, Qian et al. teach the nucleic acid construct wherein the orientation of the expression cassette of the transposase is opposite to the orientation of the expression cassette of the exogenous gene [see Abstract], wherein the transposon 3’ terminal repeat and 5’ terminal repeat is a PiggyBac transposon terminal repeat [see paragraph 0035], the transposase is a PiggyBac transposase [see paragraph 0035], the promoter is a CMV promoter, SV40 promoter, EF1a promoter, HSP70 promoter, PGK-1 promoter, b-actin promoter and GRP78 promoter [see paragraph 0046], and the transposase coding sequence contains or is operably linked to a single copy or multiple copies of a nuclear localization signal coding sequence [see paragraph 0041]. With respect to claim 5, Qian et al. teach the construct wherein the transposon 3’ terminal repeat sequence is 100% identical to SEQ ID NO: 1 [see alignment attached as APPENDIX A], the transposon 5’ terminal repeat sequence is 100% identical to SEQ ID NO: 6 [see alignment attached as APPENDIX A], the PiggyBac transposase is as shown in SEQ ID NO: 36 [see alignment attached as APPENDIX A], and the nuclear localization signal is a c-myc nuclear localization signal [see paragraph 0041]. The recitation of “as shown in” in reference to a SEQ ID NO is sufficiently broad to encompass fragments of said sequence such that the interpretation of said sequence need only share at least two contiguous nucleotides with the claimed sequence. With respect to claim 6, Qian et al. teach the nucleic acid construct wherein the nucleic acid construct comprises a sequence as shown in SEQ ID NO: 10 or 14 [see alignment attached as APPENDIX B]. The recitation of “a sequence as shown in” in reference to a SEQ ID NO is sufficiently broad to encompass fragments of said sequence such that the interpretation of said sequence need only share at least two contiguous nucleotides with the claimed sequence. With respect to claim 7, Qian et al. teach a host cell comprising the nucleic acid construct [see paragraph 0055]. With respect to claim 8, Qian et al. teach a pharmaceutical composition (medicament) comprising the nucleic acid construct and a pharmaceutically acceptable excipient [see paragraphs 0058-0060]. With respect to claim 12, Qian et al. teach the nucleic acid construct comprising a transposon 3’ terminal repeat sequence, a multiple cloning insertion site, a first polyA signal sequence, a transposon 5’ terminal repeat sequence, a transposase encoding sequence, a promoter controlling the expression of the transposase, and exogenous gene of interest [see Abstract; paragraphs 0011-0029; 0062; 0069]. With respect to claim 13, Qian et al. teach the construct wherein the transposase coding sequence and promoter controlling the expression of the transposase are outside the region between the 3’ and 5’ terminal repeat sequence [see paragraph 0017]. With respect to claim 14, Qian et al. teach the construct wherein the nucleic acid construct further comprises a multiple cloning insertion site and an exogenous gene of interest [see Abstract; paragraphs 0011-0029; 0062; 0069]. With respect to claim 15, Qian et al. teach the nucleic acid construct wherein the coding sequence of the PiggyBac transposase is as shown in SEQ ID NO: 7 and the nuclear localization signal has the sequence that is 100% identical to SEQ ID NO: 35 [see alignment attached as APPENDIX C]. The recitation of “as shown in” in reference to a SEQ ID NO is sufficiently broad to encompass fragments of said sequence such that the interpretation of said sequence need only share at least two contiguous nucleotides with the claimed sequence. With respect to claim 16, Qian et al. teach the nucleic acid construct wherein the construct is a recombinant vector [see paragraph 0050]. With respect to claim 17, Qian et al. teach the nucleic acid construct wherein the nucleic acid construct is a recombinant cloning vector or a recombinant expression vector [see paragraphs 0050-0051]. With respect to claim 18, Qian et al. teach the host cell wherein the host cell is a mammalian cell [see paragraph 0055]. With respect to claim 19, Qian et al. teach the host cell wherein the host cells are immune cells, Jurkat cell, K562 cell, embryonic stem cell, tumor cell, HEK293 cells, and CHO cell [see paragraph 0055]. With respect to claim 20, Qian et al. teach the host cell wherein the immune cell is a T cell [see paragraph 0055]. However, Qian et al. does not teach the nucleic acid construct comprising an insulator sequence with transcription termination function and the sequential order of the construct as set forth in claim 3. Mossine et al. teach a piggyBac transposon based reporter expression system wherein the most efficient and stable reporter activity was observed for combinations of transposon inverted terminal repeats and one or two cHS4 core insulators flanking the reporter construct with no detectable silencing over 10 months of continuous cell culture [see Abstract; p. 6, column 2 to p. 8, column 1], wherein the construct sequentially comprised a 3’ transposon terminal repeat, an insulator sequence and 5’- terminal repeat [see Figure 1]. Gasanov et al. teach that mammalian cell lines are widely used to produce recombinant proteins [see Abstract]. Gasanov et al. teach the use of transcription terminators from the SV40 virus, as well as human b- and g- globin genes, to prevent transcription through the transgene. The transcription terminators were shown to increase and stabilize the expression of the EGFP reporter gene in CHO cells and the combination of insulator and terminators provided an additive effect, which enhances and stabilizes transgene expression [see Abstract; p. 77-78, p. 80, column 2; Figure 2]. Before the effective filing date of the claimed invention, it would have been obvious for one of ordinary skill in the art to combine the teachings of Qian et al., Mossine et al. and Gasanov et al. to include insulator sequence with transcription termination function in the constructs of Qian et al. because Qian et al. teach nucleic acid construct comprising a transposon 3’ terminal repeat sequence, a first polyA signal sequence, and a transposon 5’ terminal repeat sequence for stable transfection and expression of exogenous genes in mammalian cells. Mossine et al. teach combinations of transposon inverted terminal repeats and one or two cHS4 core insulators flanking the reporter construct result in stable transformations and Gasanov et al. teach the combination of insulator and terminators provided an additive effect, which enhances and stabilizes transgene expression. One of ordinary skill in the art would have had a reasonable expectation of success, a reasonable level of predictability and would have been motivated to combine the teachings of Qian et al., Mossine et al. and Gasanov et al. because Mossine et al. acknowledges that combinations of transposon inverted terminal repeats and one or two cHS4 core insulators flanking the reporter construct result in stable transformations and Gasanov et al. acknowledges the combination of insulator and terminators provided an additive effect, which enhances and stabilizes transgene expression. Furthermore, it has been held that rearranging parts of an invention involves only routine skill in the art. In re Japikse, 86 USPQ 70. Therefore, the above invention would have been prima facie obvious to one of ordinary skill in the art before the effective filing date of the claimed invention. Conclusion 15. Status of the claims: Claims 1-8 and 10-21 are pending. Claims 10-11 and 21 stand withdrawn pursuant to 37 CFR 1.142(b). Claims 1-8 and 12-20 are rejected. No claims are in condition for an allowance. Any inquiry concerning this communication or earlier communications from the examiner should be directed to PAUL J HOLLAND whose telephone number is (571)270-3537. The examiner can normally be reached Monday to Friday from 8AM to 5PM. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Manjunath Rao can be reached at 571-272-0939. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /PAUL J HOLLAND/Primary Examiner, Art Unit 1656 APPENDIX A Qian et al. with SEQ ID NO: 1 ALIGNMENT: Query Match 100.0%; Score 67; Length 67; Best Local Similarity 100.0%; Matches 67; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 TTAACCCTAGAAAGATAATCATATTGTGACGTACGTTAAAGATAATCATGCGTAAAATTG 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 TTAACCCTAGAAAGATAATCATATTGTGACGTACGTTAAAGATAATCATGCGTAAAATTG 60 Qy 61 ACGCATG 67 ||||||| Db 61 ACGCATG 67 Qian et al. with SEQ ID NO: 6 ALIGNMENT: Query Match 100.0%; Score 40; Length 40; Best Local Similarity 100.0%; Matches 40; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 GCATGCGTCAATTTTACGCAGACTATCTTTCTAGGGTTAA 40 |||||||||||||||||||||||||||||||||||||||| Db 1 GCATGCGTCAATTTTACGCAGACTATCTTTCTAGGGTTAA 40 Qian et al. with SEQ ID NO: 36 Query Match 97.2%; Score 3137; DB 1; Length 604; Best Local Similarity 98.8%; Matches 597; Conservative 0; Mismatches 7; Indels 0; Gaps 0; Qy 1 MGKPKKIKTEDGSSLDDEHILSALLQSDDELVGEDSDSEVSDHVSEDDVQSDTEEAFIDE 60 || | |||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MGPAAKRVKLDGSSLDDEHILSALLQSDDELVGEDSDSEVSDHVSEDDVQSDTEEAFIDE 60 Qy 61 VHEVQPTSSGSEILDEQNVIEQPGSSLASNRILTLPQRTIRGKNKHCWSTSKPTRRSRVS 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 VHEVQPTSSGSEILDEQNVIEQPGSSLASNRILTLPQRTIRGKNKHCWSTSKPTRRSRVS 120 Qy 121 ALNIVRSQRGPTRMCRNIYDPLLCFKLFFTDEIISEIVKWTNAEISLKRRESMTSATFRD 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 ALNIVRSQRGPTRMCRNIYDPLLCFKLFFTDEIISEIVKWTNAEISLKRRESMTSATFRD 180 Qy 181 TNEDEIYAFFGILVMTAVRKDNHMSTDDLFDRSLSMVYVSVMSRDRFDFLIRCLRMDDKS 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 TNEDEIYAFFGILVMTAVRKDNHMSTDDLFDRSLSMVYVSVMSRDRFDFLIRCLRMDDKS 240 Qy 241 IRPTLRENDVFTPVRKIWDLFIHQCIQNYTPGAHLTIDEQLLGFRGRCPFRVYIPNKPSK 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 IRPTLRENDVFTPVRKIWDLFIHQCIQNYTPGAHLTIDEQLLGFRGRCPFRVYIPNKPSK 300 Qy 301 YGIKILMMCDSGTKYMINGMPYLGRGTQTNGVPLGEYYVKELSKPVHGSCRNITCDNWFT 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 YGIKILMMCDSGTKYMINGMPYLGRGTQTNGVPLGEYYVKELSKPVHGSCRNITCDNWFT 360 Qy 361 SIPLAKNLLQEPYKLTIVGTVRSNKREIPEVLKNSRSRPVGTSMFCFDGPLTLVSYKPKP 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 SIPLAKNLLQEPYKLTIVGTVRSNKREIPEVLKNSRSRPVGTSMFCFDGPLTLVSYKPKP 420 Qy 421 AKMVYLLSSCDEDASINESTGKPQMVMYYNQTKGGVDTLDQMCSVMTCSRKTNRWPMALL 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 421 AKMVYLLSSCDEDASINESTGKPQMVMYYNQTKGGVDTLDQMCSVMTCSRKTNRWPMALL 480 Qy 481 YGMINIACINSFIIYSHNVSSKGEKVQSRKKFMRNLYMGLTSSFMRKRLEAPTLKRYLRD 540 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 481 YGMINIACINSFIIYSHNVSSKGEKVQSRKKFMRNLYMGLTSSFMRKRLEAPTLKRYLRD 540 Qy 541 NISNILPKEVPGTSDDSTEEPVMKKRTYCTYCPSKIRRKASASCKKCKKVICREHNIDMC 600 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 541 NISNILPKEVPGTSDDSTEEPVMKKRTYCTYCPSKIRRKASASCKKCKKVICREHNIDMC 600 Qy 601 QSCF 604 |||| Db 601 QSCF 604 APPENDIX B Qian et al. with SEQ ID NO: 10 Query Match 68.6%; Score 1804.6; Length 2760; Best Local Similarity 96.8%; Matches 1862; Conservative 0; Mismatches 34; Indels 27; Gaps 1; Qy 637 AAAATAAAGATCTTTTATTGCATGCGTCAATTTTACGCAGACTATCTTTCTAGGGTTAAA 696 || | | | | | | ||||||||||||||||||||||||||||||||||||||||| Db 330 AACCTCTACAAATGTGGTAGCATGCGTCAATTTTACGCAGACTATCTTTCTAGGGTTAAA 389 Qy 697 TCGATTTAGTCCAACTTGACCCTCTTGGCAGCAGGGAAGCAGCTCTGGCACATGTCGATG 756 |||||||| ||||||||||||||||||||||||| Db 390 TCGATTTA---------------------------GAAGCAGCTCTGGCACATGTCGATG 422 Qy 757 TTGTGCTCGCGGCAGATCACCTTCTTGCACTTCTTGCAGCTGGCGCTGGCCTTGCGGCGG 816 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 423 TTGTGCTCGCGGCAGATCACCTTCTTGCACTTCTTGCAGCTGGCGCTGGCCTTGCGGCGG 482 Qy 817 ATCTTGCTGGGGCAGTAGGTGCAGTAGGTGCGCTTCTTCATCACGGGCTCCTCGGTGCTG 876 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 483 ATCTTGCTGGGGCAGTAGGTGCAGTAGGTGCGCTTCTTCATCACGGGCTCCTCGGTGCTG 542 Qy 877 TCGTCGCTGGTGCCGGGCACCTCCTTGGGCAGGATGTTGCTGATGTTGTCGCGCAGGTAG 936 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 543 TCGTCGCTGGTGCCGGGCACCTCCTTGGGCAGGATGTTGCTGATGTTGTCGCGCAGGTAG 602 Qy 937 CGCTTCAGGGTGGGGGCCTCCAGGCGCTTGCGCATGAAGCTGCTGGTCAGGCCCATGTAC 996 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 603 CGCTTCAGGGTGGGGGCCTCCAGGCGCTTGCGCATGAAGCTGCTGGTCAGGCCCATGTAC 662 Qy 997 AGGTTGCGCATGAACTTCTTGCGGCTCTGCACCTTCTCGCCCTTGCTGCTCACGTTGTGG 1056 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 663 AGGTTGCGCATGAACTTCTTGCGGCTCTGCACCTTCTCGCCCTTGCTGCTCACGTTGTGG 722 Qy 1057 CTGTAGATGATGAAGCTGTTGATGCAGGCGATGTTGATCATGCCGTACAGCAGGGCCATG 1116 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 723 CTGTAGATGATGAAGCTGTTGATGCAGGCGATGTTGATCATGCCGTACAGCAGGGCCATG 782 Qy 1117 GGCCAGCGGTTGGTCTTGCGGCTGCAGGTCATCACGCTGCACATCTGGTCCAGGGTGTCC 1176 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 783 GGCCAGCGGTTGGTCTTGCGGCTGCAGGTCATCACGCTGCACATCTGGTCCAGGGTGTCC 842 Qy 1177 ACGCCGCCCTTGGTCTGGTTGTAGTACATCACCATCTGGGGCTTGCCGGTGCTCTCGTTG 1236 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 843 ACGCCGCCCTTGGTCTGGTTGTAGTACATCACCATCTGGGGCTTGCCGGTGCTCTCGTTG 902 Qy 1237 ATGCTGGCGTCCTCGTCGCAGCTGCTCAGCAGGTACACCATCTTGGCGGGCTTGGGCTTG 1296 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 903 ATGCTGGCGTCCTCGTCGCAGCTGCTCAGCAGGTACACCATCTTGGCGGGCTTGGGCTTG 962 Qy 1297 TAGCTCACCAGGGTCAGGGGGCCGTCGAAGCAGAACATGCTGGTGCCCACGGGGCGGCTG 1356 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 963 TAGCTCACCAGGGTCAGGGGGCCGTCGAAGCAGAACATGCTGGTGCCCACGGGGCGGCTG 1022 Qy 1357 CGGCTGTTCTTCAGCACCTCGGGGATCTCGCGCTTGTTGCTGCGCACGGTGCCCACGATG 1416 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1023 CGGCTGTTCTTCAGCACCTCGGGGATCTCGCGCTTGTTGCTGCGCACGGTGCCCACGATG 1082 Qy 1417 GTCAGCTTGTAGGGCTCCTGCAGCAGGTTCTTGGCCAGGGGGATGCTGGTGAACCAGTTG 1476 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1083 GTCAGCTTGTAGGGCTCCTGCAGCAGGTTCTTGGCCAGGGGGATGCTGGTGAACCAGTTG 1142 Qy 1477 TCGCAGGTGATGTTGCGGCAGCTGCCGTGCACGGGCTTGCTCAGCTCCTTCACGTAGTAC 1536 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1143 TCGCAGGTGATGTTGCGGCAGCTGCCGTGCACGGGCTTGCTCAGCTCCTTCACGTAGTAC 1202 Qy 1537 TCGCCCAGGGGCACGCCGTTGGTCTGGGTGCCGCGGCCCAGGTAGGGCATGCCGTTGATC 1596 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1203 TCGCCCAGGGGCACGCCGTTGGTCTGGGTGCCGCGGCCCAGGTAGGGCATGCCGTTGATC 1262 Qy 1597 ATGTACTTGGTGCCGCTGTCGCACATCATCAGGATCTTGATGCCGTACTTGCTGGGCTTG 1656 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1263 ATGTACTTGGTGCCGCTGTCGCACATCATCAGGATCTTGATGCCGTACTTGCTGGGCTTG 1322 Qy 1657 TTGGGGATGTACACGCGGAAGGGGCAGCGGCCGCGGAAGCCCAGCAGCTGCTCGTCGATG 1716 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1323 TTGGGGATGTACACGCGGAAGGGGCAGCGGCCGCGGAAGCCCAGCAGCTGCTCGTCGATG 1382 Qy 1717 GTCAGGTGGGCGCCGGGGGTGTAGTTCTGGATGCACTGGTGGATGAACAGGTCCCAGATC 1776 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1383 GTCAGGTGGGCGCCGGGGGTGTAGTTCTGGATGCACTGGTGGATGAACAGGTCCCAGATC 1442 Qy 1777 TTGCGCACGGGGGTGAACACGTCGTTCTCGCGCAGGGTGGGGCGGATGCTCTTGTCGTCC 1836 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1443 TTGCGCACGGGGGTGAACACGTCGTTCTCGCGCAGGGTGGGGCGGATGCTCTTGTCGTCC 1502 Qy 1837 ATGCGCAGGCAGCGGATCAGGAAGTCGAAGCGGTCGCGGCTCATCACGCTCACGTACACC 1896 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1503 ATGCGCAGGCAGCGGATCAGGAAGTCGAAGCGGTCGCGGCTCATCACGCTCACGTACACC 1562 Qy 1897 ATGCTCAGGCTGCGGTCGAACAGGTCGTCGGTGCTCATGTGGTTGTCCTTGCGCACGGCG 1956 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1563 ATGCTCAGGCTGCGGTCGAACAGGTCGTCGGTGCTCATGTGGTTGTCCTTGCGCACGGCG 1622 Qy 1957 GTCATCACCAGGATGCCGAAGAAGGCGTAGATCTCGTCCTCGTTGGTGTCGCGGAAGGTG 2016 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1623 GTCATCACCAGGATGCCGAAGAAGGCGTAGATCTCGTCCTCGTTGGTGTCGCGGAAGGTG 1682 Qy 2017 GCGCTGGTCATGCTCTCGCGGCGCTTCAGGCTGATCTCGGCGTTGGTCCACTTCACGATC 2076 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1683 GCGCTGGTCATGCTCTCGCGGCGCTTCAGGCTGATCTCGGCGTTGGTCCACTTCACGATC 1742 Qy 2077 TCGCTGATGATCTCGTCGGTGAAGAACAGCTTGAAGCACAGCAGGGGGTCGTAGATGTTG 2136 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1743 TCGCTGATGATCTCGTCGGTGAAGAACAGCTTGAAGCACAGCAGGGGGTCGTAGATGTTG 1802 Qy 2137 CGGCACATGCGGGTGGGGCCGCGCTGGCTGCGCACGATGTTCAGGGCGCTCACGCGGCTG 2196 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1803 CGGCACATGCGGGTGGGGCCGCGCTGGCTGCGCACGATGTTCAGGGCGCTCACGCGGCTG 1862 Qy 2197 CGGCGGGTGGGCTTGCTGGTGCTCCAGCAGTGCTTGTTCTTGCCGCGGATGGTGCGCTGG 2256 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1863 CGGCGGGTGGGCTTGCTGGTGCTCCAGCAGTGCTTGTTCTTGCCGCGGATGGTGCGCTGG 1922 Qy 2257 GGCAGGGTCAGGATGCGGTTGCTGGCCAGGCTGCTGCCGGGCTGCTCGATCACGTTCTGC 2316 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1923 GGCAGGGTCAGGATGCGGTTGCTGGCCAGGCTGCTGCCGGGCTGCTCGATCACGTTCTGC 1982 Qy 2317 TCGTCCAGGATCTCGCTGCCGCTGCTGGTGGGCTGCACCTCGTGCACCTCGTCGATGAAG 2376 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1983 TCGTCCAGGATCTCGCTGCCGCTGCTGGTGGGCTGCACCTCGTGCACCTCGTCGATGAAG 2042 Qy 2377 GCCTCCTCGGTGTCGCTCTGCACGTCGTCCTCGCTCACGTGGTCGCTCACCTCGCTGTCG 2436 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 2043 GCCTCCTCGGTGTCGCTCTGCACGTCGTCCTCGCTCACGTGGTCGCTCACCTCGCTGTCG 2102 Qy 2437 CTGTCCTCGCCCACCAGCTCGTCGTCGCTCTGCAGCAGGGCGCTCAGGATGTGCTCGTCG 2496 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 2103 CTGTCCTCGCCCACCAGCTCGTCGTCGCTCTGCAGCAGGGCGCTCAGGATGTGCTCGTCG 2162 Qy 2497 TCCAGGCTGCTGCCATCTTCTGTTTTGATTTTCTTAGGTTTGCCCATGGTGCCAAAGTTG 2556 |||||||||||||| || | | || || |||||||||| ||| ||| Db 2163 TCCAGGCTGCTGCCGTCCAACTTGACCCTCTTGGCAGCAGGGCCCATGGTGGCAAGCTTG 2222 Qy 2557 AGC 2559 | | Db 2223 ATC 2225 APPENDIX C Qian et al. with SEQ ID NO: 7 Query Match 96.7%; Score 1781.6; DB 1; Length 1815; Best Local Similarity 99.0%; Matches 1793; Conservative 0; Mismatches 19; Indels 0; Gaps 0; Qy 1 ATGGGCAAACCTAAGAAAATCAAAACAGAAGATGGCAGCAGCCTGGACGACGAGCACATC 60 |||||| || || | | || ||||||||||||||||||||||||||| Db 1 ATGGGCCCTGCTGCCAAGAGGGTCAAGTTGGACGGCAGCAGCCTGGACGACGAGCACATC 60 Qy 61 CTGAGCGCCCTGCTGCAGAGCGACGACGAGCTGGTGGGCGAGGACAGCGACAGCGAGGTG 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 CTGAGCGCCCTGCTGCAGAGCGACGACGAGCTGGTGGGCGAGGACAGCGACAGCGAGGTG 120 Qy 121 AGCGACCACGTGAGCGAGGACGACGTGCAGAGCGACACCGAGGAGGCCTTCATCGACGAG 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 AGCGACCACGTGAGCGAGGACGACGTGCAGAGCGACACCGAGGAGGCCTTCATCGACGAG 180 Qy 181 GTGCACGAGGTGCAGCCCACCAGCAGCGGCAGCGAGATCCTGGACGAGCAGAACGTGATC 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 GTGCACGAGGTGCAGCCCACCAGCAGCGGCAGCGAGATCCTGGACGAGCAGAACGTGATC 240 Qy 241 GAGCAGCCCGGCAGCAGCCTGGCCAGCAACCGCATCCTGACCCTGCCCCAGCGCACCATC 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 GAGCAGCCCGGCAGCAGCCTGGCCAGCAACCGCATCCTGACCCTGCCCCAGCGCACCATC 300 Qy 301 CGCGGCAAGAACAAGCACTGCTGGAGCACCAGCAAGCCCACCCGCCGCAGCCGCGTGAGC 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 CGCGGCAAGAACAAGCACTGCTGGAGCACCAGCAAGCCCACCCGCCGCAGCCGCGTGAGC 360 Qy 361 GCCCTGAACATCGTGCGCAGCCAGCGCGGCCCCACCCGCATGTGCCGCAACATCTACGAC 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 GCCCTGAACATCGTGCGCAGCCAGCGCGGCCCCACCCGCATGTGCCGCAACATCTACGAC 420 Qy 421 CCCCTGCTGTGCTTCAAGCTGTTCTTCACCGACGAGATCATCAGCGAGATCGTGAAGTGG 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 421 CCCCTGCTGTGCTTCAAGCTGTTCTTCACCGACGAGATCATCAGCGAGATCGTGAAGTGG 480 Qy 481 ACCAACGCCGAGATCAGCCTGAAGCGCCGCGAGAGCATGACCAGCGCCACCTTCCGCGAC 540 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 481 ACCAACGCCGAGATCAGCCTGAAGCGCCGCGAGAGCATGACCAGCGCCACCTTCCGCGAC 540 Qy 541 ACCAACGAGGACGAGATCTACGCCTTCTTCGGCATCCTGGTGATGACCGCCGTGCGCAAG 600 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 541 ACCAACGAGGACGAGATCTACGCCTTCTTCGGCATCCTGGTGATGACCGCCGTGCGCAAG 600 Qy 601 GACAACCACATGAGCACCGACGACCTGTTCGACCGCAGCCTGAGCATGGTGTACGTGAGC 660 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 601 GACAACCACATGAGCACCGACGACCTGTTCGACCGCAGCCTGAGCATGGTGTACGTGAGC 660 Qy 661 GTGATGAGCCGCGACCGCTTCGACTTCCTGATCCGCTGCCTGCGCATGGACGACAAGAGC 720 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 661 GTGATGAGCCGCGACCGCTTCGACTTCCTGATCCGCTGCCTGCGCATGGACGACAAGAGC 720 Qy 721 ATCCGCCCCACCCTGCGCGAGAACGACGTGTTCACCCCCGTGCGCAAGATCTGGGACCTG 780 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 721 ATCCGCCCCACCCTGCGCGAGAACGACGTGTTCACCCCCGTGCGCAAGATCTGGGACCTG 780 Qy 781 TTCATCCACCAGTGCATCCAGAACTACACCCCCGGCGCCCACCTGACCATCGACGAGCAG 840 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 781 TTCATCCACCAGTGCATCCAGAACTACACCCCCGGCGCCCACCTGACCATCGACGAGCAG 840 Qy 841 CTGCTGGGCTTCCGCGGCCGCTGCCCCTTCCGCGTGTACATCCCCAACAAGCCCAGCAAG 900 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 841 CTGCTGGGCTTCCGCGGCCGCTGCCCCTTCCGCGTGTACATCCCCAACAAGCCCAGCAAG 900 Qy 901 TACGGCATCAAGATCCTGATGATGTGCGACAGCGGCACCAAGTACATGATCAACGGCATG 960 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 901 TACGGCATCAAGATCCTGATGATGTGCGACAGCGGCACCAAGTACATGATCAACGGCATG 960 Qy 961 CCCTACCTGGGCCGCGGCACCCAGACCAACGGCGTGCCCCTGGGCGAGTACTACGTGAAG 1020 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 961 CCCTACCTGGGCCGCGGCACCCAGACCAACGGCGTGCCCCTGGGCGAGTACTACGTGAAG 1020 Qy 1021 GAGCTGAGCAAGCCCGTGCACGGCAGCTGCCGCAACATCACCTGCGACAACTGGTTCACC 1080 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1021 GAGCTGAGCAAGCCCGTGCACGGCAGCTGCCGCAACATCACCTGCGACAACTGGTTCACC 1080 Qy 1081 AGCATCCCCCTGGCCAAGAACCTGCTGCAGGAGCCCTACAAGCTGACCATCGTGGGCACC 1140 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1081 AGCATCCCCCTGGCCAAGAACCTGCTGCAGGAGCCCTACAAGCTGACCATCGTGGGCACC 1140 Qy 1141 GTGCGCAGCAACAAGCGCGAGATCCCCGAGGTGCTGAAGAACAGCCGCAGCCGCCCCGTG 1200 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1141 GTGCGCAGCAACAAGCGCGAGATCCCCGAGGTGCTGAAGAACAGCCGCAGCCGCCCCGTG 1200 Qy 1201 GGCACCAGCATGTTCTGCTTCGACGGCCCCCTGACCCTGGTGAGCTACAAGCCCAAGCCC 1260 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1201 GGCACCAGCATGTTCTGCTTCGACGGCCCCCTGACCCTGGTGAGCTACAAGCCCAAGCCC 1260 Qy 1261 GCCAAGATGGTGTACCTGCTGAGCAGCTGCGACGAGGACGCCAGCATCAACGAGAGCACC 1320 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1261 GCCAAGATGGTGTACCTGCTGAGCAGCTGCGACGAGGACGCCAGCATCAACGAGAGCACC 1320 Qy 1321 GGCAAGCCCCAGATGGTGATGTACTACAACCAGACCAAGGGCGGCGTGGACACCCTGGAC 1380 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1321 GGCAAGCCCCAGATGGTGATGTACTACAACCAGACCAAGGGCGGCGTGGACACCCTGGAC 1380 Qy 1381 CAGATGTGCAGCGTGATGACCTGCAGCCGCAAGACCAACCGCTGGCCCATGGCCCTGCTG 1440 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1381 CAGATGTGCAGCGTGATGACCTGCAGCCGCAAGACCAACCGCTGGCCCATGGCCCTGCTG 1440 Qy 1441 TACGGCATGATCAACATCGCCTGCATCAACAGCTTCATCATCTACAGCCACAACGTGAGC 1500 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1441 TACGGCATGATCAACATCGCCTGCATCAACAGCTTCATCATCTACAGCCACAACGTGAGC 1500 Qy 1501 AGCAAGGGCGAGAAGGTGCAGAGCCGCAAGAAGTTCATGCGCAACCTGTACATGGGCCTG 1560 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1501 AGCAAGGGCGAGAAGGTGCAGAGCCGCAAGAAGTTCATGCGCAACCTGTACATGGGCCTG 1560 Qy 1561 ACCAGCAGCTTCATGCGCAAGCGCCTGGAGGCCCCCACCCTGAAGCGCTACCTGCGCGAC 1620 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1561 ACCAGCAGCTTCATGCGCAAGCGCCTGGAGGCCCCCACCCTGAAGCGCTACCTGCGCGAC 1620 Qy 1621 AACATCAGCAACATCCTGCCCAAGGAGGTGCCCGGCACCAGCGACGACAGCACCGAGGAG 1680 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1621 AACATCAGCAACATCCTGCCCAAGGAGGTGCCCGGCACCAGCGACGACAGCACCGAGGAG 1680 Qy 1681 CCCGTGATGAAGAAGCGCACCTACTGCACCTACTGCCCCAGCAAGATCCGCCGCAAGGCC 1740 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1681 CCCGTGATGAAGAAGCGCACCTACTGCACCTACTGCCCCAGCAAGATCCGCCGCAAGGCC 1740 Qy 1741 AGCGCCAGCTGCAAGAAGTGCAAGAAGGTGATCTGCCGCGAGCACAACATCGACATGTGC 1800 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1741 AGCGCCAGCTGCAAGAAGTGCAAGAAGGTGATCTGCCGCGAGCACAACATCGACATGTGC 1800 Qy 1801 CAGAGCTGCTTC 1812 |||||||||||| Db 1801 CAGAGCTGCTTC 1812 Qian et al. with SEQ ID NO: 35 Query Match 100.0%; Score 27; Length 27; Best Local Similarity 100.0%; Matches 27; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 CCTGCTGCCAAGAGGGTCAAGTTGGAC 27 ||||||||||||||||||||||||||| Db 1 CCTGCTGCCAAGAGGGTCAAGTTGGAC 27
Read full office action

Prosecution Timeline

Apr 12, 2023
Application Filed
Mar 17, 2026
Non-Final Rejection — §103, §112 (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12595501
EXPRESSION OF PRODUCTS FROM NUCLEIC ACID CONCATEMERS
2y 5m to grant Granted Apr 07, 2026
Patent 12595496
Enzymatic Biosynthesis Of Lactones
2y 5m to grant Granted Apr 07, 2026
Patent 12565519
RECOMBINANT STRAINS AND MEDIUM FORMULATION FOR ENHANCING SECRETION TITER USING A TYPE III SECRETION SYSTEM
2y 5m to grant Granted Mar 03, 2026
Patent 12565668
USE OF BIOMAGNETISM FOR BIOGAS PRODUCTION
2y 5m to grant Granted Mar 03, 2026
Patent 12565665
COMPOSITIONS AND METHODS FOR CONTROLLED MRNA TRANSLATION AND STABILITY
2y 5m to grant Granted Mar 03, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

AI Strategy Recommendation

Get an AI-powered prosecution strategy using examiner precedents, rejection analysis, and claim mapping.
Powered by AI — typically takes 5-10 seconds

Prosecution Projections

1-2
Expected OA Rounds
58%
Grant Probability
99%
With Interview (+65.3%)
3y 1m
Median Time to Grant
Low
PTA Risk
Based on 764 resolved cases by this examiner. Grant probability derived from career allow rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month