Prosecution Insights
Last updated: April 19, 2026
Application No. 18/249,988

CARRIER PEPTIDE FRAGMENT AND USE THEREOF

Non-Final OA §102
Filed
Apr 21, 2023
Examiner
NOAKES, SUZANNE MARIE
Art Unit
1656
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
Toagosei Co. Ltd.
OA Round
1 (Non-Final)
73%
Grant Probability
Favorable
1-2
OA Rounds
2y 8m
To Grant
91%
With Interview

Examiner Intelligence

Grants 73% — above average
73%
Career Allow Rate
763 granted / 1047 resolved
+12.9% vs TC avg
Strong +18% interview lift
Without
With
+18.4%
Interview Lift
resolved cases with interview
Typical timeline
2y 8m
Avg Prosecution
49 currently pending
Career history
1096
Total Applications
across all art units

Statute-Specific Performance

§101
5.6%
-34.4% vs TC avg
§103
22.8%
-17.2% vs TC avg
§102
24.2%
-15.8% vs TC avg
§112
29.5%
-10.5% vs TC avg
Black line = Tech Center average estimate • Based on career data from 1047 resolved cases

Office Action

§102
DETAILED ACTION Notice of AIA Status The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . Election/Restrictions Applicant’s election without traverse of Group II, claims 6-9 in the reply filed on 06 January 2026 is acknowledged. The requirement is deemed proper and therefore made Final. Status of Application Claims 1-9 are pending; Claims 1-5 are withdrawn from further consideration pursuant to 37 CFR 1.142(b) as being drawn to a nonelected subject matter, there being no allowable generic or linking claim. Thus, claims 6-9 are subject to examination on the merits. Priority The instant application is a 371 of PCT/JP2021/037981 filed 14 October 2021 which claims benefit of foreign priority document JP 2020-177944 filed 23 October 2020 is acknowledged. Said document has been received. Information Disclosure Statement The information disclosure statements (IDS) submitted on 04 December 2025, 18 September 2025, 28 December 2023 and 21 April 2023 have been considered by the examiner. See initialed and signed PTO/SB/08’s. Claim Rejections - 35 USC § 102 In the event the determination of the status of the application as subject to AIA 35 U.S.C. 102 and 103 (or as subject to pre-AIA 35 U.S.C. 102 and 103) is incorrect, any correction of the statutory basis (i.e., changing from AIA to pre-AIA ) for the rejection will not be considered a new ground of rejection if the prior art relied upon, and the rationale supporting the rejection, would be the same under either status. The following is a quotation of the appropriate paragraphs of 35 U.S.C. 102 that form the basis for the rejections under this section made in this Office action: A person shall be entitled to a patent unless – (a)(1) the claimed invention was patented, described in a printed publication, or in public use, on sale, or otherwise available to the public before the effective filing date of the claimed invention. (a)(2) the claimed invention was described in a patent issued under section 151, or in an application for patent published or deemed published under section 122(b), in which the patent or application, as the case may be, names another inventor and was effectively filed before the effective filing date of the claimed invention. Claim(s) 6-7 are rejected under 35 U.S.C. 102(a)(1) as being anticipated by Ma et al. (Acta Pharmcologica Sinica, 2018 – cited herein). Ma et al. teach: A construct comprising SEQ ID NO: 1 (MAPRGFSCLLLLTSEIDLPVKRRA) linked to a dye on the 21st lysine of the peptide – See p. 1016, 2nd col., 1st full paragraph: “HN binds to Bax and cBid in solution and in the membrane Previous fluorescence polarization (FP) assays showed that HN binds Bax or Bid in solution [14, 15]. To verify the interactions by using the FRET technique, we labelled HN with Cy3 dye. The amino acid sequence of HN is MAPRGFSCLLLLTSEIDLPVKRRA.” Regarding the intended use of the instant claims, e.g. foreign substance introduction construct, while silent to this aspect, it is noted: “The discovery of a previously unappreciated property of a prior art composition, or of a scientific explanation for the prior art’s functioning, does not render the old composition patentably new to the discoverer.” Atlas Powder Co. v. Ireco Inc., 190 F.3d 1342, 1347, 51 USPQ2d 1943, 1947 (Fed. Cir. 1999). Thus the claiming of a new use, new function or unknown property which is inherently present in the prior art does not impart novelty to the claimed product – In re Best 562 F.2d 1252, 1254, 195 USPQ 430, 433 (CCPA 1977). M.P.E.P. § 2112(I). Claim(s) 6-8 are rejected under 35 U.S.C. 102(a)(1) as being anticipated by Li et al. (Nanotech., Biology, and Medicine - 2020 – cited on PTO-892 11/06/2025). Li et al. teach: Li et al. teach fusion proteins of humanin comprising the amino acid sequence MAPRGFSCLLLLTSEIDLPVKRRA (SEQ ID NO: 1) fused to an elastin-like polypeptide (See ELP gene and construction, and ELP expression and purification, Methods, p. 2), wherein said construct is transported into retinal epithelial cells (RPE) – See Cellular update assay pp. 3-4; also See Table 1 and Methods on p. 2, and Figure 1a. Claim(s) 6-9 are rejected under 35 U.S.C. 102(a)(1) and 102(a)(2) as being anticipated by Reed et al. (US 20030175819 – cited herein). Reed et al. teach: Wild-type humanin (SEQ ID NO: 2 - MAPRGFSCLLLLTSEIDLPVKRRA) fused on its N-terminus to a Green Fluorescent Protein (GFP) – See paragraph 0044, Figure 3B, Figures 4A and 4B, Example 5. Regarding the intended use of the instant claims, e.g. foreign substance introduction construct, while silent to this aspect, it is noted: “The discovery of a previously unappreciated property of a prior art composition, or of a scientific explanation for the prior art’s functioning, does not render the old composition patentably new to the discoverer.” Atlas Powder Co. v. Ireco Inc., 190 F.3d 1342, 1347, 51 USPQ2d 1943, 1947 (Fed. Cir. 1999). Thus the claiming of a new use, new function or unknown property which is inherently present in the prior art does not impart novelty to the claimed product – In re Best 562 F.2d 1252, 1254, 195 USPQ 430, 433 (CCPA 1977). M.P.E.P. § 2112(I). Claim(s) 6-9 are rejected under 35 U.S.C. 102(a)(1) as being anticipated by CN101144080A, published 2008; cited herein – Chinese and English language versions both provided. CN101144080A teaches at in section 1 under “Contents of the invention”: “According to the primary structure of human VIP and HN, a tandem co-expression fusion protein was designed. The N-terminus of the VIP position, the C-terminus of the HN position, the middle is a self-designed connecting small peptide, the length is 13 amino acids, and the two ends are double basic amino acids. In consideration of the need for maturation of the fusion protein, an enterokinase recognition sequence (-DDDDK-) was added before VIP.” Claim 5 specifically describes the fusion protein, including the DDDDK, VIP (underlined), 13 amino acid intervening peptide; and humanin comprising MAPRGFSCLLLLTSEIDLPVKRRA (bold), going from N-terminus to C-terminus: DDDDKHSDAVFTDNYTRIRKQMAVKKYLNSILNRRGGAGIVGGSRKMAPR GFSCLLLLTSEIDLPVKRRA Thus, the CN101144080A reference teaches a precursor construct fused to the N-terminus of humanin comprising instant SEQ ID NO: 1. However, as noted it is a precursor construct and once treated with enterokinase, which happens after enterokinase treatment in Section 4.1, then the construct inherently comprises a fusion polypeptide having a mature polypeptide located N-terminally to the humanin sequence of SEQ ID NO: 1. While silent as to intended use of introducing a foreign substance, here a polypeptide both mature and precursor, from the outside to the inside of a eukaryotic cell, said CN101144080A is intended for treatment of Alzheimer’s disease in human patients – See Abstract and 3rd paragraph under “Description”. In addition, as described above, “The discovery of a previously unappreciated property of a prior art composition, or of a scientific explanation for the prior art’s functioning, does not render the old composition patentably new to the discoverer.” Atlas Powder Co. v. Ireco Inc., 190 F.3d 1342, 1347, 51 USPQ2d 1943, 1947 (Fed. Cir. 1999). Thus the claiming of a new use, new function or unknown property which is inherently present in the prior art does not impart novelty to the claimed product – In re Best 562 F.2d 1252, 1254, 195 USPQ 430, 433 (CCPA 1977). M.P.E.P. § 2112(I). Conclusion No claim is allowed. Any inquiry concerning this communication or earlier communications from the examiner should be directed to SUZANNE M NOAKES whose telephone number is (571)272-2924. The examiner can normally be reached M-F (7-4). Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Manjunath Rao can be reached at 571-272-0939. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /SUZANNE M NOAKES/Primary Examiner, Art Unit 1656 22 January 2026
Read full office action

Prosecution Timeline

Apr 21, 2023
Application Filed
Jan 22, 2026
Non-Final Rejection — §102 (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12600999
PROTEIN CRYSTAL PRODUCTION METHOD AND CRYSTALLINE STRUCTURE ANALYSIS METHOD
2y 5m to grant Granted Apr 14, 2026
Patent 12600992
2,3-Butanediol Production, Methyl Ethyl Ketone Production, and Induction of Drought Tolerance in Plants
2y 5m to grant Granted Apr 14, 2026
Patent 12590128
NOVEL ACETOHYDROXY ACID SYNTHASE VARIANT AND MICROORGANISM INCLUDING THE SAME
2y 5m to grant Granted Mar 31, 2026
Patent 12584156
Method for Producing Protein
2y 5m to grant Granted Mar 24, 2026
Patent 12584121
ENZYMATIC PRODUCTION OF HEXOSES
2y 5m to grant Granted Mar 24, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

AI Strategy Recommendation

Get an AI-powered prosecution strategy using examiner precedents, rejection analysis, and claim mapping.
Powered by AI — typically takes 5-10 seconds

Prosecution Projections

1-2
Expected OA Rounds
73%
Grant Probability
91%
With Interview (+18.4%)
2y 8m
Median Time to Grant
Low
PTA Risk
Based on 1047 resolved cases by this examiner. Grant probability derived from career allow rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month