Prosecution Insights
Last updated: August 17, 2026
Application No. 18/259,637

CROSSLINKED HELIX DIMER MIMICS OF SOS AND METHODS OF USING SAME

Non-Final OA §101§102§103§112§DP§Other
Filed
Jun 28, 2023
Priority
Dec 28, 2020 — provisional 63/131,103 +1 more
Examiner
GARYU, LIANKO G
Art Unit
1654
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
New York University
OA Round
1 (Non-Final)
66%
Grant Probability
Favorable
1-2
OA Rounds
0m
Est. Remaining
99%
With Interview

Examiner Intelligence

Grants 66% — above average
66%
Career Allowance Rate
384 granted / 582 resolved
+6.0% vs TC avg
Strong +45% interview lift
Without
With
+45.3%
Interview Lift
resolved cases with interview
Typical timeline
2y 9m
Avg Prosecution
19 currently pending
Career history
586
Total Applications
across all art units

Statute-Specific Performance

§101
5.7%
-34.3% vs TC avg
§103
31.8%
-8.2% vs TC avg
§102
17.9%
-22.1% vs TC avg
§112
32.4%
-7.6% vs TC avg
Black line = Tech Center average estimate • Based on career data from 582 resolved cases

Office Action

§101 §102 §103 §112 §DP §Other
DETAILED ACTION Notice of Pre-AIA or AIA Status The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . Election/Restrictions Applicants’ election of group I (Claims 1-5,7-9, and 11-16) in the reply filed 23 April 2026 is acknowledged. Applicants’ election of the macrostructure as shown on page 17 of the reply filed 23 April 2026 is acknowledged. Claims 17, 19, 21-23 and 27 are withdrawn from further consideration pursuant to 37 CFR 1.142(b) as being drawn to a nonelected invention, there being no allowable generic or linking claim. Election was made without traverse in the reply filed on 23 April 2026. Claims 1-5,7-9, and 11-16 are under consideration. Status of Claims The claim listing filed 23 April 2026 is pending. Claims 17, 19, 21-23 and 27 are withdrawn from further consideration for the reasons set forth above, 37 CFR 1.142(b). Claims 1-5,7-9, and 11-16 are being examined on the merits of this office action. The search was expanded to the full scope of the elected inventive group (Group I). The closest match to the elected macrostructure species is described as the macrostructure as described in Arora (US 2018/0162907 A1). The restriction between groups I-IV is maintained. Priority The present application claims status as a 371 (National Stage) of PCT/US21/65055 filed 23 December 2021, and claims priority under 119(a)-(d) to U.S. Provisional Application No. 63/131,103 filed 28 December 2020. Applicants claim for the benefit of a prior-filed application under 35 U.S.C. 119(e) or under 35 U.S.C. 120, 121, or 365 (c) is acknowledged. Information Disclosure Statement The Information Disclosure Statements (IDSs) submitted on 28 June 2023 and 10 April 2025 are in compliance with the provisions of 37 CFR 1.97. Accordingly, the Information Disclosure Statements are being considered by the examiner. Nucleotide and/or Amino Acid Sequence Disclosures REQUIREMENTS FOR PATENT APPLICATIONS CONTAINING NUCLEOTIDE AND/OR AMINO ACID SEQUENCE DISCLOSURES Items 1) and 2) provide general guidance related to requirements for sequence disclosures. 37 CFR 1.821(c) requires that patent applications which contain disclosures of nucleotide and/or amino acid sequences that fall within the definitions of 37 CFR 1.821(a) must contain a "Sequence Listing," as a separate part of the disclosure, which presents the nucleotide and/or amino acid sequences and associated information using the symbols and format in accordance with the requirements of 37 CFR 1.821 - 1.825. This "Sequence Listing" part of the disclosure may be submitted: In accordance with 37 CFR 1.821(c)(1) via the USPTO patent electronic filing system (see Section I.1 of the Legal Framework for Patent Electronic System (https://www.uspto.gov/PatentLegalFramework), hereinafter "Legal Framework") as an ASCII text file, together with an incorporation-by-reference of the material in the ASCII text file in a separate paragraph of the specification as required by 37 CFR 1.823(b)(1) identifying: the name of the ASCII text file; ii) the date of creation; and iii) the size of the ASCII text file in bytes; In accordance with 37 CFR 1.821(c)(1) on read-only optical disc(s) as permitted by 37 CFR 1.52(e)(1)(ii), labeled according to 37 CFR 1.52(e)(5), with an incorporation-by-reference of the material in the ASCII text file according to 37 CFR 1.52(e)(8) and 37 CFR 1.823(b)(1) in a separate paragraph of the specification identifying: the name of the ASCII text file; the date of creation; and the size of the ASCII text file in bytes; In accordance with 37 CFR 1.821(c)(2) via the USPTO patent electronic filing system as a PDF file (not recommended); or In accordance with 37 CFR 1.821(c)(3) on physical sheets of paper (not recommended). When a “Sequence Listing” has been submitted as a PDF file as in 1(c) above (37 CFR 1.821(c)(2)) or on physical sheets of paper as in 1(d) above (37 CFR 1.821(c)(3)), 37 CFR 1.821(e)(1) requires a computer readable form (CRF) of the “Sequence Listing” in accordance with the requirements of 37 CFR 1.824. If the "Sequence Listing" required by 37 CFR 1.821(c) is filed via the USPTO patent electronic filing system as a PDF, then 37 CFR 1.821(e)(1)(ii) or 1.821(e)(2)(ii) requires submission of a statement that the "Sequence Listing" content of the PDF copy and the CRF copy (the ASCII text file copy) are identical. If the "Sequence Listing" required by 37 CFR 1.821(c) is filed on paper or read-only optical disc, then 37 CFR 1.821(e)(1)(ii) or 1.821(e)(2)(ii) requires submission of a statement that the "Sequence Listing" content of the paper or read-only optical disc copy and the CRF are identical. Specific deficiencies and the required response to this Office Action are as follows: Specific deficiency - This application fails to comply with the requirements of 37 CFR 1.831-1.834 because it does not contain a “Sequence Listing XML” as a separate part of the disclosure. A “Sequence Listing XML” is required because claim 1 contains two formulas, both formulas consisting of 16 amino acids each. Per MPEP §2422, sequences containing more than 4 or more amino acids must be assigned a SEQ ID NO:. Required response - Applicant must provide: • A “Sequence Listing XML” part of the disclosure, as described above in item 1. or 2.; together with o A statement that indicates the basis for the amendment, with specific references to particular parts of the application as originally filed, as required by 37 CFR 1.835(a)(3); o A statement that the “Sequence Listing XML” includes no new matter as required by 37 CFR 1.835(a)(4) AND • A substitute specification in compliance with 37 CFR 1.52, 1.121(b)(3), and 1.125 inserting the required incorporation by reference paragraph as required by 37 CFR 1.835(a)(2), consisting of: o A copy of the previously-submitted specification, with deletions shown with strikethrough or brackets and insertions shown with underlining (marked-up version); o A copy of the amended specification without markings (clean version); and o A statement that the substitute specification contains no new matter.Claim Rejections - 35 USC § 112 The following is a quotation of 35 U.S.C. 112(b): (b) CONCLUSION.—The specification shall conclude with one or more claims particularly pointing out and distinctly claiming the subject matter which the inventor or a joint inventor regards as the invention. The following is a quotation of 35 U.S.C. 112 (pre-AIA ), second paragraph: The specification shall conclude with one or more claims particularly pointing out and distinctly claiming the subject matter which the applicant regards as his invention. Claims 1-5,7-9, and 11-16 are rejected under 35 U.S.C. 112(b) or 35 U.S.C. 112 (pre-AIA ), second paragraph, as being indefinite for failing to particularly point out and distinctly claim the subject matter which the inventor or a joint inventor (or for applications subject to pre-AIA 35 U.S.C. 112, the applicant), regards as the invention. Regarding claim 1, the claim recites the claim language “particularly preferred”, which renders the limitations of the claim unclear due to there being no clear indication on if the claims require such limitations or not. Additionally, claim 1 recites the phrases "preferred residues" (See the table in claim 1) and “(or analogue of any of the preceding residues)” (See the table in claim 1, pg. 4 of the claims), which renders the claim indefinite because it is unclear whether the limitations following/proceeding the phrases are part of the claimed invention. See MPEP § 2173.05(d). Regarding claim 1, page 2 of the claim set defines the variables of the first coil of formula I and the second coil of formula II as being independently absent or any residues selected from a group consisting of modified or unmodified amino acid residues and analogues thereof, then the claim redefines the variables in the Table. For example, aX2 is listed as being any hydrophobic residue. The scope of the claim is not clearly delineated. Also regarding claim 1, the claims states that the first and second coils comprise at least ten contiguous amino acids but then says the “at least ten contiguous amino acids” have a formula of 16 amino acids. This renders the claim indefinite due to it not being clear weather the first and second coils of the macrostructure comprise 10 contiguous amino acids or 16 amino acids. The complete scope of the claims is not clearly delineated. Claims 2-5,7-9, and 11-16 depend from claim 1 (either directly or indirectly) while not providing more clarity and therefore are also subject to the rejections stated above. Claim 4 is rejected under 35 U.S.C. 112(b) or 35 U.S.C. 112 (pre-AIA ), second paragraph, as being indefinite for failing to particularly point out and distinctly claim the subject matter which the inventor or a joint inventor (or for applications subject to pre-AIA 35 U.S.C. 112, the applicant), regards as the invention. Claim 4 recites the claim language “(where PG is a protecting group)” which renders the limitations of the claim unclear due to there being no clear indication on if the claims require such limitations or not. See MPEP § 2173.05(d). Claim 7 is rejected under 35 U.S.C. 112(b) or 35 U.S.C. 112 (pre-AIA ), second paragraph, as being indefinite for failing to particularly point out and distinctly claim the subject matter which the inventor or a joint inventor (or for applications subject to pre-AIA 35 U.S.C. 112, the applicant), regards as the invention. Claim 7 recites the claim language “(preferably O, S, CH2 or NR)” which renders the limitations of the claim unclear due to there being no clear indication on if the claims require such limitations or not. See MPEP § 2173.05(d). Claim 12 is rejected under 35 U.S.C. 112(b) or 35 U.S.C. 112 (pre-AIA ), second paragraph, as being indefinite for failing to particularly point out and distinctly claim the subject matter which the inventor or a joint inventor (or for applications subject to pre-AIA 35 U.S.C. 112, the applicant), regards as the invention. Claim 12 recites the claim language “(where PG is a protecting group)” which renders the limitations of the claim unclear due to there being no clear indication on if the claims require such limitations or not. See MPEP § 2173.05(d). Additionally, claim 12 is also rejected under 35 U.S.C. 112(b) because it recites that the macrostructure of claim 1, is an antiparallel coiled coil being formula III, wherein each residue has the formula “ PNG media_image1.png 218 397 media_image1.png Greyscale ”. This, after depending from claim 1, wherein each residue is either any residue or any hydrophobic residue, renders the claim language indefinite. The claim is indefinite because one of ordinary skill in the art would not be able to tell whether the residues are to be any residue/any hydrophobic residue or if each residue is required to have the formula above without explicit guidance. Claim 14 is rejected under 35 U.S.C. 112(b) or 35 U.S.C. 112 (pre-AIA ), second paragraph, as being indefinite for failing to particularly point out and distinctly claim the subject matter which the inventor or a joint inventor (or for applications subject to pre-AIA 35 U.S.C. 112, the applicant), regards as the invention. Claim 14 is drawn to the formula of the antiparallel coiled-coil having the formula as shown below. The claims are indefinite because one of ordinary skill in the art would not be able to ascertain where the points of connection are on the helical and two-dimensional views of the macrostructure without explicit guidance due to the indefinite nature of the specification listing that the dashes indicate an optional linker (see page 38 of the specification). PNG media_image2.png 535 752 media_image2.png Greyscale and PNG media_image3.png 403 882 media_image3.png Greyscale Claim 15 is rejected under 35 U.S.C. 112(b) or 35 U.S.C. 112 (pre-AIA ), second paragraph, as being indefinite for failing to particularly point out and distinctly claim the subject matter which the inventor or a joint inventor (or for applications subject to pre-AIA 35 U.S.C. 112, the applicant), regards as the invention. Claim 15 recites “macrostructure is CHDsos-1, CHDsos-2, CHDsos-3, CHDsos-4, or CHDsos-5”. The claim is indefinite because it is unclear what “CHDsos-1, CHDsos-2, CHDsos-3, CHDsos-4, or CHDsos-5” is meant to represent. The specification shows CHDsos-1, CHDsos-2, CHDsos-3, CHDsos-4, or CHDsos-5 to be compounds comprising various amino acid sequences; however, the claim does not recite these sequences and it is improper to read limitations from the specification into the claims. Appropriate correction is required. Claim Rejections - 35 USC § 101 35 U.S.C. 101 reads as follows: Whoever invents or discovers any new and useful process, machine, manufacture, or composition of matter, or any new and useful improvement thereof, may obtain a patent therefor, subject to the conditions and requirements of this title. Claims 1 and 16 are rejected under 35 U.S.C. 101 because the claimed invention is directed to a composition comprising natural products without significantly more, due to the results of the following subject matter eligibility test using the generic claim, claim 1. Step 1: Is the claim to a process, machine, manufacture or composition of matter? Yes. The claim is to “A macrostructure comprising an antiparallel coiled-coil, wherein the antiparallel coiled-coil comprises: a first coil of Formula I and a second coil of Formula II:T1-g0-a1-b1-c1-d1-e1-f1-g1-a2-b2-c2 d2-e2-f2-g2-a3-b3-c3-d3-e3-f3-T2 (I) T3-f'0-g'0-a'1-b'1-c'1-d'1-e'1-f'1-g'1-a'2-b'2-c'2-d'2-e'2-f'2-g'2-a'3-b'3-c'3-d'3-e'3-T4 (II)”. Step 2A: Is the claim directed to a law of nature, a natural phenomenon or an abstract idea? Yes. The claim is directed to a natural phenomenon (an antiparallel coiled coil comprising a first and second coiled coil). Premchandar et al. (“Structural Dynamics of the Vimentin Coiled-coil Contact Regions Involved in Filament Assembly as Revealed by Hydrogen-Deuterium Exchange.” J Biol Chem. 2016 Nov 25;291(48):24931-24950. doi: 10.1074/jbc.M116.748145. Epub 2016 Sep 30. PMID: 27694444; PMCID: PMC5122765.) teaches vimentin, a natural structural protein used to form intermediate filaments inside cells, being an antiparallel coiled-coil wherein the coiled coil comprises a first and second coil where the first and the second coil comprise at least ten contiguous residues wherein the ten have the formula described in the instant claim 1 (See pg. 24934, figure 1; See pg. 24947, Table 1; pg. 24931, “The fundamental principles of the filament assembly mechanism and the network formation have been widely elucidated for the cytoplasmic IF protein vimentin. … IF proteins form extended coiled coils that associate into macromolecular assemblies under a broad range of ionic conditions.”; pg. 24932, “The rod consists of two equally sized α-helical subdomains termed coil 1 (146 amino acids) and coil 2 (140 amino acids), which are connected by the 16-amino acid-long non-α-helical linker segment L12 … The first step in vimentin assembly is the formation of in-parallel and in-register coiled-coil dimers; two of these dimers associate into an antiparallel, approximately half-staggered tetramer…; pg. 24948, "Peptides of the following sequences 1A, 102NEKVELQELNDRFANYIDKVRFLEQQNKILLAELEQL138, 2A, 264DLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADL298, and 2B, 383YQDLLNVKMALDIEIA TYRKLLEGEESRIS412 that covered the regions of interest in vimentin were obtained by chemical synthesis …"). Step 2B: Does the claim recite additional elements that amount to significantly more than the judicial exception? No. The claim recites the limitation "A macrostructure comprising an antiparallel coiled-coil, wherein the antiparallel coiled-coil comprises: a first coil of Formula I and a second coil of Formula II". Describing the antiparallel coiled-coil as a "macrostructure" does not add any additional elements that amount to significantly more that the judicial exception to the claimed invention. Therefore, claim 1 of the instant application does not recite a composition with elements that amount to significantly more than the judicial exception and is subject to this rejection. Claim 16 does not include any additional elements that are sufficient enough to amount to significantly more than the judicial exception because while the claim 16 recites a pharmaceutical composition comprising a macrostructure according to claim 1 and a pharmaceutically acceptable vehicle. A pharmaceutically suitable vehicle could be water, a natural product. According to the FDA (“Water for pharmaceutical use.” U.S. Food and Drug Administration. (2014, August 27). https://www.fda.gov/inspections-compliance-enforcement-and-criminal-investigations/inspection- technical-guides/water-pharmaceutical-use), water can be used in the manufacture of pharmaceuticals, and that potable water used for the manufacture of drug products is primarily obtained from municipal water systems or natural sources like wells, rivers, or ponds (pgs. 1-2 ,“This ITG will cover the different types of water used in the manufacture of drug products. THE 8 TYPES OF WATER ARE: 1. Non-potable 2. Potable (drinkable) water 3. USP purified water 4. USP water for injection (WFI) … The USP defines acceptable means of producing the various types of component waters. USP WFI may be made only by distillation or reverse osmosis. Potable water is obtained primarily from municipal water systems but may also be drawn from wells, rivers, or ponds.”). Therefore, the addition of “a pharmaceutically acceptable vehicle” does not overcome the rejection under 35 U.S.C. 101 due to each component of the composition being drawn to a natural product. Claim Rejections - 35 USC § 102 The following is a quotation of the appropriate paragraphs of 35 U.S.C. 102 that form the basis for the rejections under this section made in this Office action: A person shall be entitled to a patent unless – (a)(1) the claimed invention was patented, described in a printed publication, or in public use, on sale, or otherwise available to the public before the effective filing date of the claimed invention. (a)(2) the claimed invention was described in a patent issued under section 151, or in an application for patent published or deemed published under section 122(b), in which the patent or application, as the case may be, names another inventor and was effectively filed before the effective filing date of the claimed invention. Claim 1 is rejected under 35 U.S.C. 102(a)(1) as being anticipated by Premchandar et al., hereafter “Premchandar” (“Structural Dynamics of the Vimentin Coiled-coil Contact Regions Involved in Filament Assembly as Revealed by Hydrogen-Deuterium Exchange.” J Biol Chem. 2016 Nov 25;291(48):24931-24950. doi: 10.1074/jbc.M116.748145. Epub 2016 Sep 30. PMID: 27694444; PMCID: PMC5122765.). Regarding claim 1, Premchandar teaches vimentin, an intermediate filament (IF) protein, associating in to an antiparallel tetramer comprising a first and a second coil, wherein the first and second coils where each amino acid is selected from either any amino acid or any hydrophobic residue (See pg. 24934, figure 1; See pg. 24947, Table 1; pg. 24931, “The fundamental principles of the filament assembly mechanism and the network formation have been widely elucidated for the cytoplasmic IF protein vimentin. … IF proteins form extended coiled coils that associate into macromolecular assemblies under a broad range of ionic conditions.”; pg. 24932, “The rod consists of two equally sized α-helical subdomains termed coil 1 (146 amino acids) and coil 2 (140 amino acids), which are connected by the 16-amino acid-long non-α-helical linker segment L12 … The first step in vimentin assembly is the formation of in-parallel and in-register coiled-coil dimers; two of these dimers associate into an antiparallel, approximately half-staggered tetramer”). Additionally, Premchandar teaches the first and second coils comprise at least ten contiguous residues, wherein those "at least 10 contiguous residues" have formulas corresponding to the limitations described in the table embedded into the instant claim 1 (pg. 24948, "Peptides of the following sequences 1A, 102NEKVELQELNDRFANYIDKVRFLEQQNK ILLAELEQL138, 2A, 264DLTAALRDVRQQYESVAAKNLQE AEEWYKSKFADL298, and 2B, 383YQDLLNVKMALDIEIA TYRKLLEGEESRIS412 that covered the regions of interest in vimentin were obtained by chemical synthesis"). Premchandar also teaches that vimentins form homopolymers and that the assembly process can be arrested at the unit-length filament (ULF) stage and that replacing a tyrosine with a more hydrophobic amino acid (leucine) completely stops assembly at the ULF stage (pg. 24933, “ULFs very rapidly form followed by a less dynamic longitudinal annealing reaction of ULFs with each other and of ULFs with short filaments … Interestingly, this very dynamic reaction can be completely stopped by a single amino acid change in this domain of coil 1A, i.e. mutating a highly conserved and bulky tyrosine to leucine at position 117 of human vimentin, Y117L (28). Also, the corresponding mutation of tyrosine to a leucine on the other end of the-helical rod in coil 2B, i.e. at position 400 (Y400L), produces the same effect, a complete stop of assembly at the ULF state”). Claims 1-5, 7-9, 11-14 and 16 are rejected under 35 U.S.C. 102(a)(2) as being anticipated by Arora (US 2018/0162907 A1). Regarding claim 1, Arora teaches a macrostructure comprising an antiparallel coiled-coil, where the first coil is Formula II and the second coil is Formula II wherein each residue is independently absent or a residue that is a modified or unmodified amino acid residue, wherein the first and second coils comprise at least ten contiguous residues, ([0008] “One aspect of the present invention relates to a macrostructure. This macrostructure includes: (i) an antiparallel coiled-coil structure wherein: each ◯ and each ⊗ is independently absent or a modified or unmodified amino acid residue or analogue thereof, with the proviso that at least seven contiguous amino acid residues/analogues are present in each coil, wherein a, b, c, d, e, f, g, a′, b′, c′, d′, e′, f′, and g′ indicate the location of the amino acid residues/analogues within the coiled-coil structure … ”; [0032] “Another aspect of the present invention is an antiparallel coiled-coil of formula I: g0-a1-b1-c1-d1-e1-f1-g1-a2-b2-c2-d2-e2-f2-g2-a3-b3-c3-d3-e3-f3/f0-g′0-a′1-b′1-c′1-d′1-e′1-f′1-g′1-a′2-b′2-c′2-d′2-e′2-f′2-g′2-a′3- b′3-c′3-d′3-e′3”; [0105] “Another aspect of the present invention is a parallel coiled-coil of formula II: f0-g0-a1-b1-c1-d1-e1-f1-g1-a2-b2-c2-d2-e2-f2-g2-a3-b3-c3-d3-e3/f0-g′0-a′1-b′1-c′1-d′1-e′1-f1-g′1-a′2-b′2-d′2-e′2-f′2-g′2-a′3-b′3-c′3-d′3-e′3”; [0181] “… each PNG media_image4.png 137 104 media_image4.png Greyscale is a point of attachment from a terminal nitrogen to H … each PNG media_image5.png 137 104 media_image5.png Greyscale is a point of attachment from a terminal carbonyl to H …”). Regarding claim 2, Arora teaches that the length of the linker between g and g’ amino acids being 10-25 and the linkers between an a and d amino acid being 5-15 Å ([0008] “each Linker A is independently a linker between a g* amino acid residue and a g′* amino acid residue, wherein the length of the linker is such that the spatial distance between the Cα position of the g* amino acid residue and the Cα position of the g′* amino acid residue is 10-25 Å; each Linker B is independently a linker between an a* amino acid residue and a d′* amino acid residue, wherein the length of the linker is such that the spatial distance between the Cα position of the a* amino acid residue and the Cα position of the d′* amino acid residue is 5-15 Å”). Regarding claim 3, Arora teaches g0, a1, b1, c1, d1, e1, f1, g1, a2, b2, c2, d2, e2, f2, g2, and a3, are present in the first coil and at least d′1, e′1, f′1, g′1, a′2, b′2, c′2, d′2, e′2, f2, g′2, a′3, b′3, c′3, d′3, and e′3 are present in the second coil ([0032] “Another aspect of the present invention is an antiparallel coiled-coil of formula I: g0-a1-b1-c1-d1-e1-f1-g1-a2-b2-c2-d2-e2-f2-g2-a3-b3-c3-d3-e3-f3/f0-g′0-a′1-b′1-c′1-d′1-e′1-f′1-g′1-a′2-b′2-c′2-d′2-e′2-f′2-g′2-a′3- b′3-c′3-d′3-e′3”; [0105] “Another aspect of the present invention is a parallel coiled-coil of formula II: f0-g0-a1-b1-c1-d1-e1-f1-g1-a2-b2-c2-d2-e2-f2-g2-a3-b3-c3-d3-e3/f0-g′0-a′1-b′1-c′1-d′1-e′1-f1-g′1-a′2-b′2-d′2-e′2-f′2-g′2-a′3-b′3-c′3-d′3-e′3”). Regarding claim 4, Arora teaches each residue having the formula PNG media_image1.png 218 397 media_image1.png Greyscale ([0080] “Another aspect of the present invention is an antiparallel coiled-coil of formula I wherein: a1, a2, a3, d1, d2, d3, a′1, a′2, a′3, d′1, d′2, and d′3 each independently have the formula (a) PNG media_image6.png 228 223 media_image6.png Greyscale … e1, e2, e3, g1, g2, e′1, e′2, e′3, g′0, g′1, and g′2 each independently have the formula (b) and g0 has the formula (b′) PNG media_image7.png 113 231 media_image7.png Greyscale .” Regarding claim 5, Arora teaches the linker between at least 1 residue pair having the formula —Zn—, wherein n is a number from 1 to 25 and Z is independently selected at each occurrence thereof from the group comprising alkylene ([0254] “Suitable examples of linkers between g or e and g′ or e′ residues (Linker A, Linker D, Linker E, Linker H, linkers for g0-g′2, g1-g′1, g2-g′0, e1-e′3, e2-e′2, and e3-e′1 in Formula I, and linkers for g0-e′1, g1-e′2, g2-e′3, e1-g′0, e2-g′1, and e3-g′2 in Formula II) include, without limitation, those having the formula —Zn—, wherein n is a number from 1 to 25 … and each Z is independently selected at each occurrence thereof from the group consisting of alkylene, … ”). Regarding claim 7, Arora teaches that a linker between at least one of residue pairs g0-g′2, g1-g′1, g2-g′0, e1-e′3, e2-e′2, and e3-e′1 having the formula PNG media_image8.png 112 441 media_image8.png Greyscale (formula of group a) and PNG media_image9.png 74 393 media_image9.png Greyscale (formula of group b) where in the X is O, X1 is O, R is H, and Y is S ([0254] “In at least one embodiment, the linker between g or e and g′ or e′ residues (Linker A, Linker D, Linker E, Linker H, linkers for g0-g′2…) has the following formula [see formula of group a above]… wherein X is O, S, CR2, NR, or P (preferably O, S, CH2 or NR), wherein X1 is O, S, NH, and NR, wherein each R is independently H, alkyl, or aryl, wherein Y is S…”; [0266] “In at least one embodiment, the linker between g or e and g′ or e′ residues (Linker A, Linker D, Linker E, Linker H, linkers for g0-g′2, g1-g′1, g2-g′0, e1-e′3, e2-e′2, and e3-e′1 in Formula I, and linkers for g0-e′1, g1-e′2, g2-e′3, e1-g′0, e2-g′1, and e3-g′2 in Formula II) has the following formula [see formula of group b above]… wherein X is O, S, CR2, NR, or P (preferably O, S, CH2 or NR), wherein X1 is O, S, C, CR, N, NH, and NR, wherein each R is independently H, alkyl, or aryl, wherein Y is S”). Regarding claim 8, Arora teaches that a linker between one of residue pairs g0-g′2, g1-g′1, g2-g′0, e1-e′3, e2-e′2, and e3-e′1 having the formula PNG media_image10.png 113 525 media_image10.png Greyscale PNG media_image9.png 74 393 media_image9.png Greyscale (formula of group b) ([[0266] “In at least one embodiment, the linker between g or e and g′ or e′ residues (Linker A, Linker D, Linker E, Linker H, linkers for g0-g′2, g1-g′1, g2-g′0, e1-e′3, e2-e′2, and e3-e′1 in Formula I, and linkers for g0-e′1, g1-e′2, g2-e′3, e1-g′0, e2-g′1, and e3-g′2 in Formula II) has the following formula [see formula of group b above]… wherein X is O…, wherein X1 is … C …, wherein Y is S…”). Regarding claim 9, Arora teaches that least one of the linkers for a1-d′3, a2-d′2, a3-d′1, d1-a′3, d2-a′2, and d3-a′1 is independently selected from the group consisting of disulfides, diselenides, C1-8 alkylene, C2-8 alkenylene, arylene, heteroarylene, triazole-diyl, and thiazole-diyl ([0075] “Another aspect of the present invention is an antiparallel coiled-coil of formula I wherein at least one of the linkers for a1-d′3, a2-d′2, a3-d′1, d1-a′3, d2-a′2, and d3-a′1 is independently selected from the group consisting of disulfides, diselenides, C1-8 alkylene, C2-8 alkenylene, arylene, heteroarylene, triazole-diyl, and thiazole-diyl.”). Regarding claim 11, Arora teaches that least one of the linkers for a1-d′3, a2-d′2, a3-d′1, d1-a′3, d2-a′2, and d3-a′1 is independently a disulfide bond from a cysteine or homocysteine residue, a diselenide from a selenocysteine residue, an alkylene from an allylglycine residue, or an arylene linker ([0076] “Another aspect of the present invention is an antiparallel coiled-coil of formula I wherein at least one of the linkers for a1-d′3, a2-d′2, a3-d′1, d1-a′3, d2-a′2, and d3-a′1 is independently a disulfide bond from a cysteine or homocysteine residue, a diselenide from a selenocysteine residue, an alkylene from an allylglycine residue, or an arylene linker.”). Regarding claim 12, Arora teaches the antiparallel coiled coil as being formula III where each dotted line is an optional linker and each independently have the formula PNG media_image11.png 228 103 media_image11.png Greyscale where R1a, R1b, R1c, and R1d are each independently hydrogen, when a Linker B or a Linker C is attached to a residue of formula (a), the Linker B or Linker C is attached to or replaces one of R1a, R1b, R1c, and R1d , each R4 in Formula III is independently hydrogen, and each R5 in Formula III is independently selected from the group consisting of H ([0280] “In a preferred embodiment of the compounds of the present invention, the antiparallel coiled-coil structure is an antiparallel coiled-coil of Formula III: PNG media_image12.png 604 1547 media_image12.png Greyscale wherein: * represents the residue to which an optional linker may be attached; a1*, a2*, a3*, b1, b2, b3, c1, c2, c3, d*1, d2*, d3*, e1*, e2*, e3*, f1, f2, f3, g0*, g1*, g2*, a1′*, a3′*, b1′, b2′, b3′, c1′, c2′, c3′, d1′*, d2′*, d3′, e1′, e2′*, e3′*, f0′, f1′, f2′, g0′*, g1′*, and g2′* are each independently absent or a modified or unmodified amino acid residue or analogue thereof, with the proviso that at least seven contiguous amino acid residues/analogues are present in each coil; a1*, a2*, a3*, d1*, d2*, d3*, a1′*, a2′*, a3′*, d1′*, d2′*, and d3′* each independently have the formula (a) PNG media_image11.png 228 103 media_image11.png Greyscale e1*, e2, e3*, g1*, g2*, e1′*, e2′*, e3′*, g0′*, g1′*, and g2′* each independently have the formula (b) and g0* has the formula (b′) PNG media_image13.png 332 357 media_image13.png Greyscale ”; [0081] “… where R1a, R1b, R1c, and R1d are each independently hydrogen…”, [0082] “…when a Linker B or a Linker C is attached to a residue of formula (a), the Linker B or Linker C is attached to or replaces one of R1a, R1b, R1c, and R1d …”; [0087] “…each R4 in Formula III is independently hydrogen…”; [0088] “…and each R5 in Formula III is independently selected from the group consisting of H…”). Regarding claim 13, Arora teaches that in one embodiment of the macrostructure, one of R1a and R1c is an amino acid side chain and (ii) Rib, Rid, and the other of Ria and Ric are each independently a hydrogen ([0297]“ In a preferred embodiment, (i) one of R1a and R1c is the side chain of a modified or unmodified amino acid … and (ii) R1b, R1d, and the other of R1a and R1c are each independently hydrogen, …”). Regarding claim 14, Arora teaches the antiparallel coiled-coil having the formula PNG media_image14.png 559 858 media_image14.png Greyscale PNG media_image15.png 369 977 media_image15.png Greyscale ([0008] “One aspect of the present invention relates to a macrostructure . This macrostructure includes : ( i ) an antiparallel coiled - coil structure of formula : [see helical wheel view and two-dimensional view above]…”). Regarding claim 16, Arora teaches a pharmaceutical composition comprising a macrostructure according to claim 1 and a pharmaceutically acceptable vehicle ([0323] “Another aspect of the present invention relates to pharmaceutical formulations comprising any of the above described compounds of the present invention and a pharmaceutically acceptable carrier.”). Claim Rejections - 35 USC § 103 The following is a quotation of 35 U.S.C. 103 which forms the basis for all obviousness rejections set forth in this Office action: A patent for a claimed invention may not be obtained, notwithstanding that the claimed invention is not identically disclosed as set forth in section 102, if the differences between the claimed invention and the prior art are such that the claimed invention as a whole would have been obvious before the effective filing date of the claimed invention to a person having ordinary skill in the art to which the claimed invention pertains. Patentability shall not be negated by the manner in which the invention was made. Claims 2-5, 7-9, and 11-14 and 16 are rejected under 35 U.S.C. 103 as being unpatentable over Premchandar et al., hereafter “Premchandar” (“Structural Dynamics of the Vimentin Coiled-coil Contact Regions Involved in Filament Assembly as Revealed by Hydrogen-Deuterium Exchange.” J Biol Chem. 2016 Nov 25;291(48):24931-24950. doi: 10.1074/jbc.M116.748145. Epub 2016 Sep 30. PMID: 27694444; PMCID: PMC5122765.), as applied to claim 1 above, and further in view of Arora (US 2018/0162907 A1). Regarding claim 2, Premchandar teaches vimentin, an intermediate filament (IF) protein, associating in to an antiparallel tetramer comprising a first and a second coil, wherein the first and second coils where each amino acid is selected from either any amino acid or any hydrophobic residue (See pg. 24934, figure 1; See pg. 24947, Table 1). Premchandar teaches that vimentin has linkers (pg. 24934, “Non-helical N-terminal (head) and C-terminal (tail) domains as well as linkers L1 and L12 are represented by thick black lines”). Additionally, Premchandar teaches the first and second coils comprise at least ten contiguous residues, wherein those "at least 10 contiguous residues" have formulas corresponding to the limitations described in the table embedded into the instant claim 1 (pg. 24948, "Peptides of the following sequences 1A, 102NEKVELQELNDRFANYIDKVRFLEQQNK ILLAELEQL138, 2A, 264DLTAALRDVRQQYESVAAKNLQE AEEWYKSKFADL298, and 2B, 383YQDLLNVKMALDIEIA TYRKLLEGEESRIS412 that covered the regions of interest in vimentin were obtained by chemical synthesis"). Premchandar does not teach the macrostructure of claim 1, wherein the linker between residue pairs g0-g'2, g1-g'1, g2-g'0, e1-e'3, e2-e'2, and e3-e'1 is such that the spatial distance between the Cα positions of each residue in the pair is 10-25 Å; and the length of any linker between residue pairs d1-a'3, d2-a'2, and d3-a'1 is such that the spatial distance between the Cα positions of each residue in the pair is 5-15 Å. Arora teaches a macrostructure comprising an antiparallel coiled-coil, where the first coil is Formula II and the second coil is Formula II wherein each residue is independently absent or a residue that is a modified or unmodified amino acid residue, wherein the first and second coils comprise at least ten contiguous residues, ([0008] “One aspect of the present invention relates to a macrostructure. This macrostructure includes: (i) an antiparallel coiled-coil structure wherein: each ◯ and each ⊗ is independently absent or a modified or unmodified amino acid residue or analogue thereof, with the proviso that at least seven contiguous amino acid residues/analogues are present in each coil, wherein a, b, c, d, e, f, g, a′, b′, c′, d′, e′, f′, and g′ indicate the location of the amino acid residues/analogues within the coiled-coil structure … ”; [0032] “Another aspect of the present invention is an antiparallel coiled-coil of formula I: g0-a1-b1-c1-d1-e1-f1-g1-a2-b2-c2-d2-e2-f2-g2-a3-b3-c3-d3-e3-f3/f0-g′0-a′1-b′1-c′1-d′1-e′1-f′1-g′1-a′2-b′2-c′2-d′2-e′2-f′2-g′2-a′3- b′3-c′3-d′3-e′3”; [0105] “Another aspect of the present invention is a parallel coiled-coil of formula II: f0-g0-a1-b1-c1-d1-e1-f1-g1-a2-b2-c2-d2-e2-f2-g2-a3-b3-c3-d3-e3/f0-g′0-a′1-b′1-c′1-d′1-e′1-f1-g′1-a′2-b′2-d′2-e′2-f′2-g′2-a′3-b′3-c′3-d′3-e′3”; [0181] “… each PNG media_image4.png 137 104 media_image4.png Greyscale is a point of attachment from a terminal nitrogen to H … each PNG media_image5.png 137 104 media_image5.png Greyscale is a point of attachment from a terminal carbonyl to H …”). Arora also teaches that the length of the linker between g and g’ amino acids being 10-25 and the linkers between an a and d amino acid being 5-15 Å ([0008] “each Linker A is independently a linker between a g* amino acid residue and a g′* amino acid residue, wherein the length of the linker is such that the spatial distance between the Cα position of the g* amino acid residue and the Cα position of the g′* amino acid residue is 10-25 Å; each Linker B is independently a linker between an a* amino acid residue and a d′* amino acid residue, wherein the length of the linker is such that the spatial distance between the Cα position of the a* amino acid residue and the Cα position of the d′* amino acid residue is 5-15 Å”). It would have been obvious to one of ordinary skill in the art before the effective filing date of the instant invention to use the antiparallel coiled coil of vimentin as taught in Premchandar and modify it with the teaching of Arora due to both references teaching antiparallel coiled-coils and Arora teaching a range of acceptable linker lengths. Both Premchandar and Arora teach an antiparallel coiled-coil where the first and second coils comprise at least ten contiguous residues, wherein those "at least 10 contiguous residues" have formulas corresponding to the limitations described in the table embedded into the instant claim 1. This modification of the art takes a known structure and combines it with another structure having the same description antiparallel tetramer comprising a first and a second coil, wherein the first and second coils where each amino acid is selected from either any amino acid or any hydrophobic residue. One of ordinary skill in the art before the effective filing date of the instant invention Regarding claim 3, Arora teaches g0, a1, b1, c1, d1, e1, f1, g1, a2, b2, c2, d2, e2, f2, g2, and a3, are present in the first coil and at least d′1, e′1, f′1, g′1, a′2, b′2, c′2, d′2, e′2, f2, g′2, a′3, b′3, c′3, d′3, and e′3 are present in the second coil ([0032] “Another aspect of the present invention is an antiparallel coiled-coil of formula I: g0-a1-b1-c1-d1-e1-f1-g1-a2-b2-c2-d2-e2-f2-g2-a3-b3-c3-d3-e3-f3/f0-g′0-a′1-b′1-c′1-d′1-e′1-f′1-g′1-a′2-b′2-c′2-d′2-e′2-f′2-g′2-a′3- b′3-c′3-d′3-e′3”; [0105] “Another aspect of the present invention is a parallel coiled-coil of formula II: f0-g0-a1-b1-c1-d1-e1-f1-g1-a2-b2-c2-d2-e2-f2-g2-a3-b3-c3-d3-e3/f0-g′0-a′1-b′1-c′1-d′1-e′1-f1-g′1-a′2-b′2-d′2-e′2-f′2-g′2-a′3-b′3-c′3-d′3-e′3”). Regarding claim 4, Arora teaches each residue having the formula PNG media_image1.png 218 397 media_image1.png Greyscale ([0080] “Another aspect of the present invention is an antiparallel coiled-coil of formula I wherein: a1, a2, a3, d1, d2, d3, a′1, a′2, a′3, d′1, d′2, and d′3 each independently have the formula (a) PNG media_image6.png 228 223 media_image6.png Greyscale … e1, e2, e3, g1, g2, e′1, e′2, e′3, g′0, g′1, and g′2 each independently have the formula (b) and g0 has the formula (b′) PNG media_image7.png 113 231 media_image7.png Greyscale .” Regarding claim 5, Arora teaches the linker between at least 1 residue pair having the formula —Zn—, wherein n is a number from 1 to 25 and Z is independently selected at each occurrence thereof from the group comprising alkylene ([0254] “Suitable examples of linkers between g or e and g′ or e′ residues (Linker A, Linker D, Linker E, Linker H, linkers for g0-g′2, g1-g′1, g2-g′0, e1-e′3, e2-e′2, and e3-e′1 in Formula I, and linkers for g0-e′1, g1-e′2, g2-e′3, e1-g′0, e2-g′1, and e3-g′2 in Formula II) include, without limitation, those having the formula —Zn—, wherein n is a number from 1 to 25 … and each Z is independently selected at each occurrence thereof from the group consisting of alkylene, … ”). Regarding claim 7, Arora teaches that a linker between at least one of residue pairs g0-g′2, g1-g′1, g2-g′0, e1-e′3, e2-e′2, and e3-e′1 having the formula PNG media_image8.png 112 441 media_image8.png Greyscale (formula of group a) and PNG media_image9.png 74 393 media_image9.png Greyscale (formula of group b) where in the X is O, X1 is O, R is H, and Y is S ([0254] “In at least one embodiment, the linker between g or e and g′ or e′ residues (Linker A, Linker D, Linker E, Linker H, linkers for g0-g′2…) has the following formula [see formula of group a above]… wherein X is O, S, CR2, NR, or P (preferably O, S, CH2 or NR), wherein X1 is O, S, NH, and NR, wherein each R is independently H, alkyl, or aryl, wherein Y is S…”; [0266] “In at least one embodiment, the linker between g or e and g′ or e′ residues (Linker A, Linker D, Linker E, Linker H, linkers for g0-g′2, g1-g′1, g2-g′0, e1-e′3, e2-e′2, and e3-e′1 in Formula I, and linkers for g0-e′1, g1-e′2, g2-e′3, e1-g′0, e2-g′1, and e3-g′2 in Formula II) has the following formula [see formula of group b above]… wherein X is O, S, CR2, NR, or P (preferably O, S, CH2 or NR), wherein X1 is O, S, C, CR, N, NH, and NR, wherein each R is independently H, alkyl, or aryl, wherein Y is S”). Regarding claim 8, Arora teaches that a linker between one of residue pairs g0-g′2, g1-g′1, g2-g′0, e1-e′3, e2-e′2, and e3-e′1 having the formula PNG media_image10.png 113 525 media_image10.png Greyscale PNG media_image9.png 74 393 media_image9.png Greyscale (formula of group b) ([[0266] “In at least one embodiment, the linker between g or e and g′ or e′ residues (Linker A, Linker D, Linker E, Linker H, linkers for g0-g′2, g1-g′1, g2-g′0, e1-e′3, e2-e′2, and e3-e′1 in Formula I, and linkers for g0-e′1, g1-e′2, g2-e′3, e1-g′0, e2-g′1, and e3-g′2 in Formula II) has the following formula [see formula of group b above]… wherein X is O…, wherein X1 is … C …, wherein Y is S…”). Regarding claim 9, Arora teaches that least one of the linkers for a1-d′3, a2-d′2, a3-d′1, d1-a′3, d2-a′2, and d3-a′1 is independently selected from the group consisting of disulfides, diselenides, C1-8 alkylene, C2-8 alkenylene, arylene, heteroarylene, triazole-diyl, and thiazole-diyl ([0075] “Another aspect of the present invention is an antiparallel coiled-coil of formula I wherein at least one of the linkers for a1-d′3, a2-d′2, a3-d′1, d1-a′3, d2-a′2, and d3-a′1 is independently selected from the group consisting of disulfides, diselenides, C1-8 alkylene, C2-8 alkenylene, arylene, heteroarylene, triazole-diyl, and thiazole-diyl.”). Regarding claim 11, Arora teaches that least one of the linkers for a1-d′3, a2-d′2, a3-d′1, d1-a′3, d2-a′2, and d3-a′1 is independently a disulfide bond from a cysteine or homocysteine residue, a diselenide from a selenocysteine residue, an alkylene from an allylglycine residue, or an arylene linker ([0076] “Another aspect of the present invention is an antiparallel coiled-coil of formula I wherein at least one of the linkers for a1-d′3, a2-d′2, a3-d′1, d1-a′3, d2-a′2, and d3-a′1 is independently a disulfide bond from a cysteine or homocysteine residue, a diselenide from a selenocysteine residue, an alkylene from an allylglycine residue, or an arylene linker.”). Regarding claim 12, Arora teaches the antiparallel coiled coil as being formula III where each dotted line is an optional linker and each independently have the formula PNG media_image11.png 228 103 media_image11.png Greyscale where R1a, R1b, R1c, and R1d are each independently hydrogen, when a Linker B or a Linker C is attached to a residue of formula (a), the Linker B or Linker C is attached to or replaces one of R1a, R1b, R1c, and R1d , each R4 in Formula III is independently hydrogen, and each R5 in Formula III is independently selected from the group consisting of H ([0280] “In a preferred embodiment of the compounds of the present invention, the antiparallel coiled-coil structure is an antiparallel coiled-coil of Formula III: PNG media_image12.png 604 1547 media_image12.png Greyscale wherein: * represents the residue to which an optional linker may be attached; a1*, a2*, a3*, b1, b2, b3, c1, c2, c3, d*1, d2*, d3*, e1*, e2*, e3*, f1, f2, f3, g0*, g1*, g2*, a1′*, a3′*, b1′, b2′, b3′, c1′, c2′, c3′, d1′*, d2′*, d3′, e1′, e2′*, e3′*, f0′, f1′, f2′, g0′*, g1′*, and g2′* are each independently absent or a modified or unmodified amino acid residue or analogue thereof, with the proviso that at least seven contiguous amino acid residues/analogues are present in each coil; a1*, a2*, a3*, d1*, d2*, d3*, a1′*, a2′*, a3′*, d1′*, d2′*, and d3′* each independently have the formula (a) PNG media_image11.png 228 103 media_image11.png Greyscale e1*, e2, e3*, g1*, g2*, e1′*, e2′*, e3′*, g0′*, g1′*, and g2′* each independently have the formula (b) and g0* has the formula (b′) PNG media_image13.png 332 357 media_image13.png Greyscale ”; [0081] “… where R1a, R1b, R1c, and R1d are each independently hydrogen…”, [0082] “…when a Linker B or a Linker C is attached to a residue of formula (a), the Linker B or Linker C is attached to or replaces one of R1a, R1b, R1c, and R1d …”; [0087] “…each R4 in Formula III is independently hydrogen…”; [0088] “…and each R5 in Formula III is independently selected from the group consisting of H…”). Regarding claim 13, Arora teaches that in one embodiment of the macrostructure, one of R1a and R1c is an amino acid side chain and (ii) Rib, Rid, and the other of Ria and Ric are each independently a hydrogen ([0297]“ In a preferred embodiment, (i) one of R1a and R1c is the side chain of a modified or unmodified amino acid … and (ii) R1b, R1d, and the other of R1a and R1c are each independently hydrogen, …”). Regarding claim 14, Arora teaches the antiparallel coiled-coil having the formula PNG media_image14.png 559 858 media_image14.png Greyscale PNG media_image15.png 369 977 media_image15.png Greyscale ([0008] “One aspect of the present invention relates to a macrostructure . This macrostructure includes : ( i ) an antiparallel coiled - coil structure of formula : [see helical wheel view and two-dimensional view above]…”). Regarding claim 16, Arora teaches a pharmaceutical composition comprising a macrostructure according to claim 1 and a pharmaceutically acceptable vehicle ([0323] “Another aspect of the present invention relates to pharmaceutical formulations comprising any of the above described compounds of the present invention and a pharmaceutically acceptable carrier.”). Allowable Subject Matter The following is a statement of reasons for the indication of allowable subject matter: The macrostructure being CHDsos-1, CHDsos-2, CHDsos-3,CHDsos-4, or CHDsos-5, as described in claim 15 was found to be free of the prior art. The closest prior art is described in Arora (US 2018/0162907 A1).Arora teaches the macrostructure having the antiparallel coil-coil being CHD-NHR2-2 and CHDDS-NHR2-3 ([0102-0104] “Another aspect of the present invention is an antiparallel coiled-coil of formula I selected from the group consisting of CHD-NHR2-2 and CHDDS-NHR2-3. Another aspect of the present invention is an antiparallel coiled-coil of formula I, wherein the antiparallel coiled-coil is CHD-NHR2-2. Another aspect of the present invention is an antiparallel coiled-coil of formula I, wherein the antiparallel coiled-coil is CHDDS-NHR2-3.”). Claim 15 is objected to as being dependent upon a rejected base claim, but would be allowable if rewritten in independent form including all of the limitations of the base claim and any intervening claims. Double Patenting The nonstatutory double patenting rejection is based on a judicially created doctrine grounded in public policy (a policy reflected in the statute) so as to prevent the unjustified or improper timewise extension of the “right to exclude” granted by a patent and to prevent possible harassment by multiple assignees. A nonstatutory double patenting rejection is appropriate where the conflicting claims are not identical, but at least one examined application claim is not patentably distinct from the reference claim(s) because the examined application claim is either anticipated by, or would have been obvious over, the reference claim(s). See, e.g., In re Berg, 140 F.3d 1428, 46 USPQ2d 1226 (Fed. Cir. 1998); In re Goodman, 11 F.3d 1046, 29 USPQ2d 2010 (Fed. Cir. 1993); In re Longi, 759 F.2d 887, 225 USPQ 645 (Fed. Cir. 1985); In re Van Ornum, 686 F.2d 937, 214 USPQ 761 (CCPA 1982); In re Vogel, 422 F.2d 438, 164 USPQ 619 (CCPA 1970); In re Thorington, 418 F.2d 528, 163 USPQ 644 (CCPA 1969). A timely filed terminal disclaimer in compliance with 37 CFR 1.321(c) or 1.321(d) may be used to overcome an actual or provisional rejection based on nonstatutory double patenting provided the reference application or patent either is shown to be commonly owned with the examined application, or claims an invention made as a result of activities undertaken within the scope of a joint research agreement. See MPEP § 717.02 for applications subject to examination under the first inventor to file provisions of the AIA as explained in MPEP § 2159. See MPEP § 2146 et seq. for applications not subject to examination under the first inventor to file provisions of the AIA . A terminal disclaimer must be signed in compliance with 37 CFR 1.321(b). The filing of a terminal disclaimer by itself is not a complete reply to a nonstatutory double patenting (NSDP) rejection. A complete reply requires that the terminal disclaimer be accompanied by a reply requesting reconsideration of the prior Office action. Even where the NSDP rejection is provisional the reply must be complete. See MPEP § 804, subsection I.B.1. For a reply to a non-final Office action, see 37 CFR 1.111(a). For a reply to final Office action, see 37 CFR 1.113(c). A request for reconsideration while not provided for in 37 CFR 1.113(c) may be filed after final for consideration. See MPEP §§ 706.07(e) and 714.13. The USPTO Internet website contains terminal disclaimer forms which may be used. Please visit www.uspto.gov/patent/patents-forms. The actual filing date of the application in which the form is filed determines what form (e.g., PTO/SB/25, PTO/SB/26, PTO/AIA /25, or PTO/AIA /26) should be used. A web-based eTerminal Disclaimer may be filled out completely online using web-screens. An eTerminal Disclaimer that meets all requirements is auto-processed and approved immediately upon submission. For more information about eTerminal Disclaimers, refer to www.uspto.gov/patents/apply/applying-online/eterminal-disclaimer. Claims 1-2, 4-5,7-9, and 11-14 are rejected on the ground of nonstatutory double patenting as being unpatentable over claims 1-17 and 22 of U.S. Patent No. 10851133. Regarding claim 1, Arora teaches a macrostructure comprising an antiparallel coiled-coil, where the first coil is Formula II and the second coil is Formula II wherein each residue is independently absent or a residue that is a modified or unmodified amino acid residue, wherein the first and second coils comprise at least ten contiguous residues. (See claims 1 and 13) Regarding claim 2, Arora teaches that the length of the linker between g and g’ amino acids being 10-25 Å and the linkers between an a and d amino acid being 5-15. (See claim 1) Regarding claim 3, Arora teaches g0, a1, b1, c1, d1, e1, f1, g1, a2, b2, c2, d2, e2, f2, g2, and a3, are present in the first coil and at least d′1, e′1, f′1, g′1, a′2, b′2, c′2, d′2, e′2, f2, g′2, a′3, b′3, c′3, d′3, and e′3 are present in the second coil. (See claim 1) Regarding claim 4, Arora teaches each residue having the formula PNG media_image16.png 207 376 media_image16.png Greyscale . (See claim 8) Regarding claim 5, Arora teaches the linker between at least 1 residue pair having the formula —Zn—, wherein n is a number from 1 to 25 and Z is independently selected at each occurrence thereof from the group comprising alkylene. (See claim 3) Regarding claim 7, Arora teaches that a linker between at least one of residue pairs g0-g′2, g1-g′1, g2-g′0, e1-e′3, e2-e′2, and e3-e′1 having the formula PNG media_image8.png 112 441 media_image8.png Greyscale (formula of group a) and PNG media_image9.png 74 393 media_image9.png Greyscale (formula of group b) where in the X is O, X1 is O, R is H, and Y is S. (See claim 5) Regarding claim 8, Arora teaches that a linker between one of residue pairs g0-g′2, g1-g′1, g2-g′0, e1-e′3, e2-e′2, and e3-e′1 having the formula PNG media_image10.png 113 525 media_image10.png Greyscale PNG media_image9.png 74 393 media_image9.png Greyscale (formula of group b). (See claim 4) Regarding claim 9, Arora teaches that least one of the linkers for a1-d′3, a2-d′2, a3-d′1, d1-a′3, d2-a′2, and d3-a′1 is independently selected from the group consisting of disulfides, arylene, heteroarylene, triazole-diyl, and thiazole-diyl. (See claim 1) Regarding claim 11, Arora teaches that least one of the linkers for a1-d′3, a2-d′2, a3-d′1, d1-a′3, d2-a′2, and d3-a′1 is independently a disulfide bond from a cysteine or homocysteine residue, a diselenide from a selenocysteine residue, an alkylene from an allylglycine residue, or an arylene linker. (See claim 1) Regarding claim 12, Arora teaches the antiparallel coiled coil as being formula III where each dotted line is an optional linker and each independently have the formula PNG media_image11.png 228 103 media_image11.png Greyscale where R1a, R1b, R1c, and R1d are each independently hydrogen, when a Linker B or a Linker C is attached to a residue of formula (a), the Linker B or Linker C is attached to or replaces one of R1a, R1b, R1c, and R1d , each R4 in Formula III is independently hydrogen, and each R5 in Formula III is independently selected from the group consisting of H. (See claim 8) Regarding claim 13, Arora teaches that in one embodiment of the macrostructure, one of R1a and R1c is an amino acid side chain and (ii) R1b, R1d, and the other of R1a and R1c are each independently a hydrogen. (See claim 9 and 11) Regarding claim 14, Arora teaches the antiparallel coiled-coil having the formula PNG media_image14.png 559 858 media_image14.png Greyscale PNG media_image15.png 369 977 media_image15.png Greyscale . (See claim 1) Status of Claims Claims 1-5,7-9, and 11-16 are objected to. Claims 1-5, 7-9, and 11-16 are rejected under 35 U.S.C. 112(b). Claims 1 and 16 are rejected under 35 U.S.C. 101. Claim 1 is rejected under 35 U.S.C. 102(a)(1). Claims 1-5, 7-9, and 11-14 and 16 are rejected under 35 U.S.C. 102(a)(2). Claims 2-5, 7-9, and 11-14 and 16 are rejected under 35 U.S.C. 103. Claims 1-2, 4-5, 7-9, and 11-14 are rejected on the ground of nonstatutory double patenting. No claims allowed. Conclusion Any inquiry concerning this communication or earlier communications from the examiner should be directed to Daliyah M. Brown whose telephone number is (571)272-0136. The examiner can normally be reached Monday-Thursday 9:00 am - 4:30 pm. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Lianko Garyu can be reached at (571) 270-7367. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /Daliyah M. Brown/Examiner, Art Unit 1654 /LIANKO G GARYU/Supervisory Patent Examiner, Art Unit 1654
Read full office action

Prosecution Timeline

Jun 28, 2023
Application Filed
Jul 14, 2026
Non-Final Rejection mailed — §101, §102, §103 (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12612429
DERIVATIVES OF DOLAPROINE-DOLAISOLEUINE PEPTIDES
4y 1m to grant Granted Apr 28, 2026
Patent 12325729
MODIFIED CHANNEL RHODOPSIN
4y 2m to grant Granted Jun 10, 2025
Patent 12325727
METHOD FOR PRODUCING PEPTIDE COMPOUND, PROTECTIVE GROUP-FORMING REAGENT, AND AROMATIC HETEROCYCLIC COMPOUND
3y 9m to grant Granted Jun 10, 2025
Patent 12226457
Dry Growth Hormone Composition Transiently Linked to a Polymer Carrier
4y 9m to grant Granted Feb 18, 2025
Patent 12226450
PEPTIDES AND METHODS FOR TREATING DISEASE
2y 7m to grant Granted Feb 18, 2025
Study what changed to get past this examiner. Based on 5 most recent grants.

Strategy Recommendation AI-generated — please review before filing

Get a prosecution strategy drawn from examiner precedents, rejection analysis, and claim mapping.
Typically takes 5-10 seconds — AI-generated, attorney review required before filing

Prosecution Projections

1-2
Expected OA Rounds
66%
Grant Probability
99%
With Interview (+45.3%)
2y 9m (~0m remaining)
Median Time to Grant
Low
PTA Risk
Based on 582 resolved cases by this examiner. Grant probability derived from career allowance rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month