Prosecution Insights
Last updated: July 17, 2026
Application No. 18/264,857

NOVEL GENETIC LOCI ASSOCIATED WITH DISEASE RESISTANCE IN SOYBEANS

Non-Final OA §102§103§112
Filed
Aug 09, 2023
Priority
Feb 10, 2021 — provisional 63/147,849 +3 more
Examiner
MEADOWS, CHRISTINA L
Art Unit
1663
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
Syngenta AG
OA Round
2 (Non-Final)
76%
Grant Probability
Favorable
2-3
OA Rounds
0m
Est. Remaining
99%
With Interview

Examiner Intelligence

Grants 76% — above average
76%
Career Allowance Rate
51 granted / 67 resolved
+16.1% vs TC avg
Strong +23% interview lift
Without
With
+23.2%
Interview Lift
resolved cases with interview
Typical timeline
2y 7m
Avg Prosecution
29 currently pending
Career history
94
Total Applications
across all art units

Statute-Specific Performance

§101
4.6%
-35.4% vs TC avg
§103
52.0%
+12.0% vs TC avg
§102
13.6%
-26.4% vs TC avg
§112
24.2%
-15.8% vs TC avg
Black line = Tech Center average estimate • Based on career data from 67 resolved cases

Office Action

§102 §103 §112
DETAILED ACTION Notice of Pre-AIA or AIA Status The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . Second Action Non-Final It is noted that this Office action is a Second Action Non-Final. The Office has reconsidered the allowable subject matter of 90% sequence identity with the amino acid sequence of SEQ ID NO: 5, and is re-opening prosecution to make a new rejection over that limitation. Status of Claims The amendments received on 01/21/2026 have been entered. Claims 1-18,21,23,33-36,53-54,69-71,74,76,78, and 82-87 are pending. Claims 10-18,21,23,33-36,53-54,69-71,74,76, and 78 remain withdrawn for being directed to a non-elected invention(s). Claims 1 and 2 have been amended. Claims 84-87 have been newly added. Claims 1-9 and 82-87 are examined in this Office action. Information Disclosure Statement Initialed and dated copy of Applicant’s information disclosure statement (IDS) filed on 11/11/2025 is attached to the instant Office Action. The submission is in compliance with the provisions of 37 CFR 1.97. Accordingly, the information disclosure statement is being considered by the examiner. Objections and Rejections that are Withdrawn The Objection to the Title is withdrawn in light of Applicant’s amendment to the Title. The 35 USC 112 Indefiniteness rejection to claims 1-9 and 82-83 has been withdrawn in light of Applicant’s amendments to the claims. The 35 USC 112 Written Description rejection to claims 2-9 and 82-83 has been withdrawn in light of Applicant’s amendment to the claims. However, the 35 USC 112 Written Description rejection to claim 1 stands. The 35 USC 112 Scope of Enablement rejection to claims 1-9 and 82-83 has been withdrawn in light of Applicant’s amendments to the claims. The 35 USC 101 rejection to claims 1-9 and 82-83 has been withdrawn in light of Applicant’s amendment to the claims. The text of those sections of Title 35, U.S. Code, not included in this action, can be found in a prior Office action. Claim Objections Claims 2, 82-83, and 87 are objected to because of the following informalities: In regard to claim 2, since the (b) limitation of the claim was struck through, there is no need for the “(a)” to appear before the remaining claim limitation. It is suggested to strike through the “(a)”. In regard to claims 82-83, both claims reference “(a) or (b)” as recited in claim 2. As stated in the objection to claim 2, there is no longer a “(b)”, and as such, there is no longer a need for an “(a)”. Thus, claims 82-83 should not recite “(a) or (b)” of claim 2. Claim 87 is objected to under 37 CFR 1.75(c) as being in improper form because a multiple dependent claim should refer to other claims in the alternative only. Claim 87 references two sets of claims to different features (nucleic acid molecule of claim 84; expression cassette of any of claims 85-86). See MPEP § 608.01(n). Accordingly, the claim has not been further treated on the merits. Appropriate correction is required. Claim Rejections - 35 USC § 112 Written Description Claim 1 remains rejected under 35 U.S.C. 112(a) or 35 U.S.C. 112 (pre-AIA ), first paragraph, as failing to comply with the written description requirement. The claim(s) contains subject matter which was not described in the specification in such a way as to reasonably convey to one skilled in the relevant art that the inventor or a joint inventor, or for applications subject to pre-AIA 35 U.S.C. 112, the inventor(s), at the time the application was filed, had possession of the claimed invention. The claims are broadly drawn to a nucleotide sequence comprising an R-gene encoding a polypeptide comprising an amino acid sequence having at least 90%, at least 95%, or at least 99% sequence identity to SEQ ID NO: 5, wherein expression of said R-gene confers increased pathogen resistance on a plant. Applicant has broadly claimed increased resistance to any pathogen in any plant. Applicant has reduced to practice the R-gene of SEQ ID NO: 3 operably linked to promoter prMt12344 (SEQ ID NO: 13) (construct 25845), and the R-gene of SEQ ID NO: 11 operably linked to its native RG30 promoter (SEQ ID NO: 15) (construct 25950), which both showed strong resistance (>90%) to 3 rust populations (RTP1, BRO1, and BRO3) when inserted into Glycine max plants (instant Specification, page 301, first paragraph; page 2, first paragraph). Thus, Applicant has reduced to practice increased resistance to 3 rust populations in one plant species, Glycine max. MÄRKLE (MÄRKLE et al., 2022, Essays in Biochemistry, Vol. 66(5), pp. 551-560; included on PTO-892 dated 10/31/2025) teaches how resistance (R) genes exhibit microbe/pathogen-associated specificity. Recognition of microbe/pathogen-associated molecular patterns (M/PAMPs) at the plant cell surface is mediated by receptor-like kinases (RLK) and receptor-like proteins (RLP) known as pattern-recognition receptors (PRRs). PRR signaling outcomes prevent the proliferation of most microbes on plant hosts. This kind of resistance is considered to be polygenic, as the (inter)action of several PRRs defines the resistance phenotype. Adapted pathogens secrete variable molecules, named virulence factors or effectors, into their host to promote infection. Resistance based on recognition of these specialized effectors is mediated by single-dominant genes that are historically termed resistance (R) genes. Known R genes predominantly encode nucleotide-binding oligomerization domain (NOD)-like receptors (NLRs). The canonical protein domain structures of NLRs consist of a variable N-terminal domain, a central nucleotide-binding (NB) domain and C-terminal leucine-rich repeat (LRR) domain (Markle, Introduction, page 551, second paragraph). MÄRKLE further teaches that NLRs and RLPs either directly bind effectors (direct recognition) or detect effector-mediated changes to the host’s physiology (indirect recognition) for activation of downstream signaling. In some cases, domains that resemble effector host targets are integrated into NLR structures. These integrated domains (IDs) mediate direct interaction of the effector with the R gene (integrated decoy recognition) (Markle, Introduction, page 551, third paragraph). MÄRKLE teaches that specificity of an R gene or variants of a single R gene (alleles) can be molecularly defined as the range of effectors that the resulting R gene product detects during resistance signaling activation. Previous studies have shown that NLR specificity is often mediated by the LRR domain. The N-terminal Toll/interleukin-1 receptor (TIR) domain has also been implicated in specificity, as well as so-called IDs (Markle, Introduction, page 551, fourth paragraph). Given the microbe/pathogen-associated specificity of R genes, and given that there have not been an adequate number of species reduced to practice to be representative of the broad genus of pathogens and plants, there is not an adequate description to support the breadth of the claims. Claim Rejections - 35 USC § 102 In the event the determination of the status of the application as subject to AIA 35 U.S.C. 102 and 103 (or as subject to pre-AIA 35 U.S.C. 102 and 103) is incorrect, any correction of the statutory basis (i.e., changing from AIA to pre-AIA ) for the rejection will not be considered a new ground of rejection if the prior art relied upon, and the rationale supporting the rejection, would be the same under either status. The following is a quotation of the appropriate paragraphs of 35 U.S.C. 102 that form the basis for the rejections under this section made in this Office action: A person shall be entitled to a patent unless – (a)(1) the claimed invention was patented, described in a printed publication, or in public use, on sale, or otherwise available to the public before the effective filing date of the claimed invention. Claim 1 is rejected under 35 U.S.C. 102(a)(1) as being anticipated by SCHMUTZ (Schmutz et al., 2013, UniProt sequence K7KDI2_SOYBN; see IDS dated 11/11/2025). Claim 1 recites “A polypeptide selected from: (a) a polypeptide comprising the amino acid sequence shown in SEQ ID NO: 5, and further comprising a heterologous amino acid sequence attached thereto, wherein expression of the polypeptide or portion thereof in a plant confers increased pathogen resistance on the plant; (b) an isolated polypeptide having at least 99%, at least 95%, or at least 90% sequence identity with the amino acid sequence of SEQ ID NO: 5, wherein expression of the polypeptide confers increased pathogen resistance on the plant; or (c) a fusion polypeptide comprising the amino acid sequence of SEQ ID NO: 5, or the polypeptide of (a) or (b)”. Instant SEQ ID NO: 5 is the amino acid sequence of the protein encoded by soy rust resistance candidate gene GtoRG30. Instant SEQ ID NO: 2 is a genomic DNA sequence of a soy rust resistance candidate gene (GtoRG30) from PI505267 encoding a protein containing Toll/Interleukin-1 receptor (TIR), nucleotide-binding site (NBS), and leucine rich-repeat (LRR) domains (herein, a "TNL" R- gene motif). The gene is syntenic to Glyma.05G165800 (Soy-william82_v2). The genomic DNA fragment has been mapped to an approximate interval of ~11.44MB - 11.46MB on chromosome 3 of G. tomentella (instant Specification, Sequence Listing, page 6). SCHMUTZ teaches a polypeptide sequence (K7KDI2_SOYBN) having 90% sequence identity with the amino acid sequence of SEQ ID NO: 5 (see alignment below). The polypeptide is derived from Glycine max, located on chromosome 3. The polypeptide is annotated as a Toll/interleukin-1 receptor (TIR) domain-containing, disease resistance protein (TIR-NBS-LRR class). SCHMUTZ SEQUENCE K7KDI2_SOYBN ALIGNED WITH INSTANT SEQUENCE SEQ ID NO: 5 Qy 37 AMNNRKYEVFMSFRGEDTRATFTSHLYAALQNAGIIVFKDDESLPRGDQISDSLLLAIEQ 96 |||||:|||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 6 AMNNRRYEVFMSFRGEDTRATFTSHLYAALQNAGIIVFKDDESLPRGDQISDSLLLAIEQ 65 Qy 97 SQISVVVFSTNYADSQWCLQELEKIMYCRGTIGQVVLPVFYDVDPSQVRNQTGHFGESFE 156 |||||||||||||||:|||||||||| |: ||||||||||||||||||| |||||||||: Db 66 SQISVVVFSTNYADSRWCLQELEKIMNCKRTIGQVVLPVFYDVDPSQVRYQTGHFGESFQ 125 Qy 157 NLSNRILKDDHEKTIGEGESDKEYMKSRVFISRWRKVLREAGGISGVVVLNSRNESETIK 216 |||||||||| || :|||||||||| ||| ||||||||||| |:||||||||||||||| Db 126 NLSNRILKDDDEKAVGEGESDKEYMMSRVLISRWRKVLREAASIAGVVVLNSRNESETIK 185 Qy 217 NIVENVTRLLDKIELPLVDNPVGVESRVQDMIELLDLNHKLPNSNDVLLLGMWGMGGIGK 276 ||||||||||||||||||||||||||||||||| |||||| |||||||||:|||||||| Db 186 NIVENVTRLLDKIELPLVDNPVGVESRVQDMIERLDLNHKQSNSNDVLLLGIWGMGGIGK 245 Qy 277 TTIAKAIYNKIGRNFEGRSFLEQIGEHWRQDAIRFQEQLLFDIYKETKRKIHNVELGKHA 336 |||||||||||||||||||||||||| |||||||||||||||||| |||||||||||| | Db 246 TTIAKAIYNKIGRNFEGRSFLEQIGELWRQDAIRFQEQLLFDIYK-TKRKIHNVELGKQA 304 Qy 337 LKERLCSKRVFLVLDDVNDVEQLSALCGSREWFGSGSRIIITTRDKHILRGDRVDKVYIM 396 ||||||||||||||||||||||||||||||||||||||||||||||||||||||||:| | Db 305 LKERLCSKRVFLVLDDVNDVEQLSALCGSREWFGSGSRIIITTRDKHILRGDRVDKMYTM 364 Qy 397 KGMDKSESIELFSWHAFKQASPREGFTELSNNVIAYSGGLPLALTVLGCHLFDMKIIEWK 456 | ||:||||||||||||||||||||||||||:|| ||||||||||||||||||||||||| Db 365 KEMDESESIELFSWHAFKQASPREGFTELSNDVIEYSGGLPLALTVLGCHLFDMKIIEWK 424 Qy 457 AVLDKLKRIPHDQVQKKLKISYDGLSDDTERDIFLDIACFFIGMDRNDAICILNGCGLFA 516 ||||||||||||||||||||||||||||||||||||||||||||||||:|||||||||| Db 425 TVLDKLKRIPHDQVQKKLKISYDGLSDDTERDIFLDIACFFIGMDRNDAMCILNGCGLFA 484 Qy 517 ENGIRVLVERSLVTIDDKNKLGMHDLLRDMGREIIRAKSPKDLEERSRLWFNEDVIDVLS 576 ||||||||||||||:||||||||||||||||||||||||||||||||||||||||:|||: Db 485 ENGIRVLVERSLVTVDDKNKLGMHDLLRDMGREIIRAKSPKDLEERSRLWFNEDVLDVLA 544 Qy 577 KKTGTKTIEGLALKLPLTNSNCFSTEAFKDMKKLRLLQLAGVQLDGDFEYLSKDLRWLCW 636 |||||||||||||||||||||||||||||:|||||||||||||||||||||||||||||| Db 545 KKTGTKTIEGLALKLPLTNSNCFSTEAFKEMKKLRLLQLAGVQLDGDFEYLSKDLRWLCW 604 Qy 637 HGFPLKFIPKNFHQGSLVSIELENSNVKLVWKEPQLMEKLKILNLSHSHNLTQTPDFSNL 696 :||||| |||||||||||||||||||||||||| |||||||||||||||||||||||||| Db 605 NGFPLKCIPKNFHQGSLVSIELENSNVKLVWKEAQLMEKLKILNLSHSHNLTQTPDFSNL 664 Qy 697 PNLEKLVLIDCPRLFEVSHTVGHLNKILMINLKDCISLRSLPKSIYKLKSLKTLILSGCL 756 |||||||||||||||||||||||||||||||||||||| |||:||||||||||||||||| Db 665 PNLEKLVLIDCPRLFEVSHTVGHLNKILMINLKDCISLHSLPRSIYKLKSLKTLILSGCL 724 Qy 757 KIDKLEEDLEQMESLTTLIADNTAITKVPFSIVTSKSIGYISLCGYEGFSRDVFPSIIWS 816 ||||||||||||||| ||||||||||||||||||||||||||:||||||| ||||||| | Db 725 KIDKLEEDLEQMESLMTLIADNTAITKVPFSIVTSKSIGYISMCGYEGFSCDVFPSIILS 784 Qy 817 WMSPMSSLSSHIQTFAGMSSPISVHVANNSSNNLLSIFEDIQKLRSLWVECGTKRQLSQE 876 |||||||||||||||||| ||||:|||||||:||||||||: |||||||||||||||||| Db 785 WMSPMSSLSSHIQTFAGMPSPISLHVANNSSHNLLSIFEDLPKLRSLWVECGTKRQLSQE 844 Qy 877 RTIILDALYATNSKGLESIATTSQLPNVNASTLIECSNQVHISGSKDSLTSLLIQMGMSC 936 ||||||||| ||| |||:||||||||||||||||| ||||||||||||||||||||||| Db 845 TTIILDALYAINSKALESVATTSQLPNVNASTLIECGNQVHISGSKDSLTSLLIQMGMSC 904 Qy 937 QIAHNLKQNILQNVNTSENGGCLLPGDSYPDWLTFHGEDSSVIFEIPQVNKRNLKTMMCH 996 |||| || ||||:||||||||||||| |||| ||| ||||||||||||||||||||||| Db 905 QIAHILKHKILQNMNTSENGGCLLPGDRYPDWWTFHSEDSSVIFEIPQVNKRNLKTMMCH 964 Qy 997 VHYSSPVNIATDGLKNLLVINHTKTTIQLYKSDALASLEDEEWQRVLSNIEPGNKVEIVV 1056 ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||:| Db 965 VHYSSPVNIATDGLKNLLVINHTKTTIQLYKSDALASLEDEEWQRVLSNIEPGNKVEIIV 1024 Qy 1057 VFGSRLTVVNKTTIYLIYEPMNEKMEHCHAPN------NGDENVCADRSISPQGEFKDDV 1110 |||||||:|||||||||||||||||||||||| ||||||| ||||| | :||||| Db 1025 VFGSRLTIVNKTTIYLIYEPMNEKMEHCHAPNKNVIVFNGDENVCNDRSIS-QVKFKDDV 1083 Qy 1111 GCVSVKRVIKCLLNKCLSCKSFTAKSEKKKSQVRLKDGERLSGQT 1155 |||||||||||||||||||||||||||| ||:|||| |||: ||| Db 1084 GCVSVKRVIKCLLNKCLSCKSFTAKSEKMKSRVRLKGGERMLGQT 1128 Claim Rejections - 35 USC § 103 In the event the determination of the status of the application as subject to AIA 35 U.S.C. 102 and 103 (or as subject to pre-AIA 35 U.S.C. 102 and 103) is incorrect, any correction of the statutory basis (i.e., changing from AIA to pre-AIA ) for the rejection will not be considered a new ground of rejection if the prior art relied upon, and the rationale supporting the rejection, would be the same under either status. The following is a quotation of 35 U.S.C. 103 which forms the basis for all obviousness rejections set forth in this Office action: A patent for a claimed invention may not be obtained, notwithstanding that the claimed invention is not identically disclosed as set forth in section 102, if the differences between the claimed invention and the prior art are such that the claimed invention as a whole would have been obvious before the effective filing date of the claimed invention to a person having ordinary skill in the art to which the claimed invention pertains. Patentability shall not be negated by the manner in which the invention was made. Claims 2-9 are rejected under 35 U.S.C. 103 as being unpatentable over LIU (Liu et al., International Publication Number WO 2019/103918 A1; International Publication Date: 31 May 2019; see IDS dated 08/09/2023), in view of NCBI Reference Sequence: XM_028368933.1 (PREDICTED: Glycine soja TMV resistance protein N-like (LOC114406269), transcript variant X2, mRNA, 2019). Claim 2 recites “A nucleic acid molecule comprising: (a) a nucleotide sequence encoding a polypeptide comprising an amino acid sequence having at least 90%, at least 95%, or at least 99% sequence identity to SEQ ID NO: 5, wherein said nucleotide sequence is operably coupled to a heterologous nucleic acid sequence and expression of the nucleic acid molecule in a soybean plant confers the soybean plant with increased resistance to Asian Soy Rust (ASR) compared to a control soybean plant not comprising the nucleic acid molecule”. LIU teaches and claims a DNA construct that comprises a promoter that functions in plant cells operably linked to a novel resistance gene; a transgenic plant that contains the DNA construct, wherein the transgenic plant is resistant to soybean pathogens, particularly Asian Soybean Rust (i.e., confers the soybean plant with increased resistance to Asian Soy Rust (ASR)) (Liu, page 2, third full paragraph); DNA constructs are made that contain various genetic elements necessary for the expression of the R-Gene coding sequence in plants. “DNA construct” refers to the heterologous genetic elements operably linked to each other (Liu, page 33, second paragraph); a nucleic acid molecule comprising a polynucleotide operably linked to a heterologous promoter (i.e., wherein said nucleotide sequence is operably coupled to a heterologous nucleic acid sequence), wherein said polynucleotide encodes a polypeptide (Liu, claim 16). LIU does not teach a nucleotide sequence encoding a polypeptide comprising an amino acid sequence having at least 90%, at least 95%, or at least 99% sequence identity to SEQ ID NO: 5. However, NCBI Reference Sequence: XM_028368933.1 is a Glycine soja TMV resistance protein N-like ((LOC114406269), transcript variant X2, mRNA) which encodes an amino acid sequence (XP_028224734.1) having 92.3% sequence identity with instant sequence SEQ ID NO: 5 (i.e., a nucleotide sequence encoding a polypeptide comprising an amino acid sequence having at least 90% sequence identity to SEQ ID NO: 5). The TMV resistance protein N‑like is a plant disease resistance (R) protein in the TIR‑NBS‑LRR family. XP_028224734.1 ALIGNED WITH INSTANT SEQUENCE SEQ ID NO: 5 Qy 6 AMNNRRYEVFMSFRGEDTRATFTSHLYAALQNAGIIVFKDDESLPRGDQISGSLLLAIEQ 65 |||||:||||||||||||||||||||||||||||||||||||||||||||| |||||||| Db 37 AMNNRKYEVFMSFRGEDTRATFTSHLYAALQNAGIIVFKDDESLPRGDQISDSLLLAIEQ 96 Qy 66 SQISIVVFSTNYADSRWCLQELEKIMSCNRTIGQVVLPVFYDVDPSQVRYQTGPFGESFQ 125 ||||:||||||||||:|||||||||| | ||||||||||||||||||| ||| |||||: Db 97 SQISVVVFSTNYADSQWCLQELEKIMYCRGTIGQVVLPVFYDVDPSQVRNQTGHFGESFE 156 Qy 126 NLSNRILKDDDEKAVGEGEYDKEYMMSRVLISRWRKVLREAASIAGVVVLNSRNESETIK 185 |||||||||| || :|||| ||||| ||| ||||||||||| |:||||||||||||||| Db 157 NLSNRILKDDHEKTIGEGESDKEYMKSRVFISRWRKVLREAGGISGVVVLNSRNESETIK 216 Qy 186 NVVENVTRLLDKIELPLVDNPVGVESRVQDMIELLDLNHKQSNSNDVLLLGIWGMGGIGK 245 |:|||||||||||||||||||||||||||||||||||||| |||||||||:|||||||| Db 217 NIVENVTRLLDKIELPLVDNPVGVESRVQDMIELLDLNHKLPNSNDVLLLGMWGMGGIGK 276 Qy 246 TTIAKAIYNKIGRNFEGRSFLEQIGELWRQDTIRFQEQLLFDIYK-TKRKIHNVELGKQA 304 |||||||||||||||||||||||||| |||| ||||||||||||| |||||||||||| | Db 277 TTIAKAIYNKIGRNFEGRSFLEQIGEHWRQDAIRFQEQLLFDIYKETKRKIHNVELGKHA 336 Qy 305 LKERLCSKRVFLVLDDVNDVEQLSALCGSRRWFGSGSRIIITTRDKHILRGDRVDKIYTM 364 |||||||||||||||||||||||||||||| |||||||||||||||||||||||||:| | Db 337 LKERLCSKRVFLVLDDVNDVEQLSALCGSREWFGSGSRIIITTRDKHILRGDRVDKVYIM 396 Qy 365 KEMDESESIELFSWHAFKQASPREGFTELSNDVIEYSGGLPLALTVLGCHLFDMKIIEWK 424 | ||:||||||||||||||||||||||||||:|| ||||||||||||||||||||||||| Db 397 KGMDKSESIELFSWHAFKQASPREGFTELSNNVIAYSGGLPLALTVLGCHLFDMKIIEWK 456 Qy 425 AVLDKLKRIPHDQVQKKLKISYDGLSDDTERDIFLDIACFFIGMDRNDAMCILNGCGLFA 484 |||||||||||||||||||||||||||||||||||||||||||||||||:|||||||||| Db 457 AVLDKLKRIPHDQVQKKLKISYDGLSDDTERDIFLDIACFFIGMDRNDAICILNGCGLFA 516 Qy 485 ENGIRVLVERSLVTVDDKNKLGMHDLLRDMGREIIRAKSPKDLEERSRLWFNEDVLDVLA 544 ||||||||||||||:||||||||||||||||||||||||||||||||||||||||:|||: Db 517 ENGIRVLVERSLVTIDDKNKLGMHDLLRDMGREIIRAKSPKDLEERSRLWFNEDVIDVLS 576 Qy 545 KKTGTKTIEGLALKLPLTNSNCFSTEAFKEMKKLRLLQLSGVQLDGDFEYLSKDLRWLCW 604 |||||||||||||||||||||||||||||:|||||||||:|||||||||||||||||||| Db 577 KKTGTKTIEGLALKLPLTNSNCFSTEAFKDMKKLRLLQLAGVQLDGDFEYLSKDLRWLCW 636 Qy 605 NGFPLKCIPKNFHQGSLVSIELENSNVKLVWKEAQLMEKLKILNLSHSHNLTQTPDFSNL 664 :||||| |||||||||||||||||||||||||| |||||||||||||||||||||||||| Db 637 HGFPLKFIPKNFHQGSLVSIELENSNVKLVWKEPQLMEKLKILNLSHSHNLTQTPDFSNL 696 Qy 665 PNLEKLVLIDCPRLFEVSHTVGHLNKILMINLKDCISLHSLPRSIYKLKSLKTLILSGCL 724 |||||||||||||||||||||||||||||||||||||| |||:||||||||||||||||| Db 697 PNLEKLVLIDCPRLFEVSHTVGHLNKILMINLKDCISLRSLPKSIYKLKSLKTLILSGCL 756 Qy 725 KIDKLEEDLEQMESLMTLIADNTAITKVPFSIVTSKSIGYISMCGYEGFSCDVFPSIILS 784 ||||||||||||||| ||||||||||||||||||||||||||:||||||| ||||||| | Db 757 KIDKLEEDLEQMESLTTLIADNTAITKVPFSIVTSKSIGYISLCGYEGFSRDVFPSIIWS 816 Qy 785 WMSPMSSLSSHIQTFAGMPSPISLHVANNSSHNLLSIFEDLPKLRSLWVDCGTKRQLSQE 844 |||||||||||||||||| ||||:|||||||:||||||||: |||||||:|||||||||| Db 817 WMSPMSSLSSHIQTFAGMSSPISVHVANNSSNNLLSIFEDIQKLRSLWVECGTKRQLSQE 876 Qy 845 TTIILDALYAINSKALESIATTSQLPNVNASTLIECGNQVHISGSKDSLTSLLIQMGMSC 904 ||||||||| ||| ||||||||||||||||||||| ||||||||||||||||||||||| Db 877 RTIILDALYATNSKGLESIATTSQLPNVNASTLIECSNQVHISGSKDSLTSLLIQMGMSC 936 Qy 905 QIAH-----ILQNMNTSENGGCLLPGDSHPDWWTFHSEDSSVIFEIPQVNKRNLKTMMCH 959 |||| ||||:||||||||||||||:||| ||| ||||||||||||||||||||||| Db 937 QIAHNLKQNILQNVNTSENGGCLLPGDSYPDWLTFHGEDSSVIFEIPQVNKRNLKTMMCH 996 Qy 960 VHYSSPVNIATDGLKNLLVINHTKTTIQLYKSDALASLEDEEWQRVLSNIEPGNKVEIIV 1019 ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||:| Db 997 VHYSSPVNIATDGLKNLLVINHTKTTIQLYKSDALASLEDEEWQRVLSNIEPGNKVEIVV 1056 Qy 1020 VFGSRLTIVNKTTIYLIYEPMNEKMEHCHAPNKNVIVFNGDENVCNDRSIS-QVKFKDDV 1078 |||||||:|||||||||||||||||||||||| ||||||| ||||| | :||||| Db 1057 VFGSRLTVVNKTTIYLIYEPMNEKMEHCHAPN------NGDENVCADRSISPQGEFKDDV 1110 Qy 1079 GCVSVKRVIKCLLNKCLSCKSFTAKSEKKKS 1109 ||||||||||||||||||||||||||||||| Db 1111 GCVSVKRVIKCLLNKCLSCKSFTAKSEKKKS 1141 At the time the instant application was filed, it would have been obvious and within the scope of one of ordinary skill in the art to use the DNA construct teachings of LIU, together with NCBI Reference Sequence: XM_028368933.1, to confer increased resistance to Asian Soy Rust on a soybean plant. One would have been motivated to follow the teachings of LIU knowing that the Glycine soja TMV resistance protein N-like is a plant disease resistance (R) protein in the TIR‑NBS‑LRR family. Thus, one of ordinary skill in the art would have a high expectation of success by using NCBI Reference Sequence: XM_028368933.1 in the teachings of LIU. In regard to claims 3 and 8-9, LIU teaches methods of using the polynucleotides of the invention, for example, in DNA constructs or expression cassettes (i.e., an expression cassette comprising the nucleic acid of claim 2; instant claim 3) or vectors (i.e., a vector comprising the nucleic acid molecule of claim 2; instant claim 8) for transformation and expression in organisms, including plants (i.e., a transgenic cell comprising the nucleic acid of claim 2; instant claim 9) (Liu, page 4, last paragraph). In regard to claims 4-6, LIU teaches that "expression cassette" means a nucleic acid molecule capable of directing expression of at least one polynucleotide of interest, such as a R-gene polynucleotide that encodes protein of the invention, in an appropriate host cell, comprising a promoter operably linked to the polynucleotide of interest (i.e., wherein the nucleic acid molecule is operably linked to a promoter capable of directing expression in a plant cell; instant claim 4). In embodiments, at least one of the components in the expression cassette may be heterologous (i.e., foreign) with respect to at least one of the other components {e.g., a heterologous promoter operatively associated with a polynucleotide of interest) (i.e., wherein the promoter is an endogenous/exogenous promoter; instant claims 5 and 6) (Liu, page 12, last paragraph). In regard to claim 7, LIU teaches SEQ ID NO: 19, a promoter which shares 100% sequence identity with instant sequence SEQ ID NO: 14 (i.e., wherein the promoter comprises any one of SEQ ID NOs: 13-15) (see alignment below). LIU SEQ ID NO: 19 ALIGNED WITH INSTANT SEQUENCE SEQ ID NO; 14 Qy 1 GTTGCCATCGTTTCATCCTAGGGTTTTATTGTTACTGTTATTGGCAATTAGATATCTGAA 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 GTTGCCATCGTTTCATCCTAGGGTTTTATTGTTACTGTTATTGGCAATTAGATATCTGAA 60 Qy 61 ATTTGGTGGCATGCTTCAGAGTTAGAGGATGGAGTTTTCAAGTTTTTTTGGTTTTTGTTT 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 ATTTGGTGGCATGCTTCAGAGTTAGAGGATGGAGTTTTCAAGTTTTTTTGGTTTTTGTTT 120 Qy 121 GATGATGTTCTAAGTTTTTTGGTTTAGCTTTTGCTGGTCTATTAATGGCATGATGCTTCA 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 GATGATGTTCTAAGTTTTTTGGTTTAGCTTTTGCTGGTCTATTAATGGCATGATGCTTCA 180 Qy 181 CTGATGACAAATAACAATGTAATGAAGTGTCAGTTTTGATTTTAAGCCATATTCGTGTAT 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 CTGATGACAAATAACAATGTAATGAAGTGTCAGTTTTGATTTTAAGCCATATTCGTGTAT 240 Qy 241 TGTTAAAGCATCCAATTTTGTCAATCAATTGATGCTTCAAGTATTTCTTTTATTAATGCA 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 TGTTAAAGCATCCAATTTTGTCAATCAATTGATGCTTCAAGTATTTCTTTTATTAATGCA 300 Qy 301 ATGAATTTTCGTTTTACCTTATAATCCATATGAGAACTTTCTTTAATTTTCCAGTTATGT 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 ATGAATTTTCGTTTTACCTTATAATCCATATGAGAACTTTCTTTAATTTTCCAGTTATGT 360 Qy 361 GTATATTGATTTTGTATTTTGTTGTAAAGAATTAATCATAGTGCACTGAACCTAGCAAAA 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 GTATATTGATTTTGTATTTTGTTGTAAAGAATTAATCATAGTGCACTGAACCTAGCAAAA 420 Qy 421 CTTGGGAATTTGTTGATATTGAAGCTAATTTAATCAATAGTCTTGCTTAAATGGAATAAG 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 421 CTTGGGAATTTGTTGATATTGAAGCTAATTTAATCAATAGTCTTGCTTAAATGGAATAAG 480 Qy 481 AATGGCGTGGTACTCTTCAAAATATCATGATTGCACATTTATTTTCCCTTTACCGCTTCA 540 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 481 AATGGCGTGGTACTCTTCAAAATATCATGATTGCACATTTATTTTCCCTTTACCGCTTCA 540 Qy 541 CAACATTTAATTCAGCACTACTATCAATTATTCTCTATCAATGCATATTCCCATGCACCA 600 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 541 CAACATTTAATTCAGCACTACTATCAATTATTCTCTATCAATGCATATTCCCATGCACCA 600 Qy 601 GCAAAAGTATGTCATGTAACTATAAATATAGGTGCGGTGCTATCGAAAGGCTTGCCATTC 660 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 601 GCAAAAGTATGTCATGTAACTATAAATATAGGTGCGGTGCTATCGAAAGGCTTGCCATTC 660 Qy 661 TCATTCTAAACTCACTTAGCATCACATGTTTGTATCAAAAAATGGCTTTACGTGAGTTTG 720 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 661 TCATTCTAAACTCACTTAGCATCACATGTTTGTATCAAAAAATGGCTTTACGTGAGTTTG 720 Qy 721 AGAGCTTACTTGCTTTGATTTGCTTGAAAGGTCCCATAATCTTTGTTTATTATGTTTATG 780 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 721 AGAGCTTACTTGCTTTGATTTGCTTGAAAGGTCCCATAATCTTTGTTTATTATGTTTATG 780 Qy 781 GTTTATTTTTATGTGAATATGAAAACCATCCAGCATCAAAATCTAAACGAAGGACCGCAT 840 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 781 GTTTATTTTTATGTGAATATGAAAACCATCCAGCATCAAAATCTAAACGAAGGACCGCAT 840 Qy 841 ATTATTTACCATCATTTTTACCAATTTTCATTCTCAACAACACCATTATTTACCCAAGAA 900 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 841 ATTATTTACCATCATTTTTACCAATTTTCATTCTCAACAACACCATTATTTACCCAAGAA 900 Qy 901 AATAATTAAACAACAACATATTATTTTCCGCCAACCGTTGCTTTTTCTACGGACACCCAA 960 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 901 AATAATTAAACAACAACATATTATTTTCCGCCAACCGTTGCTTTTTCTACGGACACCCAA 960 Qy 961 ATGTAAAACACCCTTAATTCCAAAGATTTCCAAGATATAAATAAATACACCATAAACATT 1020 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 961 ATGTAAAACACCCTTAATTCCAAAGATTTCCAAGATATAAATAAATACACCATAAACATT 1020 Qy 1021 CTTCTTCTAACAAAGAAGACCTAACCATTGTTCTAACAGTAACACCTAAAATTCAGTTAC 1080 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1021 CTTCTTCTAACAAAGAAGACCTAACCATTGTTCTAACAGTAACACCTAAAATTCAGTTAC 1080 Qy 1081 CTAACATGTCAAAGTGAAAACTGAGCACAAAAACTAAAATCAAAACACCAGTTAAGAAAA 1140 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1081 CTAACATGTCAAAGTGAAAACTGAGCACAAAAACTAAAATCAAAACACCAGTTAAGAAAA 1140 Qy 1141 TAATTAAACAACAACACAAAATTTTGCATTTTGATGTATGAAAAGCTTTAAAAAAAGTGA 1200 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1141 TAATTAAACAACAACACAAAATTTTGCATTTTGATGTATGAAAAGCTTTAAAAAAAGTGA 1200 Qy 1201 CTATTTCTAAAATCACTTTTAAAAAAAGAAACATCCAAAGTCATGAGTGAGTCAAAGGGG 1260 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1201 CTATTTCTAAAATCACTTTTAAAAAAAGAAACATCCAAAGTCATGAGTGAGTCAAAGGGG 1260 Qy 1261 TTATAAACTTCTGCATTACCCTAATCTTTCTATTCTTGAAATTCCATGAGAAAATAAACA 1320 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1261 TTATAAACTTCTGCATTACCCTAATCTTTCTATTCTTGAAATTCCATGAGAAAATAAACA 1320 Qy 1321 ACAGCACATAAATGGGTTAAGCTTTAAAAAAAGGGATAATTTGTAAAATCACTTTTTCAG 1380 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1321 ACAGCACATAAATGGGTTAAGCTTTAAAAAAAGGGATAATTTGTAAAATCACTTTTTCAG 1380 Qy 1381 ACATTTTTGTTTATGCATGTGGTAAAAGTCATCTAAAGAACATCCAATGGAAGAATCGTA 1440 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1381 ACATTTTTGTTTATGCATGTGGTAAAAGTCATCTAAAGAACATCCAATGGAAGAATCGTA 1440 Qy 1441 CAAAAAATCATTGATCTAACAGAATGGACCAAAACGAGATTAAAAAAAAACTTAAATACT 1500 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1441 CAAAAAATCATTGATCTAACAGAATGGACCAAAACGAGATTAAAAAAAAACTTAAATACT 1500 Qy 1501 CAAACAATCCTTTTTTTAGTTAAGAAATTAAAACAATACCAATTAAATATTTAAGGAACC 1560 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1501 CAAACAATCCTTTTTTTAGTTAAGAAATTAAAACAATACCAATTAAATATTTAAGGAACC 1560 Qy 1561 AAAATAACATTTAAGCCTAAATTATTTTGACTAACATAAATACATAATTAAAAACTATTT 1620 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1561 AAAATAACATTTAAGCCTAAATTATTTTGACTAACATAAATACATAATTAAAAACTATTT 1620 Qy 1621 TAAAATTTCAATACAACGACACACCTTGAGAGACTAAAATGATTATTATTCATATTATCC 1680 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1621 TAAAATTTCAATACAACGACACACCTTGAGAGACTAAAATGATTATTATTCATATTATCC 1680 Qy 1681 ATTAAAAAGGAAAAGGAGTGCGTGTGAAAAGCAGGCCACACGTATATGGGCCTTGAACTC 1740 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1681 ATTAAAAAGGAAAAGGAGTGCGTGTGAAAAGCAGGCCACACGTATATGGGCCTTGAACTC 1740 Qy 1741 GAATTCGAATTCGAATCTTGTGGCCACCTAACCACTTCACTAAACTCACGAATAATTGGT 1800 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1741 GAATTCGAATTCGAATCTTGTGGCCACCTAACCACTTCACTAAACTCACGAATAATTGGT 1800 Qy 1801 GAACAATTCTTTACAACGAAACTAACGAATATCCTAATACCAGATCCTAATGACATTTTT 1860 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1801 GAACAATTCTTTACAACGAAACTAACGAATATCCTAATACCAGATCCTAATGACATTTTT 1860 Qy 1861 ACCCCTAAACTCTTACCCTCAACACTTTCAAAAGAATCATCACTAAATTGTCATTTTAAC 1920 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1861 ACCCCTAAACTCTTACCCTCAACACTTTCAAAAGAATCATCACTAAATTGTCATTTTAAC 1920 Qy 1921 ACACTCTAGAACCTACTTTGATAACGAAAAAGTAGAAAGAAACCCGTGCTAGGTCCCACC 1980 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1921 ACACTCTAGAACCTACTTTGATAACGAAAAAGTAGAAAGAAACCCGTGCTAGGTCCCACC 1980 Qy 1981 CAATAGACAACGCAAACCACAATTACCAGCGCAGTATCACGGGTCATGCACCGGTCACGT 2040 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1981 CAATAGACAACGCAAACCACAATTACCAGCGCAGTATCACGGGTCATGCACCGGTCACGT 2040 Qy 2041 AGCGTAGATAAAACCCGGAACCAAACTTGACCTACCCCCACAAACAAGTCATTATTTTAT 2100 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 2041 AGCGTAGATAAAACCCGGAACCAAACTTGACCTACCCCCACAAACAAGTCATTATTTTAT 2100 Qy 2101 TATATTTATCCTTAAAACCCTATTTCTCATTTCATTTCTTCTACAACCGTCTACTCTAGC 2160 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 2101 TATATTTATCCTTAAAACCCTATTTCTCATTTCATTTCTTCTACAACCGTCTACTCTAGC 2160 Qy 2161 TCGTTAGTTCCGCTATCACTCTACTCTTCTACTACTTCACTTCATCCTCTTTGTTTTTCA 2220 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 2161 TCGTTAGTTCCGCTATCACTCTACTCTTCTACTACTTCACTTCATCCTCTTTGTTTTTCA 2220 Qy 2221 GCCTAGGGTGGTGGTAATTATTCATAACTGTTTCATTATTTTTCCTTAATTTCTCATTAA 2280 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 2221 GCCTAGGGTGGTGGTAATTATTCATAACTGTTTCATTATTTTTCCTTAATTTCTCATTAA 2280 Qy 2281 TTTTCCGTTAATTTTTCAATTAGTGTAAGCTGATCTGATTTTTTTCCTTTGTTTTTGTTT 2340 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 2281 TTTTCCGTTAATTTTTCAATTAGTGTAAGCTGATCTGATTTTTTTCCTTTGTTTTTGTTT 2340 Qy 2341 CGAATTTTGATGGATCAGCCAAGATCAAGATCGTAATCAACGGTAAATATTATAGTTCCT 2400 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 2341 CGAATTTTGATGGATCAGCCAAGATCAAGATCGTAATCAACGGTAAATATTATAGTTCCT 2400 Qy 2401 TCGATCTCTGTTCATTTATGCGTCGATCGGATTTATATTTTTTAATTTAGTTTATTTTTT 2460 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 2401 TCGATCTCTGTTCATTTATGCGTCGATCGGATTTATATTTTTTAATTTAGTTTATTTTTT 2460 Qy 2461 GTTAATTTTGTTTGTAACTGATAGGATTTGGAAGAATCGGAAACC 2505 ||||||||||||||||||||||||||||||||||||||||||||| Db 2461 GTTAATTTTGTTTGTAACTGATAGGATTTGGAAGAATCGGAAACC 2505 Summary Claims 82-87 have been deemed free of the prior art. A thorough sequence search did not disclose a sequence having at least 95% sequence identity to any one of SEQ ID NOs: 2-4 and 11-12. Nor did the sequence search disclose a nucleic acid molecule encoding the peptide of claim 1 (SEQ ID NO: 5). Accordingly, claims 82-87 are objected to as being dependent upon a rejected base claim, but would be allowable if rewritten in independent form including all of the limitations of the base claim and any intervening claims. Correspondence Any inquiry concerning this communication or earlier communications from the examiner should be directed to CHRISTINA MEADOWS whose telephone number is (703)756-1430. The examiner can normally be reached Monday - Friday 9:00 am - 5:00 pm. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Amjad Abraham can be reached at 571-270-7058. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /CHRISTINA L MEADOWS/Examiner, Art Unit 1663 CHRISTINA MEADOWS Examiner Art Unit 1663 /Amjad Abraham/SPE, Art Unit 1663
Read full office action

Prosecution Timeline

Aug 09, 2023
Application Filed
Oct 31, 2025
Non-Final Rejection mailed — §102, §103, §112
Jan 21, 2026
Response Filed
Apr 21, 2026
Non-Final Rejection mailed — §102, §103, §112 (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12680106
STEM RUST RESISTANCE GENE
3y 4m to grant Granted Jul 14, 2026
Patent 12674176
INSECTICIDAL PROTEINS AND METHODS FOR THEIR USE
2y 2m to grant Granted Jul 07, 2026
Patent 12653131
SOYBEAN VARIETIES '10020720647', '10020889109', '10020889166', '70020032728', '70020032975', '70020033154', '20598563', '21097024', '10021387700', '10021389471', '10021384531', '10021387127', '10020865219', '10021384221', '21097118', '10021389525', AND '10021384485'
2y 9m to grant Granted Jun 16, 2026
Patent 12648530
PARTHENOCARPIC WATERMELON PLANTS
3y 1m to grant Granted Jun 09, 2026
Patent 12635640
PLANTS AND SEEDS OF HYBRID CORN VARIETY CH010541
2y 5m to grant Granted May 26, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

Strategy Recommendation AI-generated — please review before filing

Get a prosecution strategy drawn from examiner precedents, rejection analysis, and claim mapping.
Typically takes 5-10 seconds — AI-generated, attorney review required before filing

Prosecution Projections

2-3
Expected OA Rounds
76%
Grant Probability
99%
With Interview (+23.2%)
2y 7m (~0m remaining)
Median Time to Grant
Moderate
PTA Risk
Based on 67 resolved cases by this examiner. Grant probability derived from career allowance rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month