Prosecution Insights
Last updated: October 02, 2026
Application No. 18/267,914

Tetravalent FZD and WNT Co-Receptor Binding Antibody Molecules and Uses Thereof

Non-Final OA §102§DP
Filed
Jun 16, 2023
Priority
Dec 18, 2020 — provisional 63/127,408 +1 more
Examiner
XIAO, YAN
Art Unit
1642
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
AntlerA Therapeutics Inc.
OA Round
1 (Non-Final)
67%
Grant Probability
Favorable
1-2
OA Rounds
0m
Est. Remaining
99%
With Interview

Examiner Intelligence

Grants 67% — above average
67%
Career Allowance Rate
518 granted / 770 resolved
+7.3% vs TC avg
Strong +53% interview lift
Without
With
+52.7%
Interview Lift
resolved cases with interview
Typical timeline
2y 11m
Avg Prosecution
48 currently pending
Career history
800
Total Applications
across all art units

Statute-Specific Performance

§101
4.8%
-35.2% vs TC avg
§103
26.3%
-13.7% vs TC avg
§102
18.4%
-21.6% vs TC avg
§112
27.1%
-12.9% vs TC avg
Black line = Tech Center average estimate • Based on career data from 770 resolved cases

Office Action

§102 §DP
Notice of Pre-AIA or AIA Status The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . DETAILED ACTION 2. The election without traverse filed 04/28/2026 in response to the Office Action of 01/28/2026 is acknowledged and has been entered. Applicant has elected Group I, claims 1-39, drawn to a tetravalent binding antibody molecule comprising: (a) an Fc domain or fragment thereof comprising a constant heavy chain domain 3 (CH3), (b) a bivalent low-density lipoprotein receptor-related protein (LRP) binding domain, and (c) a bivalent Frizzled (FZD) binding domain. 3. Claims 1-46 are pending in the application. Claims 40-46 have been withdrawn from further consideration pursuant to 37 CFR 1.142(b) as being drawn to nonelected inventions, there being no allowable generic or linking claim. Election was made without traverse in the reply filed on 04/28/2026. Claims 1-39 are currently under prosecution. Priority Applicant’s claim under 35 U.S.C. §§ 119(e) and 365(c) for benefit of the earlier filing date of applications, is acknowledged. Claim Objections 6. Claim 1 is objected to because of the following informalities: Claim 1: “Frizzled Class Receptor 5 (FZD4)” should be " Frizzled Class Receptor 4 (FZD4)”. 7. Claims 9, 17, 19-20, 29, 31, and 33 are objected to because claim recite, “Table 1, 2, 3, 4, 6, or 11”. Claims must, under modern claim practice, stand alone to define invention, and incorporation into claims by express reference to specification and/or drawings is not permitted except in very limited circumstances. See Ex parte Fressola, 27 USPQ2d 1608 (BPAI, 1993). See M.P.E.P. § 2173.05(s), which states: “Where possible, claims are to be complete in themselves. Incorporation by reference to a specific figure or table “is permitted only in exceptional circumstances where there is no practical way to define the invention in words and where it is more concise to incorporate by reference than duplicating a drawing or table into the claim. Incorporation by reference is a necessity doctrine, not for applicant's convenience.” Ex parte Fressola, 27 USPQ2d 1608, 1609 (Bd. Pat. App. & Inter. 1993) (citations omitted). Appropriate correction is required. 8. In the event the determination of the status of the application as subject to AIA 35 U.S.C. 102 and 103 (or as subject to pre-AIA 35 U.S.C. 102 and 103) is incorrect, any correction of the statutory basis for the rejection will not be considered a new ground of rejection if the prior art relied upon, and the rationale supporting the rejection, would be the same under either status. Claim Rejections - 35 USC § 102 9. The following is a quotation of the appropriate paragraphs of 35 U.S.C. 102 that form the basis for the rejections under this section made in this Office action: A person shall be entitled to a patent unless – (a)(1) the claimed invention was patented, described in a printed publication, or in public use, on sale or otherwise available to the public before the effective filing date of the claimed invention. 10. Claims 1-37 and 39 are rejected under 35 U.S.C. 102(a)(1) as being anticipated by Angers et al. (WO 2019159084, published on 22 August 2019, IDS). Claims 1-37 and 39 are herein drawn to a tetravalent binding antibody molecule comprising: (a) an Fc domain or fragment thereof comprising a constant heavy chain domain 3 (CH3), (b) a bivalent low-density lipoprotein receptor-related protein (LRP) binding domain, and (c) a bivalent Frizzled (FZD) binding domain. Angers et al. teach a multivalent binding molecule, wherein the multivalent binding molecule comprises: (a) an Fc domain, or fragment thereof comprising a CH3 domain, having a C-terminus and an N-terminus, (b) a FZD binding domain having at least two binding sites wherein at least one binding site binds to the FZD receptor and (c) a Wnt co-receptor binding domain having at least two binding sites wherein at least one binding site binds to the Wnt co-receptor, wherein the FZD binding domain is attached to one terminus of the Fc domain and the Wnt co-receptor binding domain is attached to the other terminus of the Fc domain; wherein the FZD binding domain comprises: (i) a diabody that binds the FZD receptor, said diabody comprising two peptides each peptide comprising a heavy-chain variable domain (VH) linked to a light-chain variable domain (VL) wherein the VH and the VL from one peptide pair to the VL and VH of the other peptide thereby forming the diabody, or (ii) an scFv comprising VL and VH regions that binds the FZD receptor, and the Wnt co-receptor binding domain comprises: (iii) a diabody that binds the co receptor, said diabody comprising two peptides each peptide comprising a heavy-chain variable domain (VH) linked to a light-chain variable domain (VL) wherein the VH and the VL from one peptide pair to the VL and VH of the other peptide thereby forming the diabody, or (iv) an scFv comprising VL and VH regions that binds the co-receptor; wherein the FZD binding domain binds one or more of FZD1, FZD2, FZD3, FZD4, FZD5, FZD6, FZD7, FZD8, FZD9, or FZD10 receptor; wherein the Wnt co-receptor binding domain binds one or more of LRP5 and/or LRP6; see entire document, e.g., abstract, [0005-0016], claims 9-14. For claim 6, Angers et al. teach that the LRP binding domain and/or the FZD binding domain is bispecific; see [0169]. For claims 8 and 18, Angers et al. teach the LPR binding domain binds to a Wnt3A site; see [0016]. For claims 10 and 22, Angers et al. teach that the Fc domain or fragment thereof is in a knob-in-hole configuration; see [0008]. For claims 12-13 and 24-27, Angers et al. teach that the LRP binding domain and FZD binding domain are each attached to the Fc domain by a linker, the linker is between 5 to 75, 5 to 50, 5 to 25, 5 to 20, 5 to 15, or 5 to 10 amino acids in length; see [0124] and [0127]. For claims 21 and 34, Angers et al. teach wherein at least one of the binding domains is bispecific diabody; see [0032], Fig. 3A, claim 11. For claim 39, Angers et al. teach a pharmaceutical composition comprising the multivalent binding molecule and a pharmaceutically acceptable carrier; see claim 15. Double Patenting 11. The nonstatutory double patenting rejection is based on a judicially created doctrine grounded in public policy (a policy reflected in the statute) so as to prevent the unjustified or improper timewise extension of the “right to exclude” granted by a patent and to prevent possible harassment by multiple assignees. A nonstatutory double patenting rejection is appropriate where the claims at issue are not identical, but at least one examined application claim is not patentably distinct from the reference claim(s) because the examined application claim is either anticipated by, or would have been obvious over, the reference claim(s). See, e.g., In re Berg, 140 F.3d 1428, 46 USPQ2d 1226 (Fed. Cir. 1998); In re Goodman, 11 F.3d 1046, 29 USPQ2d 2010 (Fed. Cir. 1993); In re Longi, 759 F.2d 887, 225 USPQ 645 (Fed. Cir. 1985); In re Van Ornum, 686 F.2d 937, 214 USPQ 761 (CCPA 1982); In re Vogel, 422 F.2d 438, 164 USPQ 619 (CCPA 1970); and In re Thorington, 418 F.2d 528, 163 USPQ 644 (CCPA 1969). A timely filed terminal disclaimer in compliance with 37 CFR 1.321(c) or 1.321(d) may be used to overcome an actual or provisional rejection based on a nonstatutory double patenting ground provided the reference application or patent either is shown to be commonly owned with this application, or claims an invention made as a result of activities undertaken within the scope of a joint research agreement. A terminal disclaimer must be signed in compliance with 37 CFR 1.321(b). The USPTO internet Web site contains terminal disclaimer forms which may be used. Please visit http://www.uspto.gov/forms/. The filing date of the application will determine what form should be used. A web-based eTerminal Disclaimer may be filled out completely online using web-screens. An eTerminal Disclaimer that meets all requirements is auto-processed and approved immediately upon submission. For more information about eTerminal Disclaimers, refer to http://www.uspto.gov/patents/process/file/efs/guidance/eTD-info-I.jsp. 12. Claims 1-39 are provisionally rejected on the ground of nonstatutory obviousness-type double patenting as being unpatentable over claims 1, 8-9, 12, 16 and 39 of copending Application No. 17/846846. Although the conflicting claims are not identical, they are not patentably distinct from each other for the following reasons: Claims 1-39 are herein drawn to a tetravalent binding antibody molecule comprising: (a) an Fc domain or fragment thereof comprising a constant heavy chain domain 3 (CH3), (b) a bivalent low-density lipoprotein receptor-related protein (LRP) binding domain, and (c) a bivalent Frizzled (FZD) binding domain. Claims 1, 8-9, 12, 16 and 39 of copending Application No. 17/846846 are drawn to a tetravalent binding antibody molecule comprising: (a) an Fc domain or fragment thereof comprising a constant heavy chain domain 3 (CH3), (b) a bivalent low-density lipoprotein receptor-related protein 5 (LRP5) binding domain and (c) a bivalent Frizzled (FZD) binding domain, wherein the LRP5 binding domain is attached to one terminus of the Fc domain and the FZD binding domain is attached to the other end of the Fc domain, wherein the LRP5 binding domain comprises a diabody that binds LRP5 and the FZD binding domain comprises two scFv or two Fab that bind FZD4. Instant claimed SEQ ID NOs: 986-992 are 100% identical with SEQ ID NOs: 986-992 of copending Application No. 17/846846; see sequences alignments below. This is a provisional obviousness-type double patenting rejection because the conflicting claims have not in fact been patented. Conclusion 13. No claim is allowed. 14. Any inquiry concerning this communication or earlier communications from the examiner should be directed to YAN XIAO whose telephone number is (571)270-3578. The examiner can normally be reached M-F 8-5 EST. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Samira Jean-Louis can be reached on 571-270-3503. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /YAN XIAO/Primary Examiner, Art Unit 1642 Sequences alignments US-17-846-846-986 (NOTE: this sequence has 3 duplicates in the database searched. See complete list at the end of this report) Sequence 986, US/17846846 Publication No. US20230118983A1 GENERAL INFORMATION APPLICANT: ANTLERA THERAPEUTICS, INC. TITLE OF INVENTION: TETRAVALENT FZD AND WNT CO-RECEPTOR BINDING ANTIBODY MOLECULES TITLE OF INVENTION: AND USES THEREOF FILE REFERENCE: ANT-P3186USCIP CURRENT APPLICATION NUMBER: US/17/846,846 CURRENT FILING DATE: 2022-06-22 PRIOR APPLICATION NUMBER: 63/127,408 PRIOR FILING DATE: 2020-12-18 NUMBER OF SEQ ID NOS: 1063 SEQ ID NO 986 LENGTH: 735 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: Description of Artificial Sequence: Synthetic polypeptide Query Match 100.0%; Score 3873; Length 735; Best Local Similarity 100.0%; Matches 735; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 MNLLLILTFVAAAVAEVQLVESGGGLVQPGGSLRLSCAASGFTLSYSYIHWVRQAPGKGL 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MNLLLILTFVAAAVAEVQLVESGGGLVQPGGSLRLSCAASGFTLSYSYIHWVRQAPGKGL 60 Qy 61 EWVASIYSYTGATDYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARYWSTNRI 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 EWVASIYSYTGATDYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARYWSTNRI 120 Qy 121 LSYGGMDYWGQGTLVTVSSGGGGSDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWY 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 LSYGGMDYWGQGTLVTVSSGGGGSDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWY 180 Qy 181 QQKPGKAPKLLIYSASSLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQYFDPIT 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 QQKPGKAPKLLIYSASSLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQYFDPIT 240 Qy 241 FGQGTKVEIKGGGGSGGGGSEPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISR 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 FGQGTKVEIKGGGGSGGGGSEPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISR 300 Qy 301 TPEVTCVVVAVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYGSTYRVVSVLTVLHQDWLN 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 TPEVTCVVVAVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYGSTYRVVSVLTVLHQDWLN 360 Qy 361 GKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPIRELMTSNQVSLSCAVKGFYPS 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 GKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPIRELMTSNQVSLSCAVKGFYPS 420 Qy 421 DIAVEWESNGQPENNYKTTPPVLDSDGSFFLVSKLTVDKSRWQQGNVFSCSVMHEALHNH 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 421 DIAVEWESNGQPENNYKTTPPVLDSDGSFFLVSKLTVDKSRWQQGNVFSCSVMHEALHNH 480 Qy 481 YTQKSLSLSPGKGGGSGGGSGGGSGGGSGSTGEVQLVESGGGLVQPGGSLRLSCAASGFN 540 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 481 YTQKSLSLSPGKGGGSGGGSGGGSGGGSGSTGEVQLVESGGGLVQPGGSLRLSCAASGFN 540 Qy 541 IAYSSMHWVRQAPGKGLEWVATIYPSYSSTYYADSVKGRFTISADTSKNTAYLQMNSLRA 600 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 541 IAYSSMHWVRQAPGKGLEWVATIYPSYSSTYYADSVKGRFTISADTSKNTAYLQMNSLRA 600 Qy 601 EDTAVYYCARYYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYF 660 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 601 EDTAVYYCARYYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYF 660 Qy 661 PEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTK 720 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 661 PEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTK 720 Qy 721 VDKKVEPKSCDKTHT 735 US-17-846-846-987 (NOTE: this sequence has 3 duplicates in the database searched. See complete list at the end of this report) Sequence 987, US/17846846 Publication No. US20230118983A1 GENERAL INFORMATION APPLICANT: ANTLERA THERAPEUTICS, INC. TITLE OF INVENTION: TETRAVALENT FZD AND WNT CO-RECEPTOR BINDING ANTIBODY MOLECULES TITLE OF INVENTION: AND USES THEREOF FILE REFERENCE: ANT-P3186USCIP CURRENT APPLICATION NUMBER: US/17/846,846 CURRENT FILING DATE: 2022-06-22 PRIOR APPLICATION NUMBER: 63/127,408 PRIOR FILING DATE: 2020-12-18 NUMBER OF SEQ ID NOS: 1063 SEQ ID NO 987 LENGTH: 733 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: Description of Artificial Sequence: Synthetic polypeptide Query Match 100.0%; Score 3890; Length 733; Best Local Similarity 100.0%; Matches 733; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 MNLLLILTFVAAAVAEVQLVESGGGLVQPGGSLRLSCAASGFDLSHSSIHWVRQAPGKGL 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MNLLLILTFVAAAVAEVQLVESGGGLVQPGGSLRLSCAASGFDLSHSSIHWVRQAPGKGL 60 Qy 61 EWVASISSHYGYTHYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSSYFPWF 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 EWVASISSHYGYTHYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSSYFPWF 120 Qy 121 FALDYWGQGTLVTVSSGGGGSDIQMTQSPSSLSASVGDRVTITCRASQDVSTAVAWYQQK 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 FALDYWGQGTLVTVSSGGGGSDIQMTQSPSSLSASVGDRVTITCRASQDVSTAVAWYQQK 180 Qy 181 PGKAPKLLIYSASFLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFG 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 PGKAPKLLIYSASFLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFG 240 Qy 241 QGTKVEIKGGGGSGGGGSEPKTSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTP 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 QGTKVEIKGGGGSGGGGSEPKTSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTP 300 Qy 301 EVTCVVVAVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYGSTYRVVSVLTVLHQDWLNGK 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 EVTCVVVAVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYGSTYRVVSVLTVLHQDWLNGK 360 Qy 361 EYKCKVSNKALPAPIEKTISKAKGQPREPMVFDLPPSREEMTKNQVSLWCMVKGFYPSDI 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 EYKCKVSNKALPAPIEKTISKAKGQPREPMVFDLPPSREEMTKNQVSLWCMVKGFYPSDI 420 Qy 421 AVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYT 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 421 AVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYT 480 Qy 481 QKSLSLSPGKGGGSGGGSGGGSGGGSGSTGEVQLVESGGGLVQPGGSLRLSCAASGFNIA 540 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 481 QKSLSLSPGKGGGSGGGSGGGSGGGSGSTGEVQLVESGGGLVQPGGSLRLSCAASGFNIA 540 Qy 541 YSSMHWVRQAPGKGLEWVATIYPSYSSTYYADSVKGRFTISADTSKNTAYLQMNSLRAED 600 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 541 YSSMHWVRQAPGKGLEWVATIYPSYSSTYYADSVKGRFTISADTSKNTAYLQMNSLRAED 600 Qy 601 TAVYYCARYYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPE 660 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 601 TAVYYCARYYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPE 660 Qy 661 PVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVD 720 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 661 PVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVD 720 Qy 721 KKVEPKSCDKTHT 733 ||||||||||||| Db 721 KKVEPKSCDKTHT 733 US-17-846-846-988 (NOTE: this sequence has 3 duplicates in the database searched. See complete list at the end of this report) Sequence 988, US/17846846 Publication No. US20230118983A1 GENERAL INFORMATION APPLICANT: ANTLERA THERAPEUTICS, INC. TITLE OF INVENTION: TETRAVALENT FZD AND WNT CO-RECEPTOR BINDING ANTIBODY MOLECULES TITLE OF INVENTION: AND USES THEREOF FILE REFERENCE: ANT-P3186USCIP CURRENT APPLICATION NUMBER: US/17/846,846 CURRENT FILING DATE: 2022-06-22 PRIOR APPLICATION NUMBER: 63/127,408 PRIOR FILING DATE: 2020-12-18 NUMBER OF SEQ ID NOS: 1063 SEQ ID NO 988 LENGTH: 735 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: Description of Artificial Sequence: Synthetic polypeptide Query Match 100.0%; Score 3872; Length 735; Best Local Similarity 100.0%; Matches 735; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 MNLLLILTFVAAAVAEVQLVESGGGLVQPGGSLRLSCAASGFTLSYSYIHWVRQAPGKGL 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MNLLLILTFVAAAVAEVQLVESGGGLVQPGGSLRLSCAASGFTLSYSYIHWVRQAPGKGL 60 Qy 61 EWVASIYSYTGATDYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARYWSTNRI 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 EWVASIYSYTGATDYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARYWSTNRI 120 Qy 121 LSYGGMDYWGQGTLVTVSSGGGGSDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWY 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 LSYGGMDYWGQGTLVTVSSGGGGSDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWY 180 Qy 181 QQKPGKAPKLLIYSASSLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQYFDPIT 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 QQKPGKAPKLLIYSASSLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQYFDPIT 240 Qy 241 FGQGTKVEIKGGGGSGGGGSEPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISR 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 FGQGTKVEIKGGGGSGGGGSEPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISR 300 Qy 301 TPEVTCVVVAVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYGSTYRVVSVLTVLHQDWLN 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 TPEVTCVVVAVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYGSTYRVVSVLTVLHQDWLN 360 Qy 361 GKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPIRELMTSNQVSLSCAVKGFYPS 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 GKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPIRELMTSNQVSLSCAVKGFYPS 420 Qy 421 DIAVEWESNGQPENNYKTTPPVLDSDGSFFLVSKLTVDKSRWQQGNVFSCSVMHEALHNH 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 421 DIAVEWESNGQPENNYKTTPPVLDSDGSFFLVSKLTVDKSRWQQGNVFSCSVMHEALHNH 480 Qy 481 YTQKSLSLSPGKGGGSGGGSGGGSGGGSGSTGEVQLVESGGGLVQPGGSLRLSCAASGFN 540 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 481 YTQKSLSLSPGKGGGSGGGSGGGSGGGSGSTGEVQLVESGGGLVQPGGSLRLSCAASGFN 540 Qy 541 IAYSSMHWVRQAPGKGLEWVATIYPSYSSTYYADSVKGRFTISADTSKNTAYLQMNSLRA 600 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 541 IAYSSMHWVRQAPGKGLEWVATIYPSYSSTYYADSVKGRFTISADTSKNTAYLQMNSLRA 600 Qy 601 EDTAVYYCARDYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYF 660 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 601 EDTAVYYCARDYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYF 660 Qy 661 PEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTK 720 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 661 PEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTK 720 Qy 721 VDKKVEPKSCDKTHT 735 ||||||||||||||| Db 721 VDKKVEPKSCDKTHT 735 US-17-846-846-989 (NOTE: this sequence has 3 duplicates in the database searched. See complete list at the end of this report) Sequence 989, US/17846846 Publication No. US20230118983A1 GENERAL INFORMATION APPLICANT: ANTLERA THERAPEUTICS, INC. TITLE OF INVENTION: TETRAVALENT FZD AND WNT CO-RECEPTOR BINDING ANTIBODY MOLECULES TITLE OF INVENTION: AND USES THEREOF FILE REFERENCE: ANT-P3186USCIP CURRENT APPLICATION NUMBER: US/17/846,846 CURRENT FILING DATE: 2022-06-22 PRIOR APPLICATION NUMBER: 63/127,408 PRIOR FILING DATE: 2020-12-18 NUMBER OF SEQ ID NOS: 1063 SEQ ID NO 989 LENGTH: 733 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: Description of Artificial Sequence: Synthetic polypeptide Query Match 100.0%; Score 3889; Length 733; Best Local Similarity 100.0%; Matches 733; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 MNLLLILTFVAAAVAEVQLVESGGGLVQPGGSLRLSCAASGFDLSHSSIHWVRQAPGKGL 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MNLLLILTFVAAAVAEVQLVESGGGLVQPGGSLRLSCAASGFDLSHSSIHWVRQAPGKGL 60 Qy 61 EWVASISSHYGYTHYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSSYFPWF 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 EWVASISSHYGYTHYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSSYFPWF 120 Qy 121 FALDYWGQGTLVTVSSGGGGSDIQMTQSPSSLSASVGDRVTITCRASQDVSTAVAWYQQK 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 FALDYWGQGTLVTVSSGGGGSDIQMTQSPSSLSASVGDRVTITCRASQDVSTAVAWYQQK 180 Qy 181 PGKAPKLLIYSASFLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFG 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 PGKAPKLLIYSASFLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFG 240 Qy 241 QGTKVEIKGGGGSGGGGSEPKTSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTP 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 QGTKVEIKGGGGSGGGGSEPKTSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTP 300 Qy 301 EVTCVVVAVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYGSTYRVVSVLTVLHQDWLNGK 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 EVTCVVVAVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYGSTYRVVSVLTVLHQDWLNGK 360 Qy 361 EYKCKVSNKALPAPIEKTISKAKGQPREPMVFDLPPSREEMTKNQVSLWCMVKGFYPSDI 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 EYKCKVSNKALPAPIEKTISKAKGQPREPMVFDLPPSREEMTKNQVSLWCMVKGFYPSDI 420 Qy 421 AVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYT 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 421 AVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYT 480 Qy 481 QKSLSLSPGKGGGSGGGSGGGSGGGSGSTGEVQLVESGGGLVQPGGSLRLSCAASGFNIA 540 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 481 QKSLSLSPGKGGGSGGGSGGGSGGGSGSTGEVQLVESGGGLVQPGGSLRLSCAASGFNIA 540 Qy 541 YSSMHWVRQAPGKGLEWVATIYPSYSSTYYADSVKGRFTISADTSKNTAYLQMNSLRAED 600 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 541 YSSMHWVRQAPGKGLEWVATIYPSYSSTYYADSVKGRFTISADTSKNTAYLQMNSLRAED 600 Qy 601 TAVYYCARDYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPE 660 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 601 TAVYYCARDYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPE 660 Qy 661 PVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVD 720 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 661 PVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVD 720 Qy 721 KKVEPKSCDKTHT 733 ||||||||||||| Db 721 KKVEPKSCDKTHT 733 US-17-846-846-990 (NOTE: this sequence has 3 duplicates in the database searched. See complete list at the end of this report) Sequence 990, US/17846846 Publication No. US20230118983A1 GENERAL INFORMATION APPLICANT: ANTLERA THERAPEUTICS, INC. TITLE OF INVENTION: TETRAVALENT FZD AND WNT CO-RECEPTOR BINDING ANTIBODY MOLECULES TITLE OF INVENTION: AND USES THEREOF FILE REFERENCE: ANT-P3186USCIP CURRENT APPLICATION NUMBER: US/17/846,846 CURRENT FILING DATE: 2022-06-22 PRIOR APPLICATION NUMBER: 63/127,408 PRIOR FILING DATE: 2020-12-18 NUMBER OF SEQ ID NOS: 1063 SEQ ID NO 990 LENGTH: 735 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: Description of Artificial Sequence: Synthetic polypeptide Query Match 100.0%; Score 3875; Length 735; Best Local Similarity 100.0%; Matches 735; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 MNLLLILTFVAAAVAEVQLVESGGGLVQPGGSLRLSCAASGFTLSYSYIHWVRQAPGKGL 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MNLLLILTFVAAAVAEVQLVESGGGLVQPGGSLRLSCAASGFTLSYSYIHWVRQAPGKGL 60 Qy 61 EWVASIYSYTGATDYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARYWSTNRI 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 EWVASIYSYTGATDYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARYWSTNRI 120 Qy 121 LSYGGMDYWGQGTLVTVSSGGGGSDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWY 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 LSYGGMDYWGQGTLVTVSSGGGGSDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWY 180 Qy 181 QQKPGKAPKLLIYSASSLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQYFDPIT 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 QQKPGKAPKLLIYSASSLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQYFDPIT 240 Qy 241 FGQGTKVEIKGGGGSGGGGSEPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISR 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 FGQGTKVEIKGGGGSGGGGSEPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISR 300 Qy 301 TPEVTCVVVAVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYGSTYRVVSVLTVLHQDWLN 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 TPEVTCVVVAVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYGSTYRVVSVLTVLHQDWLN 360 Qy 361 GKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPIRELMTSNQVSLSCAVKGFYPS 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 GKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPIRELMTSNQVSLSCAVKGFYPS 420 Qy 421 DIAVEWESNGQPENNYKTTPPVLDSDGSFFLVSKLTVDKSRWQQGNVFSCSVMHEALHNH 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 421 DIAVEWESNGQPENNYKTTPPVLDSDGSFFLVSKLTVDKSRWQQGNVFSCSVMHEALHNH 480 Qy 481 YTQKSLSLSPGKGGGSGGGSGGGSGGGSGSTGEVQLVESGGGLVQPGGSLRLSCAASGFN 540 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 481 YTQKSLSLSPGKGGGSGGGSGGGSGGGSGSTGEVQLVESGGGLVQPGGSLRLSCAASGFN 540 Qy 541 IAYSSMHWVRQAPGKGLEWVATIYPSYSSTYYADSVKGRFTISADTSKNTAYLQMNSLRA 600 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 541 IAYSSMHWVRQAPGKGLEWVATIYPSYSSTYYADSVKGRFTISADTSKNTAYLQMNSLRA 600 Qy 601 EDTAVYYCARYYDMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYF 660 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 601 EDTAVYYCARYYDMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYF 660 Qy 661 PEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTK 720 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 661 PEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTK 720 Qy 721 VDKKVEPKSCDKTHT 735 ||||||||||||||| Db 721 VDKKVEPKSCDKTHT 735 US-17-846-846-991 (NOTE: this sequence has 3 duplicates in the database searched. See complete list at the end of this report) Sequence 991, US/17846846 Publication No. US20230118983A1 GENERAL INFORMATION APPLICANT: ANTLERA THERAPEUTICS, INC. TITLE OF INVENTION: TETRAVALENT FZD AND WNT CO-RECEPTOR BINDING ANTIBODY MOLECULES TITLE OF INVENTION: AND USES THEREOF FILE REFERENCE: ANT-P3186USCIP CURRENT APPLICATION NUMBER: US/17/846,846 CURRENT FILING DATE: 2022-06-22 PRIOR APPLICATION NUMBER: 63/127,408 PRIOR FILING DATE: 2020-12-18 NUMBER OF SEQ ID NOS: 1063 SEQ ID NO 991 LENGTH: 733 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: Description of Artificial Sequence: Synthetic polypeptide Query Match 100.0%; Score 3892; Length 733; Best Local Similarity 100.0%; Matches 733; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 MNLLLILTFVAAAVAEVQLVESGGGLVQPGGSLRLSCAASGFDLSHSSIHWVRQAPGKGL 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MNLLLILTFVAAAVAEVQLVESGGGLVQPGGSLRLSCAASGFDLSHSSIHWVRQAPGKGL 60 Qy 61 EWVASISSHYGYTHYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSSYFPWF 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 EWVASISSHYGYTHYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSSYFPWF 120 Qy 121 FALDYWGQGTLVTVSSGGGGSDIQMTQSPSSLSASVGDRVTITCRASQDVSTAVAWYQQK 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 FALDYWGQGTLVTVSSGGGGSDIQMTQSPSSLSASVGDRVTITCRASQDVSTAVAWYQQK 180 Qy 181 PGKAPKLLIYSASFLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFG 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 PGKAPKLLIYSASFLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFG 240 Qy 241 QGTKVEIKGGGGSGGGGSEPKTSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTP 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 QGTKVEIKGGGGSGGGGSEPKTSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTP 300 Qy 301 EVTCVVVAVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYGSTYRVVSVLTVLHQDWLNGK 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 EVTCVVVAVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYGSTYRVVSVLTVLHQDWLNGK 360 Qy 361 EYKCKVSNKALPAPIEKTISKAKGQPREPMVFDLPPSREEMTKNQVSLWCMVKGFYPSDI 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 EYKCKVSNKALPAPIEKTISKAKGQPREPMVFDLPPSREEMTKNQVSLWCMVKGFYPSDI 420 Qy 421 AVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYT 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 421 AVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYT 480 Qy 481 QKSLSLSPGKGGGSGGGSGGGSGGGSGSTGEVQLVESGGGLVQPGGSLRLSCAASGFNIA 540 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 481 QKSLSLSPGKGGGSGGGSGGGSGGGSGSTGEVQLVESGGGLVQPGGSLRLSCAASGFNIA 540 Qy 541 YSSMHWVRQAPGKGLEWVATIYPSYSSTYYADSVKGRFTISADTSKNTAYLQMNSLRAED 600 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 541 YSSMHWVRQAPGKGLEWVATIYPSYSSTYYADSVKGRFTISADTSKNTAYLQMNSLRAED 600 Qy 601 TAVYYCARYYDMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPE 660 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 601 TAVYYCARYYDMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPE 660 Qy 661 PVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVD 720 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 661 PVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVD 720 Qy 721 KKVEPKSCDKTHT 733 ||||||||||||| Db 721 KKVEPKSCDKTHT 733 S-17-846-846-992 (NOTE: this sequence has 3 duplicates in the database searched. See complete list at the end of this report) Sequence 992, US/17846846 Publication No. US20230118983A1 GENERAL INFORMATION APPLICANT: ANTLERA THERAPEUTICS, INC. TITLE OF INVENTION: TETRAVALENT FZD AND WNT CO-RECEPTOR BINDING ANTIBODY MOLECULES TITLE OF INVENTION: AND USES THEREOF FILE REFERENCE: ANT-P3186USCIP CURRENT APPLICATION NUMBER: US/17/846,846 CURRENT FILING DATE: 2022-06-22 PRIOR APPLICATION NUMBER: 63/127,408 PRIOR FILING DATE: 2020-12-18 NUMBER OF SEQ ID NOS: 1063 SEQ ID NO 992 LENGTH: 229 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: Description of Artificial Sequence: Synthetic polypeptide Query Match 100.0%; Score 1166; Length 229; Best Local Similarity 100.0%; Matches 229; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 MNLLLILTFVAAAVADIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPK 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MNLLLILTFVAAAVADIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPK 60 Qy 61 LLIYSASSLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQAHYFPITFGQGTKVE 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 LLIYSASSLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQAHYFPITFGQGTKVE 120 Qy 121 IKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTE 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 IKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTE 180 Qy 181 QDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 229 ||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 QDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 229
Read full office action

Prosecution Timeline

Jun 16, 2023
Application Filed
Jun 26, 2026
Non-Final Rejection mailed — §102, §DP (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12747301
USE OF LANCL1 AND ANTIBODIES THEREOF AS A DIAGNOSTIC AND THERAPEUTIC TARGET FOR THE MANAGEMENT AND TREATMENT OF CANCER
3y 6m to grant Granted Sep 29, 2026
Patent 12741010
IMMUNOMODULATORY & ONCOLYTIC MINICELLS AND METHODS OF USE
4y 10m to grant Granted Sep 22, 2026
Patent 12729239
ANTI-CEACAM5 ANTIBODIES AND CONJUGATES AND USES THEREOF
3y 6m to grant Granted Sep 08, 2026
Patent 12723092
Anti-CXCR2 Antibodies and Uses Thereof
2y 12m to grant Granted Sep 01, 2026
Patent 12698326
ANTI-CD19 ANTIBODY FORMULATIONS
4y 4m to grant Granted Aug 04, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

Strategy Recommendation AI-generated — please review before filing

Get a prosecution strategy drawn from examiner precedents, rejection analysis, and claim mapping.
Typically takes 5-10 seconds — AI-generated, attorney review required before filing

Prosecution Projections

1-2
Expected OA Rounds
67%
Grant Probability
99%
With Interview (+52.7%)
2y 11m (~0m remaining)
Median Time to Grant
Low
PTA Risk
Based on 770 resolved cases by this examiner. Grant probability derived from career allowance rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month