Prosecution Insights
Last updated: July 17, 2026
Application No. 18/268,104

COMPLEX OF ANTI-IL-4R ANTIBODY OR ANTIGEN-BINDING FRAGMENT THEREOF AND MEDICAL USE THEREOF

Non-Final OA §103
Filed
Jun 16, 2023
Priority
Dec 22, 2020 — CN 202011529235.1 +2 more
Examiner
LANDSMAN, ROBERT S
Art Unit
1647
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
Shanghai Shengdi Pharmaceutical Co. Ltd.
OA Round
1 (Non-Final)
81%
Grant Probability
Favorable
1-2
OA Rounds
0m
Est. Remaining
94%
With Interview

Examiner Intelligence

Grants 81% — above average
81%
Career Allowance Rate
1029 granted / 1264 resolved
+21.4% vs TC avg
Moderate +13% lift
Without
With
+13.1%
Interview Lift
resolved cases with interview
Fast prosecutor
2y 2m
Avg Prosecution
43 currently pending
Career history
1295
Total Applications
across all art units

Statute-Specific Performance

§101
0.6%
-39.4% vs TC avg
§103
24.2%
-15.8% vs TC avg
§102
10.8%
-29.2% vs TC avg
§112
27.1%
-12.9% vs TC avg
Black line = Tech Center average estimate • Based on career data from 1264 resolved cases

Office Action

§103
DETAILED ACITON Notice of Pre-AIA or AIA Status The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . 1. Formal Matters A. In the response filed 3/16/26, Applicants elected Group I, without traverse, drawn to the indicated species. Therefore, this restriction is deemed proper and is made FINAL. However, upon further consideration, all species have been examined. Applicants filed a supplemental response on 4/2/26, Applicants reiterated their elections. B. Claims 1-7, 9-14 and 16-23 are pending. Claims 20 and 21 are withdrawn as being drawn to a non-elected invention. Claims 1-7, 9-14, 16-19, 22 and 23 are the subject of this Office Action. 2. Claim Objections A. Claim 6 is objected to since the sequences need to be accompanied by SEQ ID NOs. These identifiers are found in paragraph [0051] of the specification. B. Claim 11 is objected to since the sequences need to be accompanied by SEQ ID NOs. These identifiers are found in paragraph [0071] of the specification. 3. Claim Rejections - 35 USC § 103 In the event the determination of the status of the application as subject to AIA 35 U.S.C. 102 and 103 (or as subject to pre-AIA 35 U.S.C. 102 and 103) is incorrect, any correction of the statutory basis (i.e., changing from AIA to pre-AIA ) for the rejection will not be considered a new ground of rejection if the prior art relied upon, and the rationale supporting the rejection, would be the same under either status. The following is a quotation of 35 U.S.C. 103 which forms the basis for all obviousness rejections set forth in this Office action: A patent for a claimed invention may not be obtained, notwithstanding that the claimed invention is not identically disclosed as set forth in section 102, if the differences between the claimed invention and the prior art are such that the claimed invention as a whole would have been obvious before the effective filing date of the claimed invention to a person having ordinary skill in the art to which the claimed invention pertains. Patentability shall not be negated by the manner in which the invention was made. The factual inquiries for establishing a background for determining obviousness under 35 U.S.C. 103 are summarized as follows: 1. Determining the scope and contents of the prior art. 2. Ascertaining the differences between the prior art and the claims at issue. 3. Resolving the level of ordinary skill in the pertinent art. 4. Considering objective evidence present in the application indicating obviousness or nonobviousness. This application currently names joint inventors. In considering patentability of the claims the examiner presumes that the subject matter of the various claims was commonly owned as of the effective filing date of the claimed invention(s) absent any evidence to the contrary. Applicant is advised of the obligation under 37 CFR 1.56 to point out the inventor and effective filing dates of each claim that was not commonly owned as of the effective filing date of the later invention in order for the examiner to consider the applicability of 35 U.S.C. 102(b)(2)(C) for any potential 35 U.S.C. 102(a)(2) prior art against the later invention. Claims 1-5, 7, 9, 10, 12, 16-19, 22 and 23 are rejected under 35 U.S.C. 103 as being obvious over Liao et al. (WO 2020/038454; cited as JIANGSU on the IDS filed 6/16/23) in view of Papadopoulos et al. (U.S Patent No. 9,302,015). Liao (see the attached English machine translation for paragraph references regarding the instant claim limitations) teaches a fully human IL-4R comprising SEQ ID NO:44 and 45, which are identical to instant SEQ ID NO:44 and 45, respectively (see sequence alignment below). See also the Abstract and paragraph [0064]. Therefore, Liao meet the sequence limitations for instant claims 1, 2, 7 and 9. Liao also teaches the germlines in instant claims 3 (paragraph [0067] and 4 ([0073]), as well as scFv and the IgG regions and of claim 5 ([0078]). Liao also teaches the pharmaceutical composition of claim 19 [0156], as well as the polynucleotide, vector, host cells and methods of preparing antibody in instant claims 16-18 and 22 ([0129]). Regarding claim 23, Liao also teaches fusion proteins ([0142]). Liao does not teach antibody-drug conjugates (ADCs). However, Papadopoulos does teach IL4R ADCs (Example 9 and Table 28 - columns 55 and 56). Claims 10 is taught in column 16, lines 1-52 of Papadopoulos, whereas claim 12 is taught in column 15, lines 54-58. Given this, it would have been obvious at the time of the instant invention to have used the IL4R complex of Liao in the IL4R ADC of Papadopoulos given the teachings of Papadopoulos regarding linking a toxin to a cell-/protein-targeting antibody for therapeutic purposes. Furthermore, though Liao does provide teachings regarding instant claim 16-18, 19 and 22, it is noted that Papadopoulos also meets these limitations. Regarding claims 16-18 and 22, see column 3, line 56 to column 5, line 36. Regarding claim 19, see column 23, lines 60-66. The applied reference has a common inventor/assignee with the instant application. Based upon the earlier effectively filed date of the reference, it constitutes prior art under 35 U.S.C. 102(a)(2). This rejection under 35 U.S.C. 103 might be overcome by: (1) a showing under 37 CFR 1.130(a) that the subject matter disclosed in the reference was obtained directly or indirectly from the inventor or a joint inventor of this application and is thus not prior art in accordance with 35 U.S.C.102(b)(2)(A); (2) a showing under 37 CFR 1.130(b) of a prior public disclosure under 35 U.S.C. 102(b)(2)(B); or (3) a statement pursuant to 35 U.S.C. 102(b)(2)(C) establishing that, not later than the effective filing date of the claimed invention, the subject matter disclosed and the claimed invention were either owned by the same person or subject to an obligation of assignment to the same person or subject to a joint research agreement. See generally MPEP § 717.02. SEQ ID NO:44 AC BHK60188; XX DT 16-APR-2020 (first entry) XX DE Anti-IL-4R humanized antibody heavy chain, SEQ ID 44. XX OS Synthetic. OS Unidentified. XX CC PN WO2020038454-A1. XX CC PD 27-FEB-2020. XX CC PF 23-AUG-2019; 2019WO-CN102169. XX PR 24-AUG-2018; 2018CN-10971269. PR 04-DEC-2018; 2018CN-11472752. PR 22-MAR-2019; 2019CN-10221311. PR 15-MAY-2019; 2019CN-10401923. XX CC PA (JSHR ) JIANGSU HENGRUI MEDICINE CO LTD. CC PA (JSHR ) SHANGHAI HENGRUI PHARM CO LTD. XX CC PI Liao C, Xu Z, Jiang J, Zhang L, Qian X, Teng F; XX DR WPI; 2020-176023/022. XX XX CC PS Claim 8; SEQ ID NO 44; 44pp; Chinese. XX SQ Sequence 445 AA; Query Match 100.0%; Score 2367; Length 445; Best Local Similarity 100.0%; Matches 445; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 EVQLVESGGGLVQPGGSLRLSCAASGFTFSDYGMHWVRQAPGKGLEWVAFISSGSSIIYY 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 EVQLVESGGGLVQPGGSLRLSCAASGFTFSDYGMHWVRQAPGKGLEWVAFISSGSSIIYY 60 Qy 61 ADIVKGRSTISRDNAKNTLYLQMNSLRAEDTAVYYCTRGNKRGFFDYWGQGTLVTVSSAS 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 ADIVKGRSTISRDNAKNTLYLQMNSLRAEDTAVYYCTRGNKRGFFDYWGQGTLVTVSSAS 120 Qy 121 TKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGL 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 TKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGL 180 Qy 181 YSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFL 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 YSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFL 240 Qy 241 FPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRV 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 FPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRV 300 Qy 301 VSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQ 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 VSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQ 360 Qy 361 VSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNV 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 VSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNV 420 Qy 421 FSCSVMHEALHNHYTQKSLSLSLGK 445 ||||||||||||||||||||||||| Db 421 FSCSVMHEALHNHYTQKSLSLSLGK 445 SEQ ID NO:45 CC PS Claim 8; SEQ ID NO 45; 44pp; Chinese. XX SQ Sequence 215 AA; Query Match 100.0%; Score 1119; Length 215; Best Local Similarity 100.0%; Matches 215; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 EIVLTQSPATLSLSPGERATLSCRASSSVPYMYWYQQKPGQAPRLLIYLTSNLASGIPAR 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 EIVLTQSPATLSLSPGERATLSCRASSSVPYMYWYQQKPGQAPRLLIYLTSNLASGIPAR 60 Qy 61 FSGSGSGTDFTLTISSLEPEDFAVYYCQQWRAYPPMLTFGGGTKVEIKRTVAAPSVFIFP 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 FSGSGSGTDFTLTISSLEPEDFAVYYCQQWRAYPPMLTFGGGTKVEIKRTVAAPSVFIFP 120 Qy 121 PSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 PSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL 180 Qy 181 TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 215 ||||||||||||||||||||||||||||||||||| Db 181 TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 215 B. Claim 6 is rejected under 35 U.S.C. 103 as being obvious over Liao et al. (WO 2020/038454; cited as JIANGSU on the IDS filed 6/16/23) in view of Papadopoulos et al. (U.S Patent No. 9,302,015) further in view of Holliger et al. The teachings of Liao and Papadopoulos are seen in paragraph A, above. Neither teaches a linker as recited in claim 6 for linking the heavy chain to the light chain in an scFv. However, as discussed in paragraph [00141] of Applicants’ specification, Holliger (Figure 1) does teach a GGGGS linker for this purpose. C. Claims 11 and 13 are rejected under 35 U.S.C. 103 as being obvious over Liao et al. (WO 2020/038454; cited as JIANGSU on the IDS filed 6/16/23) in view of Papadopoulos et al. (U.S Patent No. 9,302,015) further in view of Tsutsumi et al.. The teachings of Liao and Papadopoulos are seen in paragraph A, above. Neither teaches the linker recited in claim 11, nor a PE of claim 13. However, Tsutsumi does teach instant SEQ ID NO:62 linked to PE38 (Abstract) and states “[r]ecombinant immunotoxins are chimeric proteins in which a truncated toxin that serves as the cytotoxic moiety is fused to an Fv portion of an antibody that serves as the targeting moiety”. This meets the essential concept of the instant claims. Conclusion A. No claim is allowable. B. Claim 14 is objected to since it depends from a rejected base claim, but is otherwise allowable since SEQ ID NO:52 and 53 are free of the prior art. Advisory information Any inquiry concerning this communication or earlier communications from the examiner should be directed to ROBERT S LANDSMAN whose telephone number is 571-272-0888. The examiner can normally be reached M-F 8 AM – 6 PM (eastern). Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Joanne Hama, can be reached at 571-272-2911. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of an application may be obtained from the Patent Application Information Retrieval (PAIR) system. Status information for published applications may be obtained from either Private PAIR or Public PAIR. Status information for unpublished applications is available through Private PAIR only. For more information about the PAIR system, see http://pair-direct.uspto.gov. Should you have questions on access to the Private PAIR system, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). /ROBERT S LANDSMAN/Primary Examiner, Art Unit 1647
Read full office action

Prosecution Timeline

Jun 16, 2023
Application Filed
Apr 02, 2026
Response after Non-Final Action
Apr 22, 2026
Non-Final Rejection mailed — §103 (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12674001
BISPECIFIC ANTIBODIES BINDING TO 5T4 AND CD3 FOR USE IN TREATMENT OF CANCER
4y 3m to grant Granted Jul 07, 2026
Patent 12662545
MUSCLE-TARGETING COMPLEXES AND USES THEREOF
10m to grant Granted Jun 23, 2026
Patent 12649795
ANTI-IGF-1R ANTIBODIES AND USES THEREOF
3y 8m to grant Granted Jun 09, 2026
Patent 12637508
COMPOUNDS AND METHODS TARGETING HUMAN AND MOUSE INSL5
3y 4m to grant Granted May 26, 2026
Patent 12637513
METHOD OF TREATING CANCER BY ADMINISTERING AN INHIBITOR OF ERYTHROPOIETIN RECEPTOR ACTIVITY COMPRISING EITHER ERYTHROPOIETIN RECEPTOR OR ERYTHROPOIETIN PROTEIN
1y 8m to grant Granted May 26, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

Strategy Recommendation AI-generated — please review before filing

Get a prosecution strategy drawn from examiner precedents, rejection analysis, and claim mapping.
Typically takes 5-10 seconds — AI-generated, attorney review required before filing

Prosecution Projections

1-2
Expected OA Rounds
81%
Grant Probability
94%
With Interview (+13.1%)
2y 2m (~0m remaining)
Median Time to Grant
Low
PTA Risk
Based on 1264 resolved cases by this examiner. Grant probability derived from career allowance rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month