Prosecution Insights
Last updated: October 02, 2026
Application No. 18/271,173

ENGINEERED STABLE ACE2 PROTEIN VARIANTS AS ANTIVIRAL NEBULIZED THERAPEUTICS

Final Rejection §102§112
Filed
Jul 06, 2023
Priority
Jan 07, 2021 — provisional 63/134,751 +1 more
Examiner
CHANDRA, GYAN
Art Unit
1674
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
Board of Regents of the University of Texas System
OA Round
2 (Final)
71%
Grant Probability
Favorable
3-4
OA Rounds
0m
Est. Remaining
99%
With Interview

Examiner Intelligence

Grants 71% — above average
71%
Career Allowance Rate
720 granted / 1010 resolved
+11.3% vs TC avg
Strong +28% interview lift
Without
With
+27.5%
Interview Lift
resolved cases with interview
Typical timeline
2y 6m
Avg Prosecution
34 currently pending
Career history
1036
Total Applications
across all art units

Statute-Specific Performance

§101
4.0%
-36.0% vs TC avg
§103
31.8%
-8.2% vs TC avg
§102
14.8%
-25.2% vs TC avg
§112
30.3%
-9.7% vs TC avg
Black line = Tech Center average estimate • Based on career data from 1010 resolved cases

Office Action

§102 §112
DETAILED ACTION Notice of Pre-AIA or AIA Status The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . Applicant’s response filed on 8/5/2026 is acknowledged and fully considered. Status of Application, Amendments, And/Or Claims The amendments of claims 1,4-8, and 10-11 have been made of record. Claims 1-23 are pending. Claims 15-23 remain withdrawn for being drawn to non-elected inventions (i.e., Groups 8-14). Claims 1-14 are under examination to the extent they read on elected invention. Information Disclosure Statement The Information Disclosure Statement filed on 6/24/2026 has been considered. Response to Arguments Claim Rejections - 35 USC § 112-maintained The following is a quotation of 35 U.S.C. 112(b): (b) CONCLUSION.—The specification shall conclude with one or more claims particularly pointing out and distinctly claiming the subject matter which the inventor or a joint inventor regards as the invention. The following is a quotation of 35 U.S.C. 112 (pre-AIA ), second paragraph: The specification shall conclude with one or more claims particularly pointing out and distinctly claiming the subject matter which the applicant regards as his invention. Claims 8 remains rejected under 35 U.S.C. 112(b) or 35 U.S.C. 112 (pre-AIA ), second paragraph, as being indefinite for failing to particularly point out and distinctly claim the subject matter which the inventor or a joint inventor (or for applications subject to pre-AIA 35 U.S.C. 112, the applicant), regards as the invention. Claims 8 recites the limitation "The recombinant protein of claim" in line 1. There is insufficient antecedent basis for this limitation in the claim. Applicant should indicate the base claim from which it depends. Claim Rejections - 35 USC § 112-withdrawn The rejection of claims 1-6 and 9-14 are rejected under 35 U.S.C. 112(a) or 35 U.S.C. 112 (pre-AIA ), first paragraph, as failing to comply with the written description requirement is withdrawn in view of applicants’ amendments to claim 1 to recite “the fragment having at least 95% identity to amino acid sequence of SEQ ID NO: 4”. Claim Rejections - 35 USC § 102-withdrawn The rejection of claim(s) 1-6, and 9-14 under 35 U.S.C. 102(a)(2) as being anticipated by Han et al (US Pat. No. 11,518,788, claims priority to US provisional 63/050473 filed on 7/10/2020) is withdrawn necessitated by applicant’s amendment to claim 1 to recite “the fragment having at least 95% identity to amino acid sequence of SEQ ID NO: 4”. However, a new ground of rejection is made in view of applicants’ amendments to the claims. New Ground of Rejection Necessitated by Applicant’s Amendments Claim Rejections - 35 USC § 102 (a)(2) the claimed invention was described in a patent issued under section 151, or in an application for patent published or deemed published under section 122(b), in which the patent or application, as the case may be, names another inventor and was effectively filed before the effective filing date of the claimed invention. Claim(s) 1-4, 7-14 is/are rejected under 35 U.S.C. 102(a)(2) as being anticipated by Mammedov (WO 2022/115083 claims priority to US Provisional 63/117,487 filed on 11/22/2020). Mammedov et al. teach a polypeptide having amino acid sequence of SEQ ID NO: 2 that comprises a signal peptide and the amino acid sequence homology is about 95.6 % (see sequence alignment below) to the instantly claimed 95% sequence identity to the amino acid sequence of SEQ ID NO: 4. They teach that the protein is for treating COVID-19 (see claim 13). They teach a composition comprising Phosphate buffer saline (PBS) (see pg. 15, line 20+). The recombinant protein binds to SARS-CoV-2 (see page 14, line29+). Because the claimed limitation of a polypeptide having 95% sequence is met, the limitations of other claims are also implicitly met, unless evidence to contrary. RESULT 15 BLD99702 ID BLD99702 standard; protein; 763 AA. XX AC BLD99702; XX DT 07-JUL-2022 (first entry) XX DE Human recombinant ACE2 protein, SEQ 2. XX KW ACE2 protein; Angiotensin converting enzyme 2; protein production; KW protein therapy; therapeutic. XX OS Homo sapiens. OS Synthetic. XX CC PN WO2022115083-A1. XX CC PD 02-JUN-2022. XX CC PF 23-NOV-2021; 2021WO-TR051277. XX PR 24-NOV-2020; 2020US-0117487P. XX CC PA (UYAK-) UNIV AKDENIZ. XX CC PI Mammedov T; XX DR WPI; 2022-74647P/049. DR N-PSDB; BLD99701. XX CC PT Generating polypeptide of glycosylated angiotensin-converting enzyme 2 by CC PT replacing signal peptide of human angiotensin-converting enzyme 2 with CC PT Nicotiana tabacum signal peptide, constructing artificial gene, inserting CC PT into vector, introducing into Agrobacterium, and producing polypeptide. XX CC PS Claim 1; SEQ ID NO 2; 36pp; English. XX CC The present invention relates to a method for generating a polypeptide of CC glycosylated angiotensin-converting enzyme 2 (ACE2) in a plant cell. The CC method involves: (a) replacing signal peptide of human ACE2 with CC Nicotiana tabacum PR-1 a signal peptide of SEQ ID NO:7 (see BLD99707), CC adding endoplasmic reticulum (ER) retention signal of SEQ ID NO:6 (see CC BLD99706), adding His6 tag coding sequence to C-terminus and constructing CC an artificial ACE2 gene; (b) inserting the constructed ACE2 gene into CC small binary vector tailored for transient expression (pEAQ vector) to CC obtain pEAQ-ACE2-His6-KDEL plasmid having a base pair sequence having at CC least 90 percent sequence identity to sequence of SEQ ID NO:1 (see CC BLD99701); (c) introducing pEAQ-ACE2-His6-KDEL plasmid into an CC Agrobacterium construct; and (d) performing infiltration of the CC Agrobacterium construct carrying the pEAQ-ACE2-His6-KDEL plasmid into a CC plant cell and producing a polypeptide of glycosylated ACE2 of SEQ ID NO: CC 2 (see BLD99702). The method of the invention is useful for treating CC COVID-19 infection. XX SQ Sequence 763 AA; Query Match 95.6%; Score 3924.5; Length 763; Best Local Similarity 97.1%; Matches 733; Conservative 4; Mismatches 9; Indels 9; Gaps 1; Qy 4 LVNVALVFMVVYISYIYASTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQ 63 ||: |:|:|: | |||||||||||||||||||||||||||||||||||||||||| Db 14 LVSTLLLFLVISHSCRAQSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQ 73 Qy 64 NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTIL 123 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 74 NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTIL 133 Qy 124 NTMSTIYSTGKVCNPDNPQECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLY 183 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 134 NTMSTIYSTGKVCNPDNPQECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLY 193 Qy 184 EEYVVLKNEMARANHYEDYGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHL 243 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 194 EEYVVLKNEMARANHYEDYGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHL 253 Qy 244 HAYVRAKLMNAYPSYISPIGCLPAHLLGDMWGRFWTNLYSLTVPFGQKPNIDVTDAMVDQ 303 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 254 HAYVRAKLMNAYPSYISPIGCLPAHLLGDMWGRFWTNLYSLTVPFGQKPNIDVTDAMVDQ 313 Qy 304 AWDAQRIFKEAEKFFVSVGLPNMTQGFWENSMLTDPGNVQKAVCHPTAWDLGKGDFRILM 363 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 314 AWDAQRIFKEAEKFFVSVGLPNMTQGFWENSMLTDPGNVQKAVCHPTAWDLGKGDFRILM 373 Qy 364 CTKVTMDDFLXAHHEMGHIQYDMAYAAQPFLLRNGANEGFHEAVGEIMSLSAATPKHLKS 423 |||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||| Db 374 CTKVTMDDFLTAHHEMGHIQYDMAYAAQPFLLRNGANEGFHEAVGEIMSLSAATPKHLKS 433 Qy 424 IGLLSPDFQEDNETEINFLLKQALTIVGTLPFTYMLEKWRWMVFKGEIPKDQWMKKWWEM 483 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 434 IGLLSPDFQEDNETEINFLLKQALTIVGTLPFTYMLEKWRWMVFKGEIPKDQWMKKWWEM 493 Qy 484 KREIVGVVEPVPHDETYCDPASLFHVSNDYSFIRYYTRTLYQFQFQEALCQAAKHEGPLH 543 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 494 KREIVGVVEPVPHDETYCDPASLFHVSNDYSFIRYYTRTLYQFQFQEALCQAAKHEGPLH 553 Qy 544 KCDISNSTEAGQKLFNMLRLGKSEPWTLALENVVGAKNMNVRPLLNYFEPLFTWLKDQNK 603 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 554 KCDISNSTEAGQKLFNMLRLGKSEPWTLALENVVGAKNMNVRPLLNYFEPLFTWLKDQNK 613 Qy 604 NSFVGWSTDWSPYADQSIKVRISLKSALGDKAYEWNDNEMYLFRSSVAYAMRQYFLKVKN 663 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 614 NSFVGWSTDWSPYADQSIKVRISLKSALGDKAYEWNDNEMYLFRSSVAYAMRQYFLKVKN 673 Qy 664 QMILFGEEDVRVANLKPRISFNFFVTAPKNVSDIIPRTEVEKAIRMSRSRINDAFRLNDN 723 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 674 QMILFGEEDVRVANLKPRISFNFFVTAPKNVSDIIPRTEVEKAIRMSRSRINDAFRLNDN 733 Qy 724 SLEFLGIQPTLGPPNQPPVSENLYFQGTGHHHHHH 758 |||||||||||||||||||| |||||| Db 734 SLEFLGIQPTLGPPNQPPVS---------HHHHHH 759 Conclusion Claims 1-4 and 7-14 are rejected. Claims 5-6 are objected to as being dependent upon a rejected base claim but would be allowable if rewritten in independent form including all of the limitations of the base claim and any intervening claims. Applicant's amendment necessitated the new ground(s) of rejection presented in this Office action. Accordingly, THIS ACTION IS MADE FINAL. See MPEP § 706.07(a). Applicant is reminded of the extension of time policy as set forth in 37 CFR 1.136(a). A shortened statutory period for reply to this final action is set to expire THREE MONTHS from the mailing date of this action. In the event a first reply is filed within TWO MONTHS of the mailing date of this final action, and the advisory action is not mailed until after the end of the THREE-MONTH shortened statutory period, then the shortened statutory period will expire on the date the advisory action is mailed, and any nonprovisional extension fee (37 CFR 1.17(a)) pursuant to 37 CFR 1.136(a) will be calculated from the mailing date of the advisory action. In no event, however, will the statutory period for reply expire later than SIX MONTHS from the mailing date of this final action. Any inquiry concerning this communication or earlier communications from the examiner should be directed to GYAN CHANDRA whose telephone number is (571)272-2922. The examiner can normally be reached Mon-Friday 8:30AM-5:00P. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Vanessa Ford can be reached at 571-272-0857. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /GYAN CHANDRA/Primary Examiner, Art Unit 1674
Read full office action

Prosecution Timeline

Jul 06, 2023
Application Filed
May 06, 2026
Non-Final Rejection mailed — §102, §112
Aug 05, 2026
Response Filed
Sep 09, 2026
Final Rejection mailed — §102, §112 (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12742000
INSULIN-FC FUSION PROTEINS AND METHODS OF USE TO TREAT CANCER
3y 4m to grant Granted Sep 22, 2026
Patent 12723097
Anti-CD45 Antibody Drug Conjugates and Uses Thereof
4y 10m to grant Granted Sep 01, 2026
Patent 12708659
Polyphenolic Insulin
3y 6m to grant Granted Aug 18, 2026
Patent 12702718
PROTEIN-ENCLOSING POLYMERIC MICELLE
4y 7m to grant Granted Aug 11, 2026
Patent 12698314
EXTENDED TIME ACTION ACYLATED INSULIN COMPOUNDS
3y 9m to grant Granted Aug 04, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

Strategy Recommendation AI-generated — please review before filing

Get a prosecution strategy drawn from examiner precedents, rejection analysis, and claim mapping.
Typically takes 5-10 seconds — AI-generated, attorney review required before filing

Prosecution Projections

3-4
Expected OA Rounds
71%
Grant Probability
99%
With Interview (+27.5%)
2y 6m (~0m remaining)
Median Time to Grant
Moderate
PTA Risk
Based on 1010 resolved cases by this examiner. Grant probability derived from career allowance rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month