Prosecution Insights
Last updated: April 19, 2026
Application No. 18/275,442

Fusion Proteins for CRISPR-based Transcriptional Repression

Non-Final OA §102§103§112
Filed
Aug 02, 2023
Examiner
ROBINSON, HOPE A
Art Unit
1652
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
Dharmacon Inc.
OA Round
1 (Non-Final)
68%
Grant Probability
Favorable
1-2
OA Rounds
3y 5m
To Grant
99%
With Interview

Examiner Intelligence

Grants 68% — above average
68%
Career Allow Rate
700 granted / 1032 resolved
+7.8% vs TC avg
Strong +43% interview lift
Without
With
+43.0%
Interview Lift
resolved cases with interview
Typical timeline
3y 5m
Avg Prosecution
70 currently pending
Career history
1102
Total Applications
across all art units

Statute-Specific Performance

§101
5.2%
-34.8% vs TC avg
§103
20.1%
-19.9% vs TC avg
§102
17.7%
-22.3% vs TC avg
§112
47.0%
+7.0% vs TC avg
Black line = Tech Center average estimate • Based on career data from 1032 resolved cases

Office Action

§102 §103 §112
DETAILED ACTION Notice of Pre-AIA or AIA Status 1. The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . 2. The Preliminary Amendments filed on August 2, 2023 and November 3, 2025, has been received and entered. 3. Applicant’s election without traverse of Group I (with SUDS3 species (SEQ ID NO: 2), claims 1, 4, 7-8 and 24) on November 3, 2025, is acknowledged. Claim Disposition 4. Claims 1, 4-8, 24, 44, 48, 50, 92, 100 and 103 are pending. Claims 1, 4, 7-8 and 24 are under examination. Claims 5-6, 44, 48, 50, 92, 100 and 103 are withdrawn from further consideration pursuant to 37 CFR 1.12(b), as being drawn to a non-elected invention, there being no allowable generic or linking claim. The species SALL1 has been rejoined with SUDS3, however, other repressor domains and NIPPI repressor domains are withdrawn. Information Disclosure Statement 5. The Information Disclosure Statements filed on August 2, 2023, July 18, 2025 and December 23, 2025, have been received and entered. The references cited on the PTO-1449 Form have been considered by the examiner and a copy is attached to the instant Office action. Drawing 6. The drawings filed on August 2, 2023, have been accepted by the examiner. Specification Objection 7. The specification is objected to for the following informalities: The specification is also objected to because it contains an embedded hyperlink and/or other form of browser-executable code. Applicant is required to delete the embedded hyperlink and/or other form of browser-executable code. See MPEP § 608.01. See page 14, for example. It is suggested that http:// is deleted. On page 58, at line 23 there is an extraneous period (.). Appropriate correction is required. Claim objection 8. Claims 1, 4, 7-8 and 24 are objected to for the following informalities: For clarity and precision of claim language it is suggested that claim 1 is amended to recite, “….SUDS3 repressor domain, wherein in the Cas protein is a nickase and wherein the Cas fusion protein regulates gene expression by specifically targeting and editing genes”. The dependent claim hereto is also included. For clarity it is suggested that claim 24 is amended to delete “similar” and instead recite “sequence identity” (i.e. at least 80% identical to SEQ ID NO:”). Appropriate correction is required. Claim Rejections - 35 USC § 112 The following is a quotation of the first paragraph of 35 U.S.C. 112(a): (a) IN GENERAL.—The specification shall contain a written description of the invention, and of the manner and process of making and using it, in such full, clear, concise, and exact terms as to enable any person skilled in the art to which it pertains, or with which it is most nearly connected, to make and use the same, and shall set forth the best mode contemplated by the inventor or joint inventor of carrying out the invention. The following is a quotation of the first paragraph of pre-AIA 35 U.S.C. 112: The specification shall contain a written description of the invention, and of the manner and process of making and using it, in such full, clear, concise, and exact terms as to enable any person skilled in the art to which it pertains, or with which it is most nearly connected, to make and use the same, and shall set forth the best mode contemplated by the inventor of carrying out his invention. 9. Claims 1, 4, 7-8 and 24 are rejected under 35 U.S.C. 112(a) or 35 U.S.C. 112 (pre-AlA), first paragraph, as failing to comply with the written description requirement. The claim(s) contains subject matter which was not described in the specification in such a way as to reasonably convey to one skilled in the relevant art that the inventor or a joint inventor, or for applications subject to pre-AIA 35 U.S.C. 112, the inventor(s), at the time the application was filed, had possession of the claimed invention. The claimed invention is directed to a Cas fusion protein comprising a Cas protein and one or both of a SALL1 repressor domain and a SUDS3 repressor domain, wherein the Cas protein is catalytically inactive…”. The claimed invention is not adequately described because there is no structure-function correlation. The claimed invention in claim 1 is devoid of any structural and functional limitations and note that claim 7 recites that the Cas protein is catalytically inactive. The invention as claimed encompasses a board variable genus of structures with no alignment of an activity. The invention as disclosed does not demonstrate possession of the entire genus. The specification discloses that the claimed invention involves transcriptional repression. It is noted that claim 24 recites a structure for the repressor domains, however no structure is found in claim 1 which needs to stand on its own. In addition, no specific Cas protein is provided. The specification discloses that “examples of Cas proteins include but are not limited to: Casl, CaslB, Cas2, Cas3,Cas4, Cass,CasSe (CasD), Cas6,Cas6e, Cas6f, Cas7, Cas8al,Cas8a2, Cas8b, Cas8c, Cas9 (Csnl or Csx12), CaslO,CaslOd, Cas12a, Cas12b, Cas12c, Cas12d, Cas12e, Cas12f, Cas12h, Cas12i, Cas12j, Mad7, CasX, CasY,Cas 13a,Cas14, C2cl,C2c2, C2c3, CasF, CasG,CasH,Csyl, Csy2, Csy3, Csel (CasA), Cse2 (CasB), Cse3 (CasE), Cse4 (CasC), Cscl, Csc2, Csa5,Csn2, Csm2, Csm3, Csm4, Csm5,Csm6, Cmrl, Cmr3, Cmr4, Cmr5,Cmr6, Csbl, Csb2, Csb3, Csx17, Csx14, CsxlO,Csx16, CsaX, Csx3, Csxl,Csx15, Csfl, Csf2, Csf3, Csf4, and Cul966, and homologs or modified versions thereof”(see paragraph [75]). It is also disclosed at paragraph [77] that, “modified versions of Cas proteins that may be used in the present invention, include but are not limited to catalytically inactive versions such as dCas9 and dCas12 or versions that have modified attenuated catalytic activity to provide a nicking function such as the nickase nCas9”. Note that claim 1 is not limited to any of this disclosure. Thus, the claimed invention is not commensurate in scope with the disclosure and no correlation is made between structure and function. Moreover note that the claimed invention is directed to a Cas fusion protein with a SUDS3 repressor domain that is at least 80% identical to SEQ ID NO:2 which encompasses a large variable genus of structures that are not adequately described. The specification fails to provide a representative number of species for the claimed genus to show that applicant was in possession of the claimed genus. A representative number of species means that the species, which are adequately described, are representative of the entire genus. The claimed embodiments encompasses any Cas protein fused with any SALL1 and/or SUDS3 repressor domains, and having at least 80% similarity with the recited structures. The written description requirement for a claimed genus may be satisfied through sufficient description of a representative number of species by actual reduction to practice, disclosure of drawings, or by disclosure of relevant identifying characteristics, for example, structure or other physical and/or chemical properties, by functional characteristics coupled with a known or disclosed correlation between function and structure, or by a combination of such identifying characteristics, sufficient to show the applicant was in possession of the claimed genus. Vas-Cath Inc. v. Mahurkar, 935 F.2d 1555, 1563-64, 19 USPQ2d 1111, 1117 (Fed. Cir. 1991), states that "applicant must convey with reasonable clarity to those skilled in the art that, as of the filing date sought, he or she was in possession of the invention. The invention is, for purposes of the ‘written description’ inquiry, whatever is now claimed" (See page 1117). The specification does not "clearly allow persons of ordinary skill in the art to recognize that [he or she] invented what is claimed" (See Vas-Cath at page 1116). The skilled artisan cannot envision the detailed chemical structure of the encompassed genus, and therefore, conception is not achieved until reduction to practice has occurred, regardless of the complexity or simplicity of the method of isolation. Adequate written description requires more than a mere statement that it is part of the invention and reference to a potential method of isolating it. The compound itself is required. See Fiers v. Revel, 25 USPQ2d 1601 at 1606 (CAFC 1993). Therefore, for all these reasons the specification lacks adequate written description, and one of skill in the art cannot reasonably conclude that the applicant had possession of the claimed invention at the time the instant application was filed. Claim Rejections - 35 USC § 102 The following is a quotation of the appropriate paragraphs of 35 U.S.C. 102 that form the basis for the rejections under this section made in this Office action: A person shall be entitled to a patent unless – (a)(1) the claimed invention was patented, described in a printed publication, or in public use, on sale, or otherwise available to the public before the effective filing date of the claimed invention. 10. Claim(s) 1 and 7 is/are rejected under 35 U.S.C. 102(a)(1) as being anticipated by Broad Institute Inc. (hereafter Broad), of record in the application. The reference teaches a Cas fusion protein comprising a Cas protein and one or both of a SALL1 repressor domain and a SUDS3 repressor domain (Abstract- The invention provides for systems, methods, and compositions for altering expression of target gene sequences and related gene products. Provided are structural information on the Cas protein of the CRISPR-Cas system, use of this information in generating modified components of a CRISPR complex, as well as methods for the design and use of such vectors and components. Also provided are methods of directing CRISPR complex formation in eukaryotic cells and methods for utilizing the CRISPR-Cas system. In particular the present invention comprehends optimized functional CRISPR-Cas enzyme systems, (claim 11-‘The composition of claim 4, wherein the adaptor protein and the functional domain, the linker optionally including a GlySer linker, (paragraph [0088])-The activated CRISPR enzyme may have associated (e.g. via fusion protein) one or more functional domains, like for example as described herein for the modified sgRNA adaptor proteins, (including for example, one or more domains from methylase activity, demethylase activity, transcription activation activity, transcription repression activity, (paragraph [0539]-In some embodiment, the functional domain may be a HDAC Recruiter Effector Domain. Preferred examples include those in the Table below, namely MeCP2, MBD2b, Sin3a, NcoR, Sall1, RCOR1. With regard to claim 7 Broad teaches the Cas fusion protein is catalytically inactive (see paragraph [0036]-‘The invention provides a method for directing a CRISPR-Cas9 system, including but not limited to a dead Cas9 (dCas9)’. Therefore, the limitations of the claims are met by the reference. Claim Rejections - 35 USC § 103 The following is a quotation of 35 U.S.C. 103 which forms the basis for all obviousness rejections set forth in this Office action: A patent for a claimed invention may not be obtained, notwithstanding that the claimed invention is not identically disclosed as set forth in section 102, if the differences between the claimed invention and the prior art are such that the claimed invention as a whole would have been obvious before the effective filing date of the claimed invention to a person having ordinary skill in the art to which the claimed invention pertains. Patentability shall not be negated by the manner in which the invention was made. 11. This application currently names joint inventors. In considering patentability of the claims the examiner presumes that the subject matter of the various claims was commonly owned as of the effective filing date of the claimed invention(s) absent any evidence to the contrary. Applicant is advised of the obligation under 37 CFR 1.56 to point out the inventor and effective filing dates of each claim that was not commonly owned as of the effective filing date of the later invention in order for the examiner to consider the applicability of 35 U.S.C. 102(b)(2)(C) for any potential 35 U.S.C. 102(a)(2) prior art against the later invention. 12. Claim(s) 1, 4, 7-8 and 24 is/are rejected under 35 U.S.C. 103 as being unpatentable over Broad Institute Inc. ((hereafter Broad), of record in the application) in view of Gearing (CRISPR 101: Cas 9 Nickase Design &Homology ), Kwon et al. (Nature Communication), US Patent No. 8586006, Aug 2007 (alignment, below ) and Reint et al. (eLife, 2021). The teaching of Broad pertaining to claims 1 and 7 are above. The primary reference is silent on ‘nickase’, however, it is known in the art. Gearing teach that CRISPR nickase creates a single strand rather than a double stranded break (Cas9 nickase) which is advantageous, see abstract. Furthermore, Kwon et al. teach cas9 based histone deacetylase (HDAC). It is well established in the art the SUDS3 and HDACs work together as core components of the Sin3/HDAC corepressor complex, a crucial machinery for regulating gene expression (SUDS3 acts as the adaptor protein helping assemble the complex with SIN3A and recruiting HDAC enzymes to specific DNA regions, influencing cell growth, development and inflammation). Kwon on page 2 teaches modulation of gene expression by transfected dCas9-HDAC3 (a fusion protein with catalytically inactive Cas protein and repressor domain complex). In addition, the art is replete with references that teach structures that are at least 80% or more identical to SEQ ID NO:2, one such alignment is provided below, thus the structure is not novel and certainly obvious. Furthermore, Reint et al. teach genome editing using CRISPR-Cas9-POLD3 fusion (see abstract and page 1). It is well established in the art that SUDS3 is equivalent to SDS3 and POLD3. Therefore, it would have been obvious for one of ordinary skill in the art before the effective filing date of the claimed invention to arrive at the claimed invention as a whole because the combined teaching of the references renders the claims as obvious. The references are considered to be analogous art, thus motivation to combine exists. The cited references in combination teaches a Cas fusion protein comprising a Cas protein and a repressor that is SALL1 or SUDS3/POLD3 and renders obvious nickase, catalytically inactive and a structure at least 80% identical to SEQ ID NO:2. Moreover, the Supreme Court pointed out in KSR, “a patent composed of several elements is not proved obvious merely by demonstrating that each of its elements was, independently, known in the prior art.” KSR, 127 S. Ct. at 1741. The Court thus reasoned that the analysis under 35 U.S.C. 103 "need not seek out precise teachings directed to the specific subject matter of the challenged claim, for a court can take account of the “inferences and creative steps that a person of ordinary skill in the art would employ.” Id. at 1741. The Court further advised that “[a] person of ordinary skill is…a person of ordinary creativity, not an automation.” Id. at 1742. Therefore, the claimed invention was obvious to make and use at the time the invention was made and was prima facie obvious. ALIGNMENT RESULT 1 US-12-376-951A-29328 (NOTE: this sequence has 9 duplicates in the database searched. See complete list at the end of this report) Sequence 29328, US/12376951A Patent No. 8586006 GENERAL INFORMATION APPLICANT: HOOD, Leroy APPLICANT: BECKMANN, M. Patricia APPLICANT: JOHNSON, Richard APPLICANT: MARELLI, Marcello APPLICANT: LI, Xiaojun TITLE OF INVENTION: ORGAN-SPECIFIC PROTEINS AND METHODS OF THEIR USE FILE REFERENCE: 655652003300 CURRENT APPLICATION NUMBER: US/12/376,951A CURRENT FILING DATE: 2011-12-20 PRIOR APPLICATION NUMBER: PCT/US2007/017868 PRIOR FILING DATE: 2007-08-09 PRIOR APPLICATION NUMBER: US 60/836,986 PRIOR FILING DATE: 2006-08-09 NUMBER OF SEQ ID NOS: 72689 SEQ ID NO 29328 LENGTH: 328 TYPE: PRT ORGANISM: Homo sapiens Query Match 100.0%; Score 1676; Length 328; Best Local Similarity 100.0%; Matches 328; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 MSAAGLLAPAPAQAGAPPAPEYYPEEDEELESAEDDERSCRGRESDEDTEDASETDLAKH 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MSAAGLLAPAPAQAGAPPAPEYYPEEDEELESAEDDERSCRGRESDEDTEDASETDLAKH 60 Qy 61 DEEDYVEMKEQMYQDKLASLKRQLQQLQEGTLQEYQKRMKKLDQQYKERIRNAELFLQLE 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 DEEDYVEMKEQMYQDKLASLKRQLQQLQEGTLQEYQKRMKKLDQQYKERIRNAELFLQLE 120 Qy 121 TEQVERNYIKEKKAAVKEFEDKKVELKENLIAELEEKKKMIENEKLTMELTGDSMEVKPI 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 TEQVERNYIKEKKAAVKEFEDKKVELKENLIAELEEKKKMIENEKLTMELTGDSMEVKPI 180 Qy 181 MTRKLRRRPNDPVPIPDKRRKPAPAQLNYLLTDEQIMEDLRTLNKLKSPKRPASPSSPEH 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 MTRKLRRRPNDPVPIPDKRRKPAPAQLNYLLTDEQIMEDLRTLNKLKSPKRPASPSSPEH 240 Qy 241 LPATPAESPAQRFEARIEDGKLYYDKRWYHKSQAIYLESKDNQKLSCVISSVGANEIWVR 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 LPATPAESPAQRFEARIEDGKLYYDKRWYHKSQAIYLESKDNQKLSCVISSVGANEIWVR 300 Qy 301 KTSDSTKMRIYLGQLQRGLFVIRRRSAA 328 |||||||||||||||||||||||||||| Db 301 KTSDSTKMRIYLGQLQRGLFVIRRRSAA 328 Conclusion 13. No claims are presently allowable. Any inquiry concerning this communication or earlier communications from the examiner should be directed to HOPE A ROBINSON whose telephone number is (571) 272-0957. The examiner can normally be reached 9-5pm on Monday to Friday. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Robert Mondesi can be reached on (408) 918-7584. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /HOPE A ROBINSON/Primary Examiner, Art Unit 1652
Read full office action

Prosecution Timeline

Aug 02, 2023
Application Filed
Jan 14, 2026
Non-Final Rejection — §102, §103, §112
Jan 27, 2026
Applicant Interview (Telephonic)
Jan 29, 2026
Examiner Interview Summary

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12595493
METHANATION METHOD IN A BIOREACTOR UNDER CONTINUOUS CELL-RETENTION CONDITIONS
2y 5m to grant Granted Apr 07, 2026
Patent 12584157
METHOD FOR PRODUCING GAMMA-GLUTAMYL-VALYL-GLYCINE AND/OR A SALT THEREOF
2y 5m to grant Granted Mar 24, 2026
Patent 12559374
PROCESS FOR PRODUCING GRAPHENE DOPED WITH NITROGEN AND SULFUR
2y 5m to grant Granted Feb 24, 2026
Patent 12553069
Isopropylmalate synthase polypeptide variant and a method for producing L-leucine using the same
2y 5m to grant Granted Feb 17, 2026
Patent 12553071
GENETICALLY ENGINEERED STRAINS WITH REDUCED BYPRODUCT FORMATION
2y 5m to grant Granted Feb 17, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

AI Strategy Recommendation

Get an AI-powered prosecution strategy using examiner precedents, rejection analysis, and claim mapping.
Powered by AI — typically takes 5-10 seconds

Prosecution Projections

1-2
Expected OA Rounds
68%
Grant Probability
99%
With Interview (+43.0%)
3y 5m
Median Time to Grant
Low
PTA Risk
Based on 1032 resolved cases by this examiner. Grant probability derived from career allow rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month