Prosecution Insights
Last updated: October 02, 2026
Application No. 18/280,362

VLP ENTEROVIRAL VACCINES

Non-Final OA §103
Filed
Sep 05, 2023
Priority
Mar 05, 2021 — provisional 63/157,543 +1 more
Examiner
BOESEN, AGNIESZKA
Art Unit
1672
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
ModernaTX Inc.
OA Round
1 (Non-Final)
68%
Grant Probability
Favorable
1-2
OA Rounds
1m
Est. Remaining
90%
With Interview

Examiner Intelligence

Grants 68% — above average
68%
Career Allowance Rate
577 granted / 842 resolved
+8.5% vs TC avg
Strong +22% interview lift
Without
With
+21.8%
Interview Lift
resolved cases with interview
Typical timeline
3y 2m
Avg Prosecution
24 currently pending
Career history
866
Total Applications
across all art units

Statute-Specific Performance

§101
6.3%
-33.7% vs TC avg
§103
33.3%
-6.7% vs TC avg
§102
16.5%
-23.5% vs TC avg
§112
22.1%
-17.9% vs TC avg
Black line = Tech Center average estimate • Based on career data from 842 resolved cases

Office Action

§103
202 DETAILED ACTION Notice of Pre-AIA or AIA Status The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . Election/Restrictions Applicants’ election without traverse of Group I, claims 3-5, 7-9, 15, 18, 20, 21, 29, 31, 32, 36 and 37 in the reply filed on September 3, 2026 is acknowledged. Claims 39, 57, 65 and 66 are withdrawn as being drawn to non-elected invention. Information Disclosure Statement The information disclosure statement (IDS) submitted on February 29, 2024 has been considered by the examiner. Claim Rejections - 35 USC § 103 The following is a quotation of 35 U.S.C. 103 which forms the basis for all obviousness rejections set forth in this Office action: A patent for a claimed invention may not be obtained, notwithstanding that the claimed invention is not identically disclosed as set forth in section 102, if the differences between the claimed invention and the prior art are such that the claimed invention as a whole would have been obvious before the effective filing date of the claimed invention to a person having ordinary skill in the art to which the claimed invention pertains. Patentability shall not be negated by the manner in which the invention was made. The factual inquiries set forth in Graham v. John Deere Co., 383 U.S. 1, 148 USPQ 459 (1966), that are applied for establishing a background for determining obviousness under 35 U.S.C. 103 are summarized as follows: 1. Determining the scope and contents of the prior art. 2. Ascertaining the differences between the prior art and the claims at issue. 3. Resolving the level of ordinary skill in the pertinent art. 4. Considering objective evidence present in the application indicating obviousness or nonobviousness. Claims 3-5, 7-9, 15, 18, 20, 29, 31, 32, 36 and 37 are rejected under 35 U.S.C. 103 as being unpatentable over Baumhof et al. (WO 2018/078053) in view of Charlston et al (US Patent 9,243,230). Baumhof et al. teach immunogenic compositions comprising mRNA comprising an open reading frame encoding mRNA compound comprising an mRNA sequence encoding at least one antigenic viral peptide or protein, wherein the mRNA compound is encapsulated in or associated with said lipid nanoparticle identical with present Compound 2 in claim 36 (see claims 1-81, and Table on page 251, III-I, Examples 1-26). Regarding present claim 4, Baumhof teaches wherein the precursor polyprotein comprises two or more capsid proteins and has a cleavage site specific for a viral protease between the two or more capsid proteins (see page 91). Bauhof does not teach picornavirus 3C protease, or a capsid protein comprising viral P1 precursor protein. Regarding present claims 5, 7-9, 15, 18, 20, 29, 31, 32, 36 and 37. Charleston et al. teaches constructs comprising picornavirus 3C protease, or a capsid protein comprising viral P1 precursor protein (see claims 1-11). Regarding present claims 5, 7-9, 15, 18, 20, 29, 31, 32, 36 and 37. Charleston teaches that proteolytic processing of the precursor P1 into VP0 (VP2 plus VP4), VP3 and VP1 occur by means of the viral protease 3C or its precursor 3CD (see columns 8-10). Regarding present claims 5, 7-9, 15, 18, 20, 29, 31, 32, 36 and 37. Charleston teaches wherein the HRV species is HRV-A16 or HRV-B14 or the 3CD is specific to an Enterovirus species, optionally wherein the Enterovirus species is genotype EV-D68 or EV-A71 (see column 10). Charleston teaches wherein mRNA comprising the ORF encoding the viral P1 precursor polyprotein and the mRNA comprising the ORF encoding the picornavirus 3C protease (P1:3CD) It would have been prima facie obvious to provide the composition of Baumhof comprising Charleston’s constructs of picornavirus 3C protease, or a capsid protein comprising viral P1 precursor protein because Charlson teaches picornavirus particles comprising the structural proteins of FMDV being non-replicative and non-infectious (see columns 6-7). It would have been prima facie obvious to optimize Charleston’s mRNA comprising the ORF encoding the viral P1 precursor polyprotein and the mRNA comprising the ORF encoding the picornavirus 3C protease (P1:3CD) are present in one of the following ratios: 20:1, 10:1, 7:1, 5:1, 4:1, 3:1, 2:1, 1:1. Thus, the present invention would have been prima facie obvious at the time the invention was made. Claim 21 is rejected under 35 U.S.C. 103 as being unpatentable over Baumhof et al. (WO 2018/078053) in view of Charlston et al. (US Patent 9,243,230), and further in view of Liggett et al. (US Patent Application Publication US 2010/0233677) and Kalnin et al. (US Patent Application Publication US 2011/0091501). Baumhof et al. and Charlston et al. teach the claimed invention as discussed above. They do not teach present SEQ ID NO: 8 or SEQ ID NO: 11. Liggett et al. teach a picornavirus 3C protease identical with present SEQ ID NO: 8 (see sequence alignment below). Present SEQ ID NO: 8 and SEQ ID NO: 2153 in Liggett. Query Match 99.9%; Score 3390; Length 2153; Best Local Similarity 100.0%; Matches 643; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 2 GPEEEFGMSIIKNNTCVVTTTNGKFTGLGIYDRILILPTHADPGSEIQVNGIHTKVLDSY 61 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1511 GPEEEFGMSIIKNNTCVVTTTNGKFTGLGIYDRILILPTHADPGSEIQVNGIHTKVLDSY 1570 Qy 62 DLFNKEGVKLEITVLKLDRNEKFRDIRKYIPESEDDYPECNLALVANQTEPTIIKVGDVV 121 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1571 DLFNKEGVKLEITVLKLDRNEKFRDIRKYIPESEDDYPECNLALVANQTEPTIIKVGDVV 1630 Qy 122 SYGNILLSGTQTARMLKYNYPTKSGYCGGVLYKIGQILGIHVGGNGRDGFSSMLLRSYFT 181 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1631 SYGNILLSGTQTARMLKYNYPTKSGYCGGVLYKIGQILGIHVGGNGRDGFSSMLLRSYFT 1690 Qy 182 EQQGQIQISKHVKDVGLPSIHTPTKTKLQPSVFYDIFPGSKEPAVLTEKDPRLKVDFDSA 241 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1691 EQQGQIQISKHVKDVGLPSIHTPTKTKLQPSVFYDIFPGSKEPAVLTEKDPRLKVDFDSA 1750 Qy 242 LFSKYKGNTECSLNEHIQVAVAHYSAQLATLDIDPQPIAMEDSVFGMDGLEALDLNTSAG 301 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1751 LFSKYKGNTECSLNEHIQVAVAHYSAQLATLDIDPQPIAMEDSVFGMDGLEALDLNTSAG 1810 Qy 302 YPYVTLGIKKKDLINNKTKDISKLKLALDKYDVDLPMITFLKDELRKKDKIAAGKTRVIE 361 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1811 YPYVTLGIKKKDLINNKTKDISKLKLALDKYDVDLPMITFLKDELRKKDKIAAGKTRVIE 1870 Qy 362 ASSINDTILFRTVYGNLFSKFHLNPGVVTGCAVGCDPETFWSKIPLMLDGDCIMAFDYTN 421 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1871 ASSINDTILFRTVYGNLFSKFHLNPGVVTGCAVGCDPETFWSKIPLMLDGDCIMAFDYTN 1930 Qy 422 YDGSIHPIWFKALGMVLDNLSFNPTLINRLCNSKHIFKSTYYEVEGGVPSGCSGTSIFNS 481 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1931 YDGSIHPIWFKALGMVLDNLSFNPTLINRLCNSKHIFKSTYYEVEGGVPSGCSGTSIFNS 1990 Qy 482 MINNIIIRTLVLDAYKHIDLDKLKIIAYGDDVIFSYKYKLDMEAIA KEGQKYGLTITPAD 541 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1991 MINNIIIRTLVLDAYKHIDLDKLKIIAYGDDVIFSYKYKLDMEAIA KEGQKYGLTITPAD 2050 Qy 542 KSSEFKELDYGNVTFLKRGFRQDDKYKFLIHPTFPVEEIYESIRWTKKPSQMQEHVLSLC 601 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 2051 KSSEFKELDYGNVTFLKRGFRQDDKYKFLIHPTFPVEEIYESIRWTKKPSQMQEHVLSLC 2110 Qy 602 HLMWHNGPEIYKDFETKIRSVSAGRALYIPPYELLRHEWYEKF 644 ||||||||||||||||||||||||||||||||||||||||||| Db 2111 HLMWHNGPEIYKDFETKIRSVSAGRALYIPPYELLRHEWYEKF 2153 Kalnin teaches a picornavirus capsid protein identical with present SEQ ID NO: 11 (see sequence alignment below and SEQ ID NO: 30 in Kalnin). Present SEQ ID NO: 11 and SEQ ID NO: 30 in Kalnin Query Match 100.0%; Score 4524; Length 2179; Best Local Similarity 100.0%; Matches 856; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 MGAQVSTQKSGSHENQNILTNGSNQTFTVINYYKDAASTSSAGQSLSMDPSKFTEPVKDL 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MGAQVSTQKSGSHENQNILTNGSNQTFTVINYYKDAASTSSAGQSLSMDPSKFTEPVKDL 60 Qy 61 MLKGAPALNSPNVEACGYSDRVQQITLGNSTITTQEAANAVVCYAEWPEYLPDVDASDVN 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 MLKGAPALNSPNVEACGYSDRVQQITLGNSTITTQEAANAVVCYAEWPEYLPDVDASDVN 120 Qy 121 KTSKPDTSVCRFYTLDSKTWTTGSKGWCWKLPDALKDMGVFGQNMFFHSLGRSGYTVHVQ 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 KTSKPDTSVCRFYTLDSKTWTTGSKGWCWKLPDALKDMGVFGQNMFFHSLGRSGYTVHVQ 180 Qy 181 CNATKFHSGCLLVVVIPEHQLASHEGGNVSVKYTFTHPGERGIDLSSANEVGGPVKDVIY 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 CNATKFHSGCLLVVVIPEHQLASHEGGNVSVKYTFTHPGERGIDLSSANEVGGPVKDVIY 240 Qy 241 NMNGTLLGNLLIFPHQFINLRTNNTATIVIPYINSVPIDSMTRHNNVSLMVIPIAPLTVP 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 NMNGTLLGNLLIFPHQFINLRTNNTATIVIPYINSVPIDSMTRHNNVSLMVIPIAPLTVP 300 Qy 301 TGATPSLPITVTIAPMCTEFSGIRSKSIVPQGLPTTTLPGSGQFLTTDDRQSPSALPNYE 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 TGATPSLPITVTIAPMCTEFSGIRSKSIVPQGLPTTTLPGSGQFLTTDDRQSPSALPNYE 360 Qy 361 PTPRIHIPGKVHNLLEIIQVDTLIPMNNTHTKDEVNSYLIPLNANRQNEQVFGTNLFIGD 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 PTPRIHIPGKVHNLLEIIQVDTLIPMNNTHTKDEVNSYLIPLNANRQNEQVFGTNLFIGD 420 Qy 421 GVFKTTLLGEIVQYYTHWSGSLRFSLMYTGPALSSAKLILAYTPPGARGPQDRREAMLGT 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 421 GVFKTTLLGEIVQYYTHWSGSLRFSLMYTGPALSSAKLILAYTPPGARGPQDRREAMLGT 480 Qy 481 HVVWDIGLQSTIVMTIPWTSGVQFRYTDPDTYTSAGFLSCWYQTSLILPPETTGQVYLLS 540 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 481 HVVWDIGLQSTIVMTIPWTSGVQFRYTDPDTYTSAGFLSCWYQTSLILPPETTGQVYLLS 540 Qy 541 FISACPDFKLRLMKDTQTISQTVALTEGLGDELEEVIVEKTKQTVASISSGPKHTQKVPI 600 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 541 FISACPDFKLRLMKDTQTISQTVALTEGLGDELEEVIVEKTKQTVASISSGPKHTQKVPI 600 Qy 601 LTANETGATMPVLPSDSIETRTTYMHFNGSETDVECFLGRAACVHVTEIQNKDATGIDNH 660 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 601 LTANETGATMPVLPSDSIETRTTYMHFNGSETDVECFLGRAACVHVTEIQNKDATGIDNH 660 Qy 661 REAKLFNDWKINLSSLVQLRKKLELFTYVRFDSEYTILATASQPDSANYSSNLVVQAMYV 720 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 661 REAKLFNDWKINLSSLVQLRKKLELFTYVRFDSEYTILATASQPDSANYSSNLVVQAMYV 720 Qy 721 PPGAPNPKEWDDYTWQSASNPSVFFKVGDTSRFSVPYVGLASAYNCFYDGYSHDDAETQY 780 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 721 PPGAPNPKEWDDYTWQSASNPSVFFKVGDTSRFSVPYVGLASAYNCFYDGYSHDDAETQY 780 Qy 781 GITVLNHMGSMAFRIVNEHDEHKTLVKIRVYHRAKHVEAWIPRAPRALPYTSIGRTNYPK 840 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 781 GITVLNHMGSMAFRIVNEHDEHKTLVKIRVYHRAKHVEAWIPRAPRALPYTSIGRTNYPK 840 Qy 841 NTEPVIKKRKGDIKSY 856 |||||||||||||||| Db 841 NTEPVIKKRKGDIKSY 856 It would have been prima facie obvious to provide the composition of Baumhof comprising Charleston’s constructs of picornavirus 3C protease, or a capsid protein comprising viral P1 precursor protein and further comprising present picornavirus protease of SEQ ID NO: 8 and picornavirus capsid polyprotein of SEQ ID NO: 11 because those proteins have been known in the prior art as evidenced by Liggett and Kalnin. Thus, the present invention would have been prima facie obvious at the time the invention was made. Contact Information Any inquiry concerning this communication or earlier communications from the examiner should be directed to AGNIESZKA BOESEN whose telephone number is (571)272-8035. The examiner can normally be reached on 8:30 - 5:00 PM. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Thomas Visone can be reached on 571-270-0684. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of an application may be obtained from the Patent Application Information Retrieval (PAIR) system. Status information for published applications may be obtained from either Private PAIR or Public PAIR. Status information for unpublished applications is available through Private PAIR only. For more information about the PAIR system, see http://pair-direct.uspto.gov. Should you have questions on access to the Private PAIR system, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative or access to the automated information system, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /AGNIESZKA BOESEN/Primary Examiner, Art Unit 1648
Read full office action

Prosecution Timeline

Sep 05, 2023
Application Filed
Sep 23, 2026
Non-Final Rejection mailed — §103 (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12741018
VIRAL PANDEMIC VACCINE
5y 6m to grant Granted Sep 22, 2026
Patent 12735697
METHOD FOR SELECTING ANTIBODY FRAGMENTS, RECOMBINANT ANTIBODIES PRODUCED THEREFROM, AND USES THEREOF
3y 9m to grant Granted Sep 15, 2026
Patent 12729407
MUCINS AND ISOFORMS THEREOF IN DISEASES CHARACTERIZED BY BARRIER DYSFUNCTION
3y 9m to grant Granted Sep 08, 2026
Patent 12721887
VACCINE COMPOSITION COMPRISING PLANT-EXPRESSED RECOMBINANT ZIKA VIRUS ENVELOPE PROTEIN AND PREPARATION METHOD THEREFOR
3y 6m to grant Granted Sep 01, 2026
Patent 12709634
TREATMENT OF DISEASES RELATED TO HEPATITIS B VIRUS
4y 2m to grant Granted Aug 18, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

Strategy Recommendation AI-generated — please review before filing

Get a prosecution strategy drawn from examiner precedents, rejection analysis, and claim mapping.
Typically takes 5-10 seconds — AI-generated, attorney review required before filing

Prosecution Projections

1-2
Expected OA Rounds
68%
Grant Probability
90%
With Interview (+21.8%)
3y 2m (~1m remaining)
Median Time to Grant
Low
PTA Risk
Based on 842 resolved cases by this examiner. Grant probability derived from career allowance rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month