Notice of Pre-AIA or AIA Status The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA. DETAILED ACTION 1. Claims 1-3 and 29-45 are currently pending. Priority 2. Application claims benefit of KR10-2021-0044840 filed on 4/6/2021 and PCT/KR2022/004890 filed on 4/5/2022. An English translation of the foreign application has not been received, so priority has not been granted. Therefore, priority has been granted to th e PCT application and the present application is considered to have the effective filing date of 4/5/2022. Claim Objections 3. Claim 3 is objected to as being dependent upon a rejected base claim, but would be allowable if rewritten in independent form including all of the limitations of the base claim and any intervening claims. Claim Rejections - 35 USC § 112 The following is a quotation of the first paragraph of 35 U.S.C. 112(a): (a) IN GENERAL.—The specification shall contain a written description of the invention, and of the manner and process of making and using it, in such full, clear, concise, and exact terms as to enable any person skilled in the art to which it pertains, or with which it is most nearly connected, to make and use the same, and shall set forth the best mode contemplated by the inventor or joint inventor of carrying out the invention. The following is a quotation of the first paragraph of pre-AIA 35 U.S.C. 112: The specification shall contain a written description of the invention, and of the manner and process of making and using it, in such full, clear, concise, and exact terms as to enable any person skilled in the art to which it pertains, or with which it is most nearly connected, to make and use the same, and shall set forth the best mode contemplated by the inventor of carrying out his invention. 4 . Claims 39-45 are rejected under 35 U.S.C. 112(a) or 35 U.S.C. 112 (pre-AIA), first paragraph, as failing to comply with the enablement requirement. The claim(s) contains subject matter which was not described in the specification in such a way as to enable one skilled in the art to which it pertains, or with which it is most nearly connected, to make and/or use the invention. The present claims are drawn to a method for preventing or treating cancer. Comprising administering an anti-CNTN4 antibody or fragment as disclosed in claim 1 . However, the instant specification, as filed, does not provide sufficient enabling description for preventing or treating any neoplasia as encompassed by the claims because there does not appear to be sufficient in vitro or in vivo evidence to support administering an inhibitor of CNTN4 to lessen or ameliorate the symptoms of any possible cancer. For example, one skilled in the art is well aware that cancer is difficult to prevent and treat. According to The Merck Manual of Diagnosis and Therapy, there are numerous molecular mechanisms which may drive cell to become cancerous, from genetic abnormalities to environmental factors. (The Merck Manuals Online Medical Library, [online]. Whitehouse Station, NJ:Merck Research Laboratories, 2006-2007. [retrieved 03/12/2026]. Retrieved from the Internet: < URL:https://www.merckmanuals .com/professional/oncology/overview-of - cancer/cellular-and-molecular-basis-of-cancer>. Cellular and Molecular Basis of Cancer). However, the instant disclosure does not provide sufficient in vitro or in vivo evidence showing that the administration of an anti-CNTN4 antibody can counter-act the cause or the manifestation of cancer as defined by the Merck Manual of Diagnosis and Therapy in order to prevent or ameliorate the disease. To elaborate, Fidler (Human Vaccines & Immunotherapeutic 8:8, 1141-1141) teaches that cancer is a highly heterogenous disease, driven by genomic variability, which presents challenges to therapy. Specifically, a heterogenous disease cannot be treated by a homogenous therapy. One skilled in the art would appreciate that a single specific therapy would be unlikely to treat all types of cancers equally. Pharmaceutical therapies in the absence of in vivo clinical data are unpredictable for the following reasons; (1) the protein may be inactivated before producing an effect, i.e. such as proteolytic degradation, immunological inactivation or due to an inherently short half-life of the protein; (2) the protein may not reach the target area because, i.e. the protein may not be able to cross the mucosa or the proteins may be adsorbed by fluids, cells and tissues where the protein has no effect; and (3) other functional properties, known or unknown, may make the protein unsuitable for in vivo therapeutic use, i.e. such as adverse side effects prohibitive to the use of such treatment. See page 1338, footnote 7 of Ex parte Aggarwal , 23 USPQ2d 1334 (PTO Bd. Pat. App. & Inter. 1992). The instant specification fails to demonstrate any predictable anti-cancer function of the claimed antibody. The act of an antibody binding to an antigen does not necessitate any anti-cancer function , or antagonist or agonist function against the antigen or cell expressing the antigen . The instant specification does not demonstrate any disclosed anti-CNTN4 antibodies predictably functioning to bind CNTN4 and exert an anti-cancer effect . The specification fails to provide a predictable nexus between antibody binding to CNTN4 and cancer treatment or prevention. A high quantity of experimentation would be required to determine any anti-cancer effects of the claimed antibodies. The present specification lacks in vitro and in vivo evidence of any therapeutic effect of the antibody. The present specification provides in vitro examples of antibody binding to the CNTN4 antigen. (See Examples 2 and 3). Further, the only evidence of an inhibitory effect is using CD4+ and CD8+ T cells expressing the CNTN4 antigen in vitro , which provides no data on the anticancer effects of the claimed antibody . (See Example 4). There is insufficient guidance and direction as well as objective evidence provided for treating and preventing the scope of cancers encompassed by the claimed method. In vie w of the lack of predictability in the art (e.g. treating or preventing cancer) to which the invention pertains, undue experimentation would be required to practice the claimed method of treating and preventing any cancer with a reasonable expectation of success, absent a specific and detailed description of applicant’s specification of how to effectively use the claimed agent and absent working examples providing evidence which is reasonably predictive that the claimed antibody is effective for preventing or ameliorating any cancer commensurate in scope with the claimed invention. Reasonable correlation must exist between the scope of the claims and the scope of the enablement set forth. In view on the quantity of experimentation necessary, the absence of working examples, the unpredictable nature of the invention, the state of the prior art, the unpredictability of the art, and the breadth of the claims, it would require undue experimentation to practice the claimed invention. The following is a quotation of 35 U.S.C. 112(b): (b ) CONCLUSION.—The specification shall conclude with one or more claims particularly pointing out and distinctly claiming the subject matter which the inventor or a joint inventor regards as the invention. The following is a quotation of 35 U.S.C. 112 (pre-AIA), second paragraph: The specification shall conclude with one or more claims particularly pointing out and distinctly claiming the subject matter which the appl icant regards as his invention. 5 . Claims 31-32 are rejected under 35 U.S.C. 112(b) or 35 U.S.C. 112 (pre-AIA), second paragraph, as being indefinite for failing to particularly point out and distinctly claim the subject matter which the inventor or a joint inventor (or for applications subject to pre-AIA 35 U.S.C. 112, the applicant), regards as the invention. Claim 31 recites “increasing an activity of T cell” it is unclear what is increasing an activity of a T cell, or where the T cell comes from. Please re-write the claim to clearly define the limitations of the claim. The following is a quotation of 35 U.S.C. 112(d): (d) REFERENCE IN DEPENDENT FORMS.—Subject to subsection (e), a claim in dependent form shall contain a reference to a claim previously set forth and then specify a further limitation of the subject matter claimed. A claim in dependent form shall be construed to incorporate by reference all the limitations of the claim to which it refers. The following is a quotation of pre-AIA 35 U.S.C. 112, fourth paragraph: Subject to the following paragraph [i.e., the fifth paragraph of pre-AIA 35 U.S.C. 112], a claim in dependent form shall contain a reference to a claim previously set forth and then specify a further limitation of the subject matter claimed. A claim in dependent form shall be construed to incorporate by reference all the limitations of the claim to which it refers. 6 . Claim 33 is rejected under 35 U.S.C. 112(d) or pre-AIA 35 U.S.C. 112, 4th paragraph, as being of improper dependent form for failing to further limit the subject matter of the claim upon which it depends, or for failing to include all the limitations of the claim upon which it depends. Claim 33 depends from claim 1. Claim 1 is limited to an anti-CNTN4 antibody comprising six CDR sequence s , three CDRs from the heavy chain, and three CDRs f ro m the light chain. Claim 33 recites the antibody can be a single domain antibody . A single domain antibody comprises only the heavy chain CDR s and excludes the light chain CDRs, therefore, this limitation is outside the scope of claim 1. Applicant may cancel the claim(s), amend the claim(s) to place the claim(s) in proper dependent form, rewrite the claim(s) in independent form, or present a sufficient showing that the dependent claim(s) complies with the statutory requirements. Double Patenting The nonstatutory double patenting rejection is based on a judicially created doctrine grounded in public policy (a policy reflected in the statute) so as to prevent the unjustified or improper timewise extension of the “right to exclude” granted by a patent and to prevent possible harassment by multiple assignees. A nonstatutory double patenting rejection is appropriate where the conflicting claims are not identical, but at least one examined application claim is not patentably distinct from the reference claim(s) because the examined application claim is either anticipated by, or would have been obvious over, the reference claim(s). See, e.g., In re Berg , 140 F.3d 1428, 46 USPQ2d 1226 (Fed. Cir. 1998); In re Goodman , 11 F.3d 1046, 29 USPQ2d 2010 (Fed. Cir. 1993); In re Longi , 759 F.2d 887, 225 USPQ 645 (Fed. Cir. 1985); In re Van Ornum , 686 F.2d 937, 214 USPQ 761 (CCPA 1982); In re Vogel , 422 F.2d 438, 164 USPQ 619 (CCPA 1970); In re Thorington , 418 F.2d 528, 163 USPQ 644 (CCPA 1969). A timely filed terminal disclaimer in compliance with 37 CFR 1.321(c) or 1.321(d) may be used to overcome an actual or provisional rejection based on nonstatutory double patenting provided the reference application or patent either is shown to be commonly owned with the examined application, or claims an invention made as a result of activities undertaken within the scope of a joint research agreement. See MPEP § 717.02 for applications subject to examination under the first inventor to file provisions of the AIA as explained in MPEP § 2159. See MPEP § 2146 et seq. for applications not subject to examination under the first inventor to file provisions of the AIA. A terminal disclaimer must be signed in compliance with 37 CFR 1.321(b). The filing of a terminal disclaimer by itself is not a complete reply to a nonstatutory double patenting (NSDP) rejection. A complete reply requires that the terminal disclaimer be accompanied by a reply requesting reconsideration of the prior Office action. Even where the NSDP rejection is provisional the reply must be complete. See MPEP § 804, subsection I.B.1. For a reply to a non-final Office action, see 37 CFR 1.111(a). For a reply to final Office action, see 37 CFR 1.113(c). A request for reconsideration while not provided for in 37 CFR 1.113(c) may be filed after final for consideration. See MPEP §§ 706.07(e) and 714.13. The USPTO Internet website contains terminal disclaimer forms which may be used. Please visit www.uspto.gov/patent/patents-forms. The actual filing date of the application in which the form is filed determines what form (e.g., PTO/SB/25, PTO/SB/26, PTO/AIA/25, or PTO/AIA/26) should be used. A web-based eTerminal Disclaimer may be filled out completely online using web-screens. An eTerminal Disclaimer that meets all requirements is auto-processed and approved immediately upon submission. For more information about eTerminal Disclaimers, refer to www.uspto.gov/patents/apply/applying-online/eterminal-disclaimer . 7 . Claims 1, 2, 29- 45 are provisionally rejected on the ground of nonstatutory double patenting as being unpatentable over claims 1, 3, 5-8, and 21 , 25-26, and 30 of copending Application No. 17227173 (reference application) in view of Nam (CA3098983 A1, pub. 11/7/2019) . Although the claims at issue are not identical, they are not patentably distinct from each other because they are both drawn to a method of treating a cancer expressing CNTN4 using anti-CNTN4 antibodies or antigen binding fragments . In regards to claims 1, 2, 31-33, 39 , and 43 the present and co-pending application both claim anti-CNTN4 antibodies and antigen-binding fragments comprising a VL region comprising a CDR1 region of SEQ ID NO:70, CDR2 region of SEQ ID NO:88, and CDR3 of SEQ ID NO:116, also the whole VL region of the sequence of SEQ ID NO: 18 (U.S. Patent App. No. 17227173 SEQ ID NO:31, see alignment below) and a VH region comprising CDR1 of SEQ ID NO:58, CDR2 of SEQ ID NO:89, and CDR3 of SEQ ID NO:115, also the whole VH region of the sequence of SEQ ID NO:2 (U.S. Patent App. No. 17227173 SEQ ID NO:32 , see alignment below ). The present and copending application s further claim a method for treating CNTN4 expressing cancers through enhancing the immune response comprising administering the anti-CNTN4 antibody to a subject, and increasing the level of T-cell mediated immune response. In regard to claims 29-30, 34- 35, 37-38 , 40, 42, 44-45 , the co-pending application does not claim the subject matter but discloses them through the specification. The co-pending application discloses through the specification that the anti-CNTN4 antibody is capable of binding to human or mouse antigens. (See 17227173 pg. 14). The co-pending application also discloses the antibodies can be chimeric, humanized , or multispecific (See 17227173 pg. 7 ) . The co-pending application further discloses the antibodies were made using an expression vector encoding the antigen-binding fragment. (See 17227173 pg. 33, 5.1.2). The co-pending application discloses the treatment of cancer using one or more immune checkpoint inhibitors (See 17227173, pg. 3, paragraph 3) and a pharmaceutical composition including all of the inhibitors that would be administered to a subject in a single formation (See 17227173 pg. 11, paragraph 2). Therefore, all of the above claims would be obvious over the disclosure of co-pending application 17227173. In regard to claims 36 and 41 t he co-pending application 17227173 does not disclose or claim the anti-CNTN4 antibody conjugated with a drug or the administration of the anti-CNTN4 antibody with an additional anti-cancer agent which is an immune checkpoint inhibitor consisting of an anti-CTLA-4 antibody, an anti-PD-1 antibody, and an anti-PD-L1 antibody. Nam teaches conjugation of an additional anti-cancer drug to an antibody as a stable way to deliver additional anti-cancer therapeutics to target cells. (See Nam, pg. 22 [72]. Nam further teaches that anti-cancer antibodies can be treated along side other conventional therapeutic agents. (See Nam pg. 42 [136]). Additionally, Nam teaches that immune checkpoint inhibitors, including CTLA-4, PD-1 and PD-L1, are known in the art for the treatment of cancer. (See Nam pgs. 43-44 [140], [142]). It would have been prima facie obvious to a person of ordinary skill in the art prior to the effective filing date to apply the teachings of Nam to the co-pending application no. 17227173 for the present claimed invention. It would have been obvious because Nam teaches that antibody-drug conjugation is a useful method for targeted delivery of additional anti-cancer therapeutics and Nam further teaches that the use of specific immune checkpoint inhibitors for CTLA-4, PD-1, and PD-L1 are well known for successfully treating cancer. Therefore, it would have been obvious for a person of ordinary skill in the art prior to the effective filing date to combine an anti-cancer antibody to a drug conjugate or in addition to an anti-CTLA4, anti-PD-1, or anti-PD-L1 immune checkpoint inhibitor with a reasonable expectation of success in enhancing the treatment of cancer over the administration of a single anti-cancer antibody alone. This is a provisional nonstatutory double patenting rejection because the patentably indistinct claims have not in fact been patented. SEQ ID NO: 18 is 100% identical to SEQ ID NO: 31: RESULT 1 US-17-227-173-31 (NOTE: this sequence has 1 duplicate in the database searched. See complete list at the end of this report) Sequence 31, US/17227173 GENERAL INFORMATION APPLICANT: Genome and Company TITLE OF INVENTION: NOVEL TARGET FOR ANTI-CANCER AND IMMUNE-ENHANCING FILE REFERENCE: Q263017 CURRENT APPLICATION NUMBER: US/17/227,173 CURRENT FILING DATE: 2021-04-09 PRIOR APPLICATION NUMBER: US 16/375,377 PRIOR FILING DATE: 2019-04-04 PRIOR APPLICATION NUMBER: US 62/652,948 PRIOR FILING DATE: 2018-04-05 NUMBER OF SEQ ID NOS: 33 SEQ ID NO 31 LENGTH: 102 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: scFv AB1 VL Query Match 100.0%; Score 532; Length 102; Best Local Similarity 100.0%; Matches 102; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 ALTQPSSVSANLGETVKITCSGSSGSYGWYQQKSPGSAPVTLIYDNTNRPSDIPSRFSGS 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 ALTQPSSVSANLGETVKITCSGSSGSYGWYQQKSPGSAPVTLIYDNTNRPSDIPSRFSGS 60 Qy 61 GSGSTGTLTITGVRAEDEAVYYCGGYDGSTDVFGAGTTLTVL 102 |||||||||||||||||||||||||||||||||||||||||| Db 61 GSGSTGTLTITGVRAEDEAVYYCGGYDGSTDVFGAGTTLTVL 102 SEQ ID NOs:70, 88, and 116 100% disclosed in SEQ ID NO:31: US-17-227-173-31 (NOTE: this sequence has 1 duplicate in the database searched. See complete list at the end of this report) Sequence 31, US/17227173 GENERAL INFORMATION APPLICANT: Genome and Company TITLE OF INVENTION: NOVEL TARGET FOR ANTI-CANCER AND IMMUNE-ENHANCING FILE REFERENCE: Q263017 CURRENT APPLICATION NUMBER: US/17/227,173 CURRENT FILING DATE: 2021-04-09 PRIOR APPLICATION NUMBER: US 16/375,377 PRIOR FILING DATE: 2019-04-04 PRIOR APPLICATION NUMBER: US 62/652,948 PRIOR FILING DATE: 2018-04-05 NUMBER OF SEQ ID NOS: 33 SEQ ID NO 31 LENGTH: 102 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: scFv AB1 VL Query Match 78.6%; Score 92; Length 102; Best Local Similarity 30.6%; Matches 22; Conservative 0; Mismatches 0; Indels 50; Gaps 2; Qy 1 SGSSGS------------------DNTNRPS----------------------------- 13 |||||| ||||||| Db 21 SGSSGSYGWYQQKSPGSAPVTLIYDNTNRPSDIPSRFSGSGSGSTGTLTITGVRAEDEAV 80 Qy 14 ---GGYDGSTDV 22 ||||||||| Db 81 YYCGGYDGSTDV 92 SEQ ID NO: 2 is 100% identical to SEQ ID NO: 32: US-17-227-173-32 (NOTE: this sequence has 1 duplicate in the database searched. See complete list at the end of this report) Sequence 32, US/17227173 GENERAL INFORMATION APPLICANT: Genome and Company TITLE OF INVENTION: NOVEL TARGET FOR ANTI-CANCER AND IMMUNE-ENHANCING FILE REFERENCE: Q263017 CURRENT APPLICATION NUMBER: US/17/227,173 CURRENT FILING DATE: 2021-04-09 PRIOR APPLICATION NUMBER: US 16/375,377 PRIOR FILING DATE: 2019-04-04 PRIOR APPLICATION NUMBER: US 62/652,948 PRIOR FILING DATE: 2018-04-05 NUMBER OF SEQ ID NOS: 33 SEQ ID NO 32 LENGTH: 123 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: scFv AB1 VH Query Match 100.0%; Score 649; Length 123; Best Local Similarity 100.0%; Matches 123; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 AVTLDESEGGLQTPGGALSLVCKASGFTFSSFNMFWVRQAPGKGLEYVAEISGGGGSTWY 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 AVTLDESEGGLQTPGGALSLVCKASGFTFSSFNMFWVRQAPGKGLEYVAEISGGGGSTWY 60 Qy 61 APAVKGRATISRDNGQSTVRLQLNNLRAEDTGTYYCAKSADTWSYGAATIDAWGHGTEVI 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 APAVKGRATISRDNGQSTVRLQLNNLRAEDTGTYYCAKSADTWSYGAATIDAWGHGTEVI 120 Qy 121 VSS 123 ||| Db 121 VSS 123 SEQ ID NOs: 58, 89, and 115 100% disclosed in SEQ ID NO: 32: US-17-227-173-32 (NOTE: this sequence has 1 duplicate in the database searched. See complete list at the end of this report) Sequence 32, US/17227173 GENERAL INFORMATION APPLICANT: Genome and Company TITLE OF INVENTION: NOVEL TARGET FOR ANTI-CANCER AND IMMUNE-ENHANCING FILE REFERENCE: Q263017 CURRENT APPLICATION NUMBER: US/17/227,173 CURRENT FILING DATE: 2021-04-09 PRIOR APPLICATION NUMBER: US 16/375,377 PRIOR FILING DATE: 2019-04-04 PRIOR APPLICATION NUMBER: US 62/652,948 PRIOR FILING DATE: 2018-04-05 NUMBER OF SEQ ID NOS: 33 SEQ ID NO 32 LENGTH: 123 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: scFv AB1 VH Query Match 87.4%; Score 170.4; Length 123; Best Local Similarity 43.9%; Matches 36; Conservative 0; Mismatches 0; Indels 46; Gaps 2; Qy 1 SFNMF--------------EISGGGGSTWYAPAVKG------------------------ 22 ||||| ||||||||||||||||| Db 31 SFNMFWVRQAPGKGLEYVAEISGGGGSTWYAPAVKGRATISRDNGQSTVRLQLNNLRAED 90 Qy 23 --------SADTWSYGAATIDA 36 |||||||||||||| Db 91 TGTYYCAKSADTWSYGAATIDA 112 8 . Claims 1 and 29-45 are provisionally rejected on the ground of nonstatutory double patenting as being unpatentable over claim 1, 3-5, 8, 12, 14-21, and 23 of copending Application No. 18288268 (recently allowed) in view of Yoon (WO2019/194586 pub. 10/10/2019) . In regard to claims 1 , 30-33, and 36-45 the claims are drawn to an anti-CNTN4 antibody or antigen-binding fragment thereof comprising a VL region comprising a CDR1 of SEQ ID NO:70, CDR2 of SEQ ID NO:88, and CDR3 of SEQ ID NO:116, also the VL sequence of SEQ ID NO: 156 (U.S. Patent App No. 18288268 SEQ ID NO:1., see alignment below) and the VH region comprising a CDR1 of SEQ ID NO:58, CDR2 of SEQ ID NO:89, and a CDR3 of SEQ ID NO:115, also the VH sequence of SEQ ID NO: 159 (U.S. Patent App No. 18288268 SEQ ID NO:2, see alignment below). Further, both the present and copending applications claim the ant i -CNTN4 antibody or antigen binding fragment as binding to CNTN4 with a dissociation constant (Kd) of 1 x 10 -7 M or less, and increases the activity of either CD4+ or CD8+ T cells. The anti-CNTN antigen binding fragment can be selected from the group consisting of Fab, Fab', Fab'- SH, Fv, a single chain antibody scFv, a (Fab')2 fragment, a single domain antibody, a diabody (dAb), and a linear antibody. The anti-CNTN4 antibody or antigen binding fragment is conjugated to a drug. A recombinant expression vector comprising a nucleic acid molecule encoding for the antibody or antigen-binding fragment. The present and copending claims are also drawn to a method for preventing or treating a cancer that expresses CNTN4 by administering an effective amount of the anti-CNTN4 antibody to a subject and an additional anti-cancer agent or additional anti-cancer therapy. The anticancer agent could be an immune checkpoint inhibitor or a chemotherapeutic agent and the anticancer therapy could also be radiotherapy. The immune checkpoint inhibitor may be selected from the group consisting of an anti-CTLA-4 antibody, an anti-PD-1 antibody, and an anti-PD-L1 antibody. The method also allows for the administration of the anti-CNTN4 antibody or antigen-binding fragment thereof, and the additional anticancer agent simultaneously as a single formulation, o r simultaneously or sequentially administered to a subject as separate formulations. Thereby, rendering obvious the instant claim limitations. In regard to claims 29 and 34-35 , co - pending Application No. 18288268 does not claim an antibody or antigen-binding fragment that specifically binds to a human or mouse CNTN4 protein, or an antibody that is chimeric, humanized, or multispecific . However, Yoon discloses an anti-CNTN4 antibody (See Yoon, pg. 4 [18]) that can be administered to animals including humans (See Yoon, pg. 7 [35]) and can be in the form of a multispecific antibody, chimeric antibody, or a humanized antibody (See Yoon, pg. 6, [28]). It would have been prima facie obvious to a person of ordinary skill prior to the effective filing date to combine the disclosure of Yoon to the claims in co-pending application 18288268 to produce the present claimed invention. It would have been obvious because antibodies are known to bind to specific targets and engineered antibodies are known to have multiple different designs that prov i de different uses and advantages. Therefore, it would have been obvious to person of ordinary skill in the art prior to the effective filing date that an anti-CNTN4 antibody created for use in humans would bind to a CNTN4 human protein and could be designed to be included in a multispecific antibody for targeting additional cancer antigens, and could be either chimeric or a humanized antibody with a reasonable expectation of success. This is a provisional nonstatutory double patenting rejection. SEQ ID NOs: 70, 88, and 116 100% disclosed in SEQ ID NO: 1: US-18-288-268-1 Filing date in PALM: 2023-10-25 Sequence 1, US/18288268 GENERAL INFORMATION APPLICANT: GENOME AND COMPANY TITLE OF INVENTION: ANTI-CNTN4-SPECIFIC ANTIBODIES AND USE THEREOF FILE REFERENCE: Q292461 CURRENT APPLICATION NUMBER: US/18/288,268 CURRENT FILING DATE: 2023-10-25 PRIOR APPLICATION NUMBER: PCT/KR2021/005449 PRIOR FILING DATE: 2021-04-29 NUMBER OF SEQ ID NOS: 2 SEQ ID NO 1 LENGTH: 101 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: hAb-1 light chain variable region (VL) % Result Query Filing No. Score Match Length ID Date Dups Description ------------------------------------------------------------------------------------------------------------- 2 92.1 78.7 101 US-18-285-459-156 2023-10-03 2 ANTI-CNTN4 ANTIBODY AND USE THEREOF ALIGNMENT: Query Match 78.7%; Score 92.1; Length 101; Best Local Similarity 31.0%; Matches 22; Conservative 0; Mismatches 0; Indels 49; Gaps 2; Qy 1 SGSSGS-----------------DNTNRPS------------------------------ 13 |||||| ||||||| Db 21 SGSSGSYGWYQQKPGQAPVLVIYDNTNRPSGIPDRFSGSSSGNTASLTITGAQAEDEADY 80 Qy 14 --GGYDGSTDV 22 ||||||||| Db 81 YCGGYDGSTDV 91 SEQ ID NO: 58, 89, and 115 align 100% with SEQ ID NO: 2: US-18-288-268-2 Sequence 2, US/18288268 Publication No. US20240209081A1 GENERAL INFORMATION APPLICANT: GENOME AND COMPANY TITLE OF INVENTION: ANTI-CNTN4-SPECIFIC ANTIBODIES AND USE THEREOF FILE REFERENCE: Q292461 CURRENT APPLICATION NUMBER: US/18/288,268 CURRENT FILING DATE: 2023-10-25 PRIOR APPLICATION NUMBER: PCT/KR2021/005449 PRIOR FILING DATE: 2021-04-29 NUMBER OF SEQ ID NOS: 2 SEQ ID NO 2 LENGTH: 123 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: hAb-1 heavy chain variable region (VH) Query Match 87.4%; Score 170.4; Length 123; Best Local Similarity 43.9%; Matches 36; Conservative 0; Mismatches 0; Indels 46; Gaps 2; Qy 1 SFNMF--------------EISGGGGSTWYAPAVKG------------------------ 22 ||||| ||||||||||||||||| Db 31 SFNMFWVRQAPGKGLEWVAEISGGGGSTWYAPAVKGRFTISRDNSKNTLYLQMNSLRAED 90 Qy 23 --------SADTWSYGAATIDA 36 |||||||||||||| Db 91 TAVYYCAKSADTWSYGAATIDA 112 9 . Claims 1 and 2 9 - 45 are provisionally rejected on the ground of nonstatutory double patenting as being unpatentable over claims 1, 5 -6 , 8 -22 of copending Application No. 19156699 in view of Yoon (WO2019/194586, pub. 10/10/2019). In regard to claims 1, 33-34, 36-42, and 45 , the present claims and the co-pending claims are drawn to an anti-CNTN4 antibody or antigen binding fragment thereof comprising a VL region comprising a CDR1 of SEQ ID NO:70 (SEQ ID NO:2 of U.S. Patent App. No. 19156699), a CDR2 of SEQ ID NO:88 (SEQ ID NO:5 of U.S. Patent App. No. 19156699), and CDR3 of SEQ ID NO:116 (SEQ ID NO:7 of U.S. Patent App. No. 19156699), and a VH region comprising CDR1 of SEQ ID NO:58 (SEQ ID NO:1 of U.S. Patent App. No. 19156699), CDR2 of SEQ ID NO:89 (SEQ ID NO:4 of U.S. Patent App. No. 19156699), and CDR3 of SEQ ID NO:115 (SEQ ID NO:18 of U.S. Patent App. No. 19156699) . Further, both the present and copending application s claim the anti-CNTN4 antibody or antigen-binding fragment, wherein the antigen-binding fragment is selected from the group consisting of Fab, Fab', Fab'- SH, Fv, a single chain antibody scFv, a (Fab')2 fragment, a single domain antibody, a diabody (dAb), and a linear antibody. The antibody is either a chimeric or humanized antibody. The antibody is conjugated with a drug. A recombinant expression vector comprising the nucleic acid molecule of the antibody. The copending and present claims are also drawn to a method for preventing or treating a cancer that expresses CNTN4 by administering an effective amount of the anti-CNTN4 antibody to a subject and an additional anti-cancer agent or additional anti-cancer therapy. The anticancer agent could be an immune checkpoint inhibitor or a chemotherapeutic agent and the anticancer therapy could also be radiotherapy. The immune checkpoint inhibitor may be selected from the group consisting of an anti-CTLA-4 antibody, an anti-PD-1 antibody, and an anti-PD-L1 antibody. The method also allows for the administration of the anti-CNTN4 antibody or antigen-binding fragment thereof, and the additional anticancer agent simultaneously as a single formulation, o r simultaneously or sequentially administered to a subject as separate formulations. In regard to claims 29, 31-32, and 35 , the co-pending application does not claim an antibody or antigen-binding fragment specifically binding to a human or mouse CNTN4 protein, that increases activity of a CD4+ or CD8+ T cell. However, Yoon discloses an anti-CNTN4 antibody (See Yoon, pg. 4 [18]) that can be administered to animals including humans (See Yoon, pg. 7 [35]) and can be used to increase the ability of T cells to attack and kill cancer cells (See Yoon, pg. 6 [31]) or also capable of enhancing the immune response (See Yoon, pg. 8 , [ 44 ]). It would have been obvious to a person of ordinary skill in the art to combine the disclosure of Yoon to the claims of the co-pending application prior to the effective filing date with a reasonable expectation of success. It would have been obvious because antibodies are known to bind to specific antigens and Yoon teaches that the targeting of CNTN4 expression increases and enhances the immune response through increasing the ability of T cells to attack and kill cancer cells. Therefore, it would have been obvious prior to the effective filing date for a person of ordinary skill in the art to combine Yoon to the co-pending application to present the claimed invention with a reasonable expectation of success. This is a provisional nonstatutory double patenting rejection. SEQ ID NOs: 70, 88, and 116 are 100% disclosed by SEQ ID NO: 37: US-19-156-699-37 Filing date in PALM: N/A Sequence 37, US/19156699 GENERAL INFORMATION APPLICANT: GENOME AND COMPANY (en) TITLE OF INVENTION: ANTI-CNTN4 ANTIBODY AND USES THEREOF (en) FILE REFERENCE: ABEL.P0003US/1001355918 CURRENT APPLICATION NUMBER: US/19/156,699 CURRENT FILING DATE: 2025-08-14 NUMBER OF SEQ ID NOS: 67 SEQ ID NO 37 LENGTH: 101 TYPE: PRT FEATURE: NAME/KEY: source LOCATION: 1..101 QUALIFIERS: mol_type = protein organism = synthetic construct % Result Query Filing No. Score Match Length ID Date Dups Description ------------------------------------------------------------------------------------------------------------- 2 92.1 78.7 101 US-18-285-459-156 2023-10-03 2 ANTI-CNTN4 ANTIBODY AND USE THEREOF ALIGNMENT: Query Match 78.7%; Score 92.1; Length 101; Best Local Similarity 31.0%; Matches 22; Conservative 0; Mismatches 0; Indels 49; Gaps 2; Qy 1 SGSSGS-----------------DNTNRPS------------------------------ 13 |||||| ||||||| Db 21 SGSSGSYGWYQQKPGQAPVLVIYDNTNRPSGIPDRFSGSSSGNTASLTITGAQAEDEADY 80 Qy 14 --GGYDGSTDV 22 ||||||||| Db 81 YCGGYDGSTDV 91 SEQ ID NO: 70 100% matches SEQ ID NO:2: % Result Query No. Score Match Length DB ID Description ---------------------------------------------------------------------------- 1 28 100.0 8 1 AASEQ2_03132026_104056 ALIGNMENTS RESULT 1 AASEQ2_03132026_104056 Query Match 100.0%; Score 28; DB 1; Length 8; Best Local Similarity 100.0%; Matches 6; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 SGSSGS 6 |||||| Db 1 SGSSGS 6 SEQ ID NO: 88 100% matches SEQ ID NO:5: % Result Query No. Score Match Length DB ID Description ---------------------------------------------------------------------------- 1 39 100.0 7 1 AASEQ2_03132026_104208 ALIGNMENTS RESULT 1 AASEQ2_03132026_104208 Query Match 100.0%; Score 39; DB 1; Length 7; Best Local Similarity 100.0%; Matches 7; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 DNTNRPS 7 ||||||| Db 1 DNTNRPS 7 SEQ ID NO: 116 100% matches SEQ ID NO: 18 % Result Query No. Score Match Length DB ID Description ---------------------------------------------------------------------------- 1 50 100.0 9 1 AASEQ2_03132026_104344 ALIGNMENTS RESULT 1 AASEQ2_03132026_104344 Query Match 100.0%; Score 50; DB 1; Length 9; Best Local Similarity 100.0%; Matches 9; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 GGYDGSTDV 9 ||||||||| Db 1 GGYDGSTDV 9 SEQ ID NOs: 58, 89, and 115 align 100% with SEQ ID NO: 48 % Result Query No. Score Match Length DB ID Description ---------------------------------------------------------------------------- 1 152 23.4 36 1 AASEQ2_03122026_164932 ALIGNMENTS RESULT 1 AASEQ2_03122026_164932 Query Match 23.4%; Score 152; DB 1; Length 36; Best Local Similarity 43.9%; Matches 36; Conservative 0; Mismatches 0; Indels 46; Gaps 2; Qy 31 SFNMFWVRQAPGKGLEWVAEISGGGGSTWYAPAVKGRFTISRDNSKNTLYLQMNSLRAED 90 ||||| ||||||||||||||||| Db 1 SFNMF--------------EISGGGGSTWYAPAVKG------------------------ 22 Qy 91 TAVYYCAKSADTWSYGAATIDA 112 |||||||||||||| Db 23 --------SADTWSYGAATIDA 36 SEQ ID NO: 58 is 100% identical to SEQ ID NO:1: % Result Query No. Score Match Length DB ID Description ---------------------------------------------------------------------------- 1 27 100.0 5 1 AASEQ2_03132026_104950 ALIGNMENTS RESULT 1 AASEQ2_03132026_104950 Query Match 100.0%; Score 27; DB 1; Length 5; Best Local Similarity 100.0%; Matches 5; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 SFNMF 5 ||||| Db 1 SFNMF 5 SEQ ID NO: 89 is 100% identical to SEQ ID NO: 4: % Result Query No. Score Match Length DB ID Description ---------------------------------------------------------------------------- 1 94 100.0 17 1 AASEQ2_03132026_105106 ALIGNMENTS RESULT 1 AASEQ2_03132026_105106 Query Match 100.0%; Score 94; DB 1; Length 17; Best Local Similarity 100.0%; Matches 17; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 EISGGGGSTWYAPAVKG 17 ||||||||||||||||| Db 1 EISGGGGSTWYAPAVKG 17 SEQ ID NO: 115 is 100% identical to SEQ ID NO: 18: % Result Query No. Score Match Length DB ID Description ---------------------------------------------------------------------------- 1 74 100.0 14 1 AASEQ2_03132026_105229 ALIGNMENTS RESULT 1 AASEQ2_03132026_105229 Query Match 100.0%; Score 74; DB 1; Length 14; Best Local Similarity 100.0%; Matches 14; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 SADTWSYGAATIDA 14 |||||||||||||| Db 1 SADTWSYGAATIDA 14 Conclusion 10 . Claims 1- 2 and 29 -45 are rejected. Claim 3 is objected to based on dependency. Any inquiry concerning this communication or earlier communications from the examiner should be directed to FILLIN "Examiner name" \* MERGEFORMAT LINDSAY DUNN whose telephone number is FILLIN "Phone number" \* MERGEFORMAT (571)272-5825 . The examiner can normally be reached FILLIN "Work Schedule?" \* MERGEFORMAT Monday-Friday 8-4:30 . Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, FILLIN "SPE Name?" \* MERGEFORMAT Samira Jean-Louis can be reached at FILLIN "SPE Phone?" \* MERGEFORMAT 571-270-3503 . The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /LINDSAY DUNN/ Examiner, Art Unit 1644 /Laura B Goddard/ Primary Examiner, Art Unit 1642