Prosecution Insights
Last updated: July 17, 2026
Application No. 18/294,306

DURABLE DOWNY MILDEW RESISTANCE IN SPINACH

Non-Final OA §112
Filed
Feb 01, 2024
Priority
Aug 06, 2021 — EU 21190145.9 +1 more
Examiner
DELEO, VICTORIA LYNN
Art Unit
1662
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
Kws Vegetables B V
OA Round
2 (Non-Final)
37%
Grant Probability
At Risk
2-3
OA Rounds
0m
Est. Remaining
-3%
With Interview

Examiner Intelligence

Grants only 37% of cases
37%
Career Allowance Rate
10 granted / 27 resolved
-23.0% vs TC avg
Minimal -40% lift
Without
With
+-40.0%
Interview Lift
resolved cases with interview
Typical timeline
2y 6m
Avg Prosecution
33 currently pending
Career history
66
Total Applications
across all art units

Statute-Specific Performance

§101
1.7%
-38.3% vs TC avg
§103
52.0%
+12.0% vs TC avg
§102
8.5%
-31.5% vs TC avg
§112
12.4%
-27.6% vs TC avg
Black line = Tech Center average estimate • Based on career data from 27 resolved cases

Office Action

§112
DETAILED ACTION Notice of Pre-AIA or AIA Status The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . Status of Claims Claims 1, 3, 5-13, 15-19 & 39 are under examination on the merits. The objection to the specification is withdrawn in light of Applicant’s amendments. The objection to claims 11 & 17 is withdrawn in light of Applicant’s amendments. The rejection of claims 1, 4-7 & 9-11 under 35 U.S.C. 101 is withdrawn in light of Applicant’s amendments. The rejection of claims 1-19 under 35 U.S.C. 112(b) or 35 U.S.C. 112 (pre-AIA ), second paragraph, is withdrawn in light of Applicant’s amendments. The rejections of claims 6-8, 18 under 35 U.S.C. 112(d) or pre-AIA 35 U.S.C. 112, 4th paragraph, are withdrawn in light of Applicant’s amendments. The rejection of claims 3 & 8 under 35 U.S.C. 112(a) or 35 U.S.C. 112 (pre-AIA ), first paragraph, as failing to comply with the enablement requirement is withdrawn in light of Applicant’s amendments. The rejection of claims 1 & 6 under 35 U.S.C. 102(a)(1) as being anticipated by Jiang et al (2018) Phytopathology. 108(8): 980-987 is withdrawn in light of Applicant’s amendments. The rejection of claims 1 & 7 under 35 U.S.C. 102(a)(1) as being anticipated by Li et al (2019) Frontiers in Plant Science. 10:417 is withdrawn in light of Applicant’s amendments. The rejection of claims 1, 2, 6, 12, 13 & 19 under 35 U.S.C. 103 as being unpatentable over Jiang et al (2018) Phytopathology. 108(8): 980-987 in view of Barrantes et al (2014) Mol Breeding. 34:1817-1831 is withdrawn in light of Applicant’s amendments. Objections Claims 3 & 15 are objected to as being dependent upon a rejected base claim, but would be allowable if rewritten in independent form including all of the limitations of the base claim and any intervening claims. Claim 12 is objected to because of the following informalities: Claim 12 (line 3): “a modified susceptibility gene (S-gene) encoding an RPS2-like resistance protein” should read --a modified susceptibility gene (S-gene)-- in light of lines 4-5, which read “wherein the S-gene encodes an RPS2-like resistance protein...”. Appropriate correction is required. Claim Rejections - 35 USC § 112 Written Description The following is a quotation of the first paragraph of 35 U.S.C. 112(a): (a) IN GENERAL.—The specification shall contain a written description of the invention, and of the manner and process of making and using it, in such full, clear, concise, and exact terms as to enable any person skilled in the art to which it pertains, or with which it is most nearly connected, to make and use the same, and shall set forth the best mode contemplated by the inventor or joint inventor of carrying out the invention. The following is a quotation of the first paragraph of pre-AIA 35 U.S.C. 112: The specification shall contain a written description of the invention, and of the manner and process of making and using it, in such full, clear, concise, and exact terms as to enable any person skilled in the art to which it pertains, or with which it is most nearly connected, to make and use the same, and shall set forth the best mode contemplated by the inventor of carrying out his invention. Claims 1, 5-13, 16-19 & 39 are rejected under 35 U.S.C. 112(a) or 35 U.S.C. 112 (pre-AIA ), first paragraph, as failing to comply with the written description requirement. The claim(s) contains subject matter which was not described in the specification in such a way as to reasonably convey to one skilled in the relevant art that the inventor or a joint inventor, or for applications subject to pre-AIA 35 U.S.C. 112, the inventor(s), at the time the application was filed, had possession of the claimed invention. Due to Applicant' s amendment of the claims, the rejection is modified from the rejection as set forth in the Office action mailed 8/4/2025, as applied to claims 1, 2, 4-7, 9, 10-14, 16, 17 & 19. Applicant' s arguments filed 11/4/2025 have been fully considered but they are not persuasive. A. Claims 1, 5-13, 16-19 & 39 require a plant comprising an S-gene that encodes an RPS2-like resistance protein comprising an amino acid sequence that is at least 90% identical to SEQ ID NO: 174. Claims 1, 5-11 & 13 further require increasing expression or activity of the gene, and claims 1 & 5-11 require targeted DNA modification or introgressing a gene allele to increase or decrease the activity or expression of the gene. Claim 18 requires a plant comprising nucleotide modifications at a genomic locus flanked by Spov3_chr4_93275081 and Spov3_chr4_121142541, while claim 8 requires modification or an introgressed allele flanked by Spov3_chr4_93275081 and Spov3_chr4_121142541. Claims 12-13, 16-19 & 39 broadly require any plant with reduced susceptibility to a pathogen and any nucleotide modification at a genomic locus encoding S-gene that encodes an RPS2-like resistance protein comprising an amino acid sequence that is at least 90% identical to SEQ ID NO: 174. An RPS2-like resistance protein with 90% identity to the 826 amino acid-long SEQ ID NO: 174 encompasses proteins with 82 amino acid substitutions relative to SEQ ID NO: 174. Claims 1 & 5-11 do not require modifying the RPS2-like gene directly or introducing it into a plant but encompass modifications or interventions to other loci that affect the activity and/or expression of RPS2. Claims 8 & 18 require that the modification or introgressed allele is flanked by Spov3_chr4_93275081 and Spov3_chr4_121142541, a distance of 27,867,460 nucleotides which potentially encompasses multiple undescribed genes or regulatory elements. The instant specification describes many RPSs-like resistance protein homologs: SEQ ID NO: 219-240 and 333 (page 39, like 35-page 40, line 2; tables 4 & 6). The specification also describes a SEQ ID NO: 171 with 99.8% sequence identity to SEQ ID NO: 174 and SEQ ID NO: 342 with 91.3% sequence identity to SEQ ID NO: 174. See alignments below. The next most similar sequence, SEQ ID NO: 333, has only 64.5% sequence identity to SEQ ID NO: 174. See third alignment below. Thus, the examples of RPS-like resistance proteins described in the instant specification are not representative of the full scope of the RPS2-like resistance proteins claimed. The specification envisions methods of modifying the S-gene locus and/or increasing activity or expression of the gene (page 7, lines 1-17; page 70 lines 17-30; page 73, lines 4-17). The specification describes mutations in an S-gene in spinach that resulted in resistance to Peronospora effusa (page 80, line -page 81 line), and thus describes removal of 2 C-terminal LRR motifs as associated with increased resistance. This is the only structural feature of the RPS2-like protein provided by the specification contributing to reduced susceptibility. The specification does not describe genes or regulatory elements, and modifications thereto, that affect the activity or expression of RPS2-like genes. US-18-294-306A-171 Sequence 171, US/18294306A GENERAL INFORMATION APPLICANT: KWS Vegetables B.V. (en) TITLE OF INVENTION: DURABLE DOWNY MILDEW RESISTANCE IN SPINACH (en) FILE REFERENCE: P14647US00 CURRENT APPLICATION NUMBER: US/18/294,306A CURRENT FILING DATE: 2024-02-01 NUMBER OF SEQ ID NOS: 342 SEQ ID NO 171 LENGTH: 826 TYPE: PRT FEATURE: NAME/KEY: source LOCATION: 1..826 QUALIFIERS: mol_type = protein organism = Spinacia oleracea Query Match 99.8%; Score 4295; Length 826; Best Local Similarity 99.9%; Matches 825; Conservative 0; Mismatches 1; Indels 0; Gaps 0; Qy 1 MAHQIQIPIKMISIIANLFGIGRYHRGVPCDGGTLDNHQSELSSVLIQPQNKRRKVEEFL 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MAHQIQIPIKMISIIANLFGIGRYHRGVPCDGGTLDNHQSELSSVLIQPQNKRRKVEEFL 60 Qy 61 WFNTEYVDRIIGWLKDSEIDTIGVYGMGGVGKTTLATQLQTRLLNHVVAWVSVGVDFTVY 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 WFNTEYVDRIIGWLKDSEIDTIGVYGMGGVGKTTLATQLQTRLLNHVVAWVSVGVDFTVY 120 Qy 121 KLQQDIAGSFGLDLQGDRDAIRRAAMISEFLCRNHNCVLFLDDLWGDFRREDVGIPRKCK 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 KLQQDIAGSFGLDLQGDRDAIRRAAMISEFLCRNHNCVLFLDDLWGDFRREDVGIPRKCK 180 Qy 181 LIVISRLLDVCRKLRCKKVVKVEPLQEEESWQLFNRSIGYGVLNSVDVCRIRKLVYDKCV 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 LIVISRLLDVCRKLRCKKVVKVEPLQEEESWQLFNRSIGYGVLNSVDVCRIRKLVYDKCV 240 Qy 241 GLPLAITSLATSLRKMVDDDNPSSWREVLENFDLLSAKQPHLEDTFSQLRLSYERLNNKL 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 GLPLAITSLATSLRKMVDDDNPSSWREVLENFDLLSAKQPHLEDTFSQLRLSYERLNNKL 300 Qy 301 QRCFLYSALFPKGYAIRKEELIRVWIGMELIDDVPSLQARYNMGHSILNKLVDSCLLETY 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 QRCFLYSALFPKGYAIRKEELIRVWIGMELIDDVPSLQARYNMGHSILNKLVDSCLLETY 360 Qy 361 DNDNIIKINDLVRHMALSIAGDSYMVEAGIPTNFEFRENLRVVSLVNSSIPSIPSGASLI 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 DNDNIIKINDLVRHMALSIAGDSYMVEAGIPTNFEFRENLRVVSLVNSSIPSIPSGASLI 420 Qy 421 KCHCLSTLLLQHNSLEFIPESFFLHMRGLRVLNLSDTNLIRLPSSIDALEELRVLDLSFC 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 421 KCHCLSTLLLQHNSLEFIPESFFLHMRGLRVLNLSDTNLIRLPSSIDALEELRVLDLSFC 480 Qy 481 QNLKQVTSLSKLLKLQFLNLSQTGIGPAPRSLENLKSLTELNLSSIPEPQKIPSGVLPAL 540 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 481 QNLKQVTSLSKLLKLQFLNLSQTGIGPAPRSLENLKSLTELNLSSIPEPQKIPSGVLPAL 540 Qy 541 FRLKRLACYVVEAAIHELQNVNSLEVLDARFLNLCDLSSYVRSQHWCILESYHLQVGFEV 600 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 541 FRLKRLACYVVEAAIHELQNVNSLEVLDARFLNLCDLSSYVRSQHWCILESYHLQVGFEV 600 Qy 601 RSEQPYNRRVSLSGCSLTGQEGDYVVLPSNIQELYVDNCRDFRCLSDVLLPVAYRHRNCQ 660 ||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||| Db 601 RSEQPYNRRVSLSRCSLTGQEGDYVVLPSNIQELYVDNCRDFRCLSDVLLPVAYRHRNCQ 660 Qy 661 NGASVDSCNGEQAEVFAGLEMCIISRCQDVKTLFAPSWVEENLQSLELLQVENCRQVKEI 720 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 661 NGASVDSCNGEQAEVFAGLEMCIISRCQDVKTLFAPSWVEENLQSLELLQVENCRQVKEI 720 Qy 721 IAEEVVECGHSEGKDAVISLPQLTRLVLTLLPQVHSVYKGLLVCSSLLWCTFMDCPKLKR 780 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 721 IAEEVVECGHSEGKDAVISLPQLTRLVLTLLPQVHSVYKGLLVCSSLLWCTFMDCPKLKR 780 Qy 781 LPFSNMDRLEWIEGQEKWWDLLEWDEPESKASLRPLFRCKSVDGDR 826 |||||||||||||||||||||||||||||||||||||||||||||| Db 781 LPFSNMDRLEWIEGQEKWWDLLEWDEPESKASLRPLFRCKSVDGDR 826 US-18-294-306A-342 Sequence 342, US/18294306A GENERAL INFORMATION APPLICANT: KWS Vegetables B.V. (en) TITLE OF INVENTION: DURABLE DOWNY MILDEW RESISTANCE IN SPINACH (en) FILE REFERENCE: P14647US00 CURRENT APPLICATION NUMBER: US/18/294,306A CURRENT FILING DATE: 2024-02-01 NUMBER OF SEQ ID NOS: 342 SEQ ID NO 342 LENGTH: 763 TYPE: PRT FEATURE: NAME/KEY: source LOCATION: 1..763 QUALIFIERS: mol_type = protein organism = Spinacia oleracea Query Match 91.3%; Score 3929.5; Length 763; Best Local Similarity 92.1%; Matches 761; Conservative 0; Mismatches 2; Indels 63; Gaps 2; Qy 1 MAHQIQIPIKMISIIANLFGIGRYHRGVPCDGGTLDNHQSELSSVLIQPQNKRRKVEEFL 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MAHQIQIPIKMISIIANLFGIGRYHRGVPCDGGTLDNHQSELSSVLIQPQNKRRKVEEFL 60 Qy 61 WFNTEYVDRIIGWLKDSEIDTIGVYGMGGVGKTTLATQLQTRLLNHVVAWVSVGVDFTVY 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 WFNTEYVDRIIGWLKDSEIDTIGVYGMGGVGKTTLATQLQTRLLNHVVAWVSVGVDFTVY 120 Qy 121 KLQQDIAGSFGLDLQGDRDAIRRAAMISEFLCRNHNCVLFLDDLWGDFRREDVGIPRKCK 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 KLQQDIAGSFGLDLQGDRDAIRRAAMISEFLCRNHNCVLFLDDLWGDFRREDVGIPRKCK 180 Qy 181 LIVISRLLDVCRKLRCKKVVKVEPLQEEESWQLFNRSIGYGVLNSVDVCRIRKLVYDKCV 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 LIVISRLLDVCRKLRCKKVVKVEPLQEEESWQLFNRSIGYGVLNSVDVCRIRKLVYDKCV 240 Qy 241 GLPLAITSLATSLRKMVDDDNPSSWREVLENFDLLSAKQPHLEDTFSQLRLSYERLNNKL 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 GLPLAITSLATSLRKMVDDDNPSSWREVLENFDLLSAKQPHLEDTFSQLRLSYERLNNKL 300 Qy 301 QRCFLYSALFPKGYAIRKEELIRVWIGMELIDDVPSLQARYNMGHSILNKLVDSCLLETY 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 QRCFLYSALFPKGYAIRKEELIRVWIGMELIDDVPSLQARYNMGHSILNKLVDSCLLETY 360 Qy 361 DNDNIIKINDLVRHMALSIAGDSYMVEAGIPTNFEFRENLRVVSLVNSSIPSIPSGASLI 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 DNDNIIKINDLVRHMALSIAGDSYMVEAGIPTNFEFRENLRVVSLVNSSIPSIPSGASLI 420 Qy 421 KCHCLSTLLLQHNSLEFIPESFFLHMRGLRVLNLSDTNLIRLPSSIDALEELRVLDLSFC 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 421 KCHCLSTLLLQHNSLEFIPESFFLHMRGLRVLNLSDTNLIRLPSSIDALEELRVLDLSFC 480 Qy 481 QNLKQVTSLSKLLKLQFLNLSQTGIGPAPRSLENLKSLTELNLSSIPEPQKIPSGVLPAL 540 |||||||||| | Db 481 QNLKQVTSLSNL------------------------------------------------ 492 Qy 541 FRLKRLACYVVEAAIHELQNVNSLEVLDARFLNLCDLSSYVRSQHWCILESYHLQVGFEV 600 | |||||||||||||||||||||||||||||||||||||||||||| Db 493 -------C--------ELQNVNSLEVLDARFLNLCDLSSYVRSQHWCILESYHLQVGFEV 537 Qy 601 RSEQPYNRRVSLSGCSLTGQEGDYVVLPSNIQELYVDNCRDFRCLSDVLLPVAYRHRNCQ 660 ||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||| Db 538 RSEQPYNRRVSLSRCSLTGQEGDYVVLPSNIQELYVDNCRDFRCLSDVLLPVAYRHRNCQ 597 Qy 661 NGASVDSCNGEQAEVFAGLEMCIISRCQDVKTLFAPSWVEENLQSLELLQVENCRQVKEI 720 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 598 NGASVDSCNGEQAEVFAGLEMCIISRCQDVKTLFAPSWVEENLQSLELLQVENCRQVKEI 657 Qy 721 IAEEVVECGHSEGKDAVISLPQLTRLVLTLLPQVHSVYKGLLVCSSLLWCTFMDCPKLKR 780 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 658 IAEEVVECGHSEGKDAVISLPQLTRLVLTLLPQVHSVYKGLLVCSSLLWCTFMDCPKLKR 717 Qy 781 LPFSNMDRLEWIEGQEKWWDLLEWDEPESKASLRPLFRCKSVDGDR 826 |||||||||||||||||||||||||||||||||||||||||||||| Db 718 LPFSNMDRLEWIEGQEKWWDLLEWDEPESKASLRPLFRCKSVDGDR 763 US-18-294-306A-333 Sequence 333, US/18294306A GENERAL INFORMATION APPLICANT: KWS Vegetables B.V. (en) TITLE OF INVENTION: DURABLE DOWNY MILDEW RESISTANCE IN SPINACH (en) FILE REFERENCE: P14647US00 CURRENT APPLICATION NUMBER: US/18/294,306A CURRENT FILING DATE: 2024-02-01 NUMBER OF SEQ ID NOS: 342 SEQ ID NO 333 LENGTH: 826 TYPE: PRT FEATURE: NAME/KEY: source LOCATION: 1..826 QUALIFIERS: mol_type = protein organism = Beta vulgaris Query Match 64.5%; Score 2775.5; Length 826; Best Local Similarity 67.4%; Matches 566; Conservative 96; Mismatches 135; Indels 43; Gaps 13; Qy 11 MISIIANLFGIGRYHRGVPCDGGTLD-------NHQSELSSVLIQPQNKRRK-VEEFLWF 62 | :| | | : | : |||| :| |:|||| : || :||||: |: | | Db 1 MNAIFTKFFRIELFWRDLRCDGGRIDTRVETVVNNQSELGTGHIQQENKRRRLVQPSLCF 60 Qy 63 NTEYVDRIIGWLKDSEIDTIGVYGMGGVGKTTLATQLQTRLLN--------HVVAWVSVG 114 |:| ||||| || : |:|||||||| |||||||||||:||||| | || |||| Db 61 NSECVDRIISWLDNDEVDTIGVYGMCGVGKTTLATQLETRLLNHDIRFSASHDVAGVSVG 120 Qy 115 VDFTVYKLQQDIAGSFGLDLQGDRDAIRRAAMISEFLCRNHNCVLFLDDLWGDFRREDVG 174 |: :||||||||||:||:||||| | ||||:|| || | ||| ||||||||||:||| Db 121 VNCSVYKLQQDIAGAFGIDLQGDEDKIRRASMIEAFLSRRDKCVLILDDLWGDFRRKDVG 180 Qy 175 IPRKCKLIVISRLLDVCRKLRCKKVVKVEPLQEEESWQLFNRSIGYGVLNSVDVCRIRKL 234 ||::|||::||: ||||| | |:||:||||| | ::|:||| ||| ||||: |||||||| Db 181 IPKECKLVLISQSLDVCRVLGCEKVLKVEPLSEGKTWKLFNHSIGGGVLNNEDVCRIRKL 240 Qy 235 VYDKCVGLPLAITSLATSLRKMVDDDNPSSWREVLENFDLLSAKQPHLEDTFSQLRLSYE 294 ||||| |||||| || ||||| ||| ||||||| : |:: ||||||| |:|||| Db 241 VYDKCAGLPLAIVELAKRLRKMV-DDNGFSWREVLEGTNPFSSRSMHLEDTFSHLKLSYE 299 Qy 295 RLNN-KLQRCFLYSALFPKGYAIRKEELIRVWIGMELIDDVPSLQARYNMGHSILNKLVD 353 ||:: |||:||||||::|||:|| :||||||||| :||||: || |:|: ||||||||:: Db 300 RLSDIKLQQCFLYSAIYPKGHAISREELIRVWIGEKLIDDISSLLAQYDKGHSILNKLIN 359 Qy 354 SCLLET-YDNDNIIKINDLVRHMALSIAGDSYMVEAGIPTNFEFRENLRVVSLVNSSIPS 412 ||||| | |||:::||||||||||||:|:|||:|: ||||||:|||||:|| | Db 360 SCLLEACEDYKGCIKIHEVVRHMALSIAGDSFMIEAGVPSKFEFRENVRVVSLINSLISP 419 Qy 413 IPSGASLIKCHCLSTLLLQHNSLEFIPESFFLHMRGLRVLNLSDTNLIRLPSSIDALEEL 472 |||||| | | ||||||||| || |||| || || ||||||||| |||||||| ||||| Db 420 IPSGAS-SKYHTLSTLLLQHNPLELIPESLFLQMRALRVLNLSDTRLIRLPSSIGALEEL 478 Qy 473 RVLDLSFCQNLKQVTSLSKLLKLQFLNLSQTGIGPAPRSLENLKSLTELNLSSIPEPQKI 532 |||||||||||||| :||||||||||||||| | | ||| || |||||||||||| || Db 479 RVLDLSFCQNLKQVAALSKLLKLQFLNLSQTTIEKVPCSLEKLKRLTELNLSSIPEPTKI 538 Qy 533 PSGVLPALFRLKRLACYVVEAAIHELQNVNSLEVLDARFLNLCDLSSYVRSQHWCILESY 592 || || || |||:| |:|: ||||| :||||:||||| :|||||:||||||||||||| Db 539 PSVVLLALCRLKKLTCHVI-GTIHELQRMNSLEILDARFFSLCDLSAYVRSQHWCILESY 597 Qy 593 HLQVGFEVRSEQPYNRRVSLSGCSLTGQEGDYVVLPSNIQELYVDNCRDFRCLSDVLLPV 652 ||:| ||::|||| ||||| | |||||| |:||||||||||||||| || ||||: || Db 598 SLQLGCEVQAEQPYIRRVSLQGFSLTGQE-QYIVLPSNIQELYVDNCRGFRRLSDVMYPV 656 Qy 653 AYRHRNCQNGASVDSCNGEQAEVFAGLEMCIISRCQDVKTLFAPSWVEENLQSLELLQVE 712 ||:|::||| ||| ||:|:|||| ||:|||| :|| |||||||||||| Db 657 AYQHKSCQN-----------YEVFLSLEICVISRCPDVETLFAANWV-ENLQSLELLQVE 704 Qy 713 NCRQVKEIIAEEVVECG-HSEGKDAVISLPQLTRLVLTLLPQVHSVYKGLLVCSSLLWCT 771 :| |:||:| || || | : || | |:| |: :|: | |||: |:||| |||:||| || Db 705 DCGQLKEVITEEFVERGVYPEGISAPINLLQIRQLIFTRLPQMESIYKGQLVCASLLSCT 764 Qy 772 FMDCPKLKRLPFSNMD--------RLEWIEGQEKWWDLLEWDEPESKASLRPLFRCKSVD 823 |:||||| ||||| | |||||||::|||::||||:| |:| :|||||||:| Db 765 FLDCPKLTRLPFSCMGNGEETFPWRLEWIEGEKKWWEMLEWDQPGSEALFKPLFRCKSLD 824 This instant specification describes 9 markers within the chromosomal region flanked by Spov3_chr4_93275081 and Spov3_chr4_121142541 (Table 1). The instant specification describes that a chromosome region can contain one or more ORFs associated with disease resistance, and describes that three genes were identified in the region of the instant claims (page 36, lines 5-17). The instant specification does not describe non-coding elements present within the recited region that influence the expression or activity of the RPS2-like resistance protein gene. RPS2-like resistance proteins are known in the prior art. RPS2 in Arabidopsis, for which the genus of proteins is named, induces a defense response in a gene-for-gene interaction (Mauricio et al (2003) Genetics 163: 735–746. Published 2/1/2003, hereafter Mauricio. page 735, left column, paragraph 1). RPS2-like proteins contain a nucleotide-binding site and leucine-rich repeat region (LRR); the LRR determines resistance specificity by recognizing avirulence products of pathogens or their downstream products (Mauricio, page 735, left column paragraph 2-right column paragraph 1). Given their role in pathogen recognition, it is understood in the art that different RPS2-like proteins within a plant do not necessarily respond to a given pathogen in the same way if at all. For example, in tea plants exposed to Exobasidium vexans, genes annotated as RPS2-like were upregulated at all time points while others were not upregulated at different infection stages (Jayaswall et al (2016) Scientific Reports. 6:30412. published 7/28/2016: figure 5A, page 11 page 3). Even within species, different alleles of RPS2-like genes may provide different levels of resistance or susceptibility. Multiple RPS2 alleles are known from different Arabidopsis ecotypes (Mauricio tables 1, 2) and variation of amino acid residues in the N-terminal end of RPS2 may be consistent with diversifying selection on the gene (Mauricio page 744, right column, paragraph 1). RPS2-like resistance proteins with an amino acid sequence that is at least 90% identical to the sequence of SEQ ID NO: 174 are not described in the prior art over the scope of the claims. A gene encoding a hypothetical resistance protein in spinach was known prior to filing of the instant application with >99% sequence identity to SEQ ID NO: 174 (NCBI reference sequence XP_021845706.1, available 8/1/2017; see alignment below). In other species, the closest protein sequence of NCBI Reference Sequence XP_010696096.1 (available 11/28/2016) shared 67% sequence identity with SEQ ID NO: 174 (see second alignment below). The Beta vulgaris gene is annotated to be an RPS2-like resistance protein. Spinacia oleracea Score Expect Method Identities Positives Gaps 1681 bits(4353) 0.0 Compositional matrix adjust. 823/826(99%) 825/826(99%) 0/826(0%) Query 1 MAHQIQIPIKMISIIANLFGIGRYHRGVPCDGGTLDNHQSELSSVLIQPQNKRRKVEEFL 60 MAHQIQIPIKMISIIANLFGIGRYHRGVPCDGGTLDNHQSELSSVLIQPQNKRRKVEEFL Sbjct 1 MAHQIQIPIKMISIIANLFGIGRYHRGVPCDGGTLDNHQSELSSVLIQPQNKRRKVEEFL 60 Query 61 WFNTEYVDRIIGWLKDSEIDTIGVYGMGGVGKTTLATQLQTRLLNHVVAWVSVGVDFTVY 120 WFNTEYVDRIIGWLKDSEIDTIGVYGMGGVGKTTLATQLQTRLLNHVVAWVSVGVDFTVY Sbjct 61 WFNTEYVDRIIGWLKDSEIDTIGVYGMGGVGKTTLATQLQTRLLNHVVAWVSVGVDFTVY 120 Query 121 KLQQDIAGSFGLDLQGDRDAIRRAAMISEFLCRNHNCVLFLDDLWGDFRREDVGIPRKCK 180 KLQQDIAGSFGLDLQGDRDAIRRAAMISEFLCRNHNCVLFLDDLWGDFRREDVGIPRKCK Sbjct 121 KLQQDIAGSFGLDLQGDRDAIRRAAMISEFLCRNHNCVLFLDDLWGDFRREDVGIPRKCK 180 Query 181 LIVISRLLDVCRKLRCKKVVKVEPLQEEESWQLFNRSIGYGVLNSVDVCRIRKLVYDKCV 240 LIVISRLLDVCRKLRCKKVVKVEPLQEEESWQLFNRSIGYGVLNSVDVCRIRKLVYDKCV Sbjct 181 LIVISRLLDVCRKLRCKKVVKVEPLQEEESWQLFNRSIGYGVLNSVDVCRIRKLVYDKCV 240 Query 241 GLPLAITSLATSLRKMVDDDNPSSWREVLENFDLLSAKQPHLEDTFSQLRLSYERLNNKL 300 GLPLAITSLATSLRKMVDDDNPSSWREVLENFDLLSAKQPHLEDTFSQLRLSYERLNNK Sbjct 241 GLPLAITSLATSLRKMVDDDNPSSWREVLENFDLLSAKQPHLEDTFSQLRLSYERLNNKP 300 Query 301 QRCFLYSALFPKGYAIRKEELIRVWIGMELIDDVPSLQARYNMGHSILNKLVDSCLLETY 360 QRCFLYSAL+PKGYAIRKEELIRVWIGMELIDDVPSLQARYNMGHSIL+KLVDSCLLETY Sbjct 301 QRCFLYSALYPKGYAIRKEELIRVWIGMELIDDVPSLQARYNMGHSILSKLVDSCLLETY 360 Query 361 DNDNIIKINDLVRHMALSIAGDSYMVEAGIPTNFEFRENLRVVSLVNSSIPSIPSGASLI 420 DNDNIIKINDLVRHMALSIAGDSYMVEAGIPTNFEFRENLRVVSLVNSSIPSIPSGASLI Sbjct 361 DNDNIIKINDLVRHMALSIAGDSYMVEAGIPTNFEFRENLRVVSLVNSSIPSIPSGASLI 420 Query 421 KCHCLSTLLLQHNSLEFIPESFFLHMRGLRVLNLSDTNLIRLPSSIDALEELRVLDLSFC 480 KCHCLSTLLLQHNSLEFIPESFFLHMRGLRVLNLSDTNLIRLPSSIDALEELRVLDLSFC Sbjct 421 KCHCLSTLLLQHNSLEFIPESFFLHMRGLRVLNLSDTNLIRLPSSIDALEELRVLDLSFC 480 Query 481 QNLKQVTSLSKLLKLQFLNLSQTGIGPAPRSLENLKSLTELNLSSIPEPQKIPSGVLPAL 540 QNLKQVTSLSKLLKLQFLNLSQTGIGPAPRSLENLKSLTELNLSSIPEPQKIPSGVLPAL Sbjct 481 QNLKQVTSLSKLLKLQFLNLSQTGIGPAPRSLENLKSLTELNLSSIPEPQKIPSGVLPAL 540 Query 541 FRLKRLACYVVEAAIHELQNVNSLEVLDARFLNLCDLSSYVRSQHWCILESYHLQVGFEV 600 FRLKRLACYVVEAAIHELQNVNSLEVLDARFLNLCDLSSYVRSQHWCILESYHLQVGFEV Sbjct 541 FRLKRLACYVVEAAIHELQNVNSLEVLDARFLNLCDLSSYVRSQHWCILESYHLQVGFEV 600 Query 601 RSEQPYNRRVSLSGCSLTGQEGDYVVLPSNIQELYVDNCRDFRCLSDVLLPVAYRHRNCQ 660 RSEQPYNRRVSLSGCSLTGQEGDYVVLPSNIQELYVDNCRDFRCLSDVLLPVAYRHRNCQ Sbjct 601 RSEQPYNRRVSLSGCSLTGQEGDYVVLPSNIQELYVDNCRDFRCLSDVLLPVAYRHRNCQ 660 Query 661 NGASVDSCNGEQAEVFAGLEMCIISRCQDVKTLFAPSWVEENLQSLELLQVENCRQVKEI 720 NGASVDSCNGEQAEVFAGLEMCIISRCQDVKTLFAPSWVEENLQSLELLQVENCRQVKEI Sbjct 661 NGASVDSCNGEQAEVFAGLEMCIISRCQDVKTLFAPSWVEENLQSLELLQVENCRQVKEI 720 Query 721 IAEEVVECGHSEGKDAVISLPQLTRLVLTLLPQVHSVYKGLLVCSSLLWCTFMDCPKLKR 780 IAEEVVECGHSEGKDAVISLPQLTRLVLTLLPQVHSVYKGLLVCSSLLWCTFMDCPKLKR Sbjct 721 IAEEVVECGHSEGKDAVISLPQLTRLVLTLLPQVHSVYKGLLVCSSLLWCTFMDCPKLKR 780 Query 781 LPFSNMDRLEWIEGQEKWWDLLEWDEPESKASLRPLFRCKSVDGDR 826 LPFSNMDRLEWIEGQEKWWDLLEWDEPESKASLRPLFRCKSVDGDR Sbjct 781 LPFSNMDRLEWIEGQEKWWDLLEWDEPESKASLRPLFRCKSVDGDR 826 Beta vulgaris Score Expect Method Identities Positives Gaps 1071 bits(2771) 0.0 Compositional matrix adjust. 564/840(67%) 661/840(78%) 43/840(5%) Query 11 MISIIANLFGIGRYHRGVPCDGGTLD-------NHQSELSSVLIQPQNKRRK-VEEFLWF 62 M +I F I + R + CDGG +D N+QSEL + IQ +NKRR+ V+ L F Sbjct 2 MNAIFTKFFRIELFWRDLRCDGGRIDTRVETVVNNQSELGTGHIQQENKRRRLVQPSLCF 61 Query 63 NTEYVDRIIGWLKDSEIDTIGVYGMGGVGKTTLATQLQTRLLNHV--------VAWVSVG 114 N+E VDRII WL + E+DTIGVYGM GVGKTTLATQL+TRLLNH VA VSVG Sbjct 62 NSECVDRIISWLDNDEVDTIGVYGMCGVGKTTLATQLETRLLNHDIRFSASHDVAGVSVG 121 Query 115 VDFTVYKLQQDIAGSFGLDLQGDRDAIRRAAMISEFLCRNHNCVLFLDDLWGDFRREDVG 174 V+ +VYKLQQDIAG+FG+DLQGD D RRA+MI F R CVL LDDLWGDFRR+DVG Sbjct 122 VNCSVYKLQQDIAGAFGIDLQGDEDKTRRASMIEAFFSRRDKCVLILDDLWGDFRRKDVG 181 Query 175 IPRKCKLIVISRLLDVCRKLRCKKVVKVEPLQEEESWQLFNRSIGYGVLNSVDVCRIRKL 234 IP++CKL++IS+ LDVCR L C+KV+KVEPL E ++W+LFN SIG GVLN+ DVCRIRKL Sbjct 182 IPKECKLVLISQSLDVCRVLGCEKVLKVEPLSEGKTWKLFNHSIGGGVLNNEDVCRIRKL 241 Query 235 VYDKCVGLPLAITSLATSLRKMVDDDNPSSWREVLENFDLLSAKQPHLEDTFSQLRLSYE 294 VYDKC GLPLAI LA LRKMV DDN SWREVLE + S++ HLEDTFS L+LSYE Sbjct 242 VYDKCAGLPLAIVELAKRLRKMV-DDNGFSWREVLEGTNPFSSRSMHLEDTFSHLKLSYE 300 Query 295 RLNN-KLQRCFLYSALFPKGYAIRKEELIRVWIGMELIDDVPSLQARYNMGHSILNKLVD 353 RL++ KLQ+CFLYSA++PKG+AI +EELIRVWIG +LIDD+ SL A+Y+ GHSILNKL++ Sbjct 301 RLSDIKLQQCFLYSAIYPKGHAISREELIRVWIGEKLIDDISSLLAQYDKGHSILNKLIN 360 Query 354 SCLLET-YDNDNIIKINDLVRHMALSIAGDSYMVEAGIPTNFEFRENLRVVSLVNSSIPS 412 SCLLE D IKI+++VRHMALSIAGDS+M+EAG+P+ FEFREN+RVVSL+NS I Sbjct 361 SCLLEACEDYKGCIKIHEVVRHMALSIAGDSFMIEAGVPSKFEFRENVRVVSLINSLISP 420 Query 413 IPSGASLIKCHCLSTLLLQHNSLEFIPESFFLHMRGLRVLNLSDTNLIRLPSSIDALEEL 472 IPSGAS K H LSTLLLQHN LE IPES FL MR LRVLNLSDT LIRLPSSI ALEEL Sbjct 421 IPSGAS-SKYHTLSTLLLQHNPLELIPESLFLQMRALRVLNLSDTRLIRLPSSIGALEEL 479 Query 473 RVLDLSFCQNLKQVTSLSKLLKLQFLNLSQTGIGPAPRSLENLKSLTELNLSSIPEPQKI 532 RVLDLSFCQNLKQV +LSKLLKLQFLNLSQT I P SLE LK LTELNLSSIPEP KI Sbjct 480 RVLDLSFCQNLKQVAALSKLLKLQFLNLSQTTIEKVPCSLEKLKRLTELNLSSIPEPTKI 539 Query 533 PSGVLPALFRLKRLACYVVEAAIHELQNVNSLEVLDARFLNLCDLSSYVRSQHWCILESY 592 PS VL AL RLK+L C+V+ IHELQ +NSLE+LDARF +LCDLS+YVRSQHWCILESY Sbjct 540 PSVVLLALCRLKKLTCHVI-GTIHELQRMNSLEILDARFFSLCDLSAYVRSQHWCILESY 598 Query 593 HLQVGFEVRSEQPYNRRVSLSGCSLTGQEGDYVVLPSNIQELYVDNCRDFRCLSDVLLPV 652 LQ+G EV++EQPY RRVSL G SLTGQE Y+VLPSNIQELYVDNCR FR LSDV+ PV Sbjct 599 SLQLGCEVQAEQPYIRRVSLQGFSLTGQE-QYIVLPSNIQELYVDNCRGFRRLSDVMYPV 657 Query 653 AYRHRNCQNGASVDSCNGEQAEVFAGLEMCIISRCQDVKTLFAPSWVEENLQSLELLQVE 712 AY+H++CQN EVF+ LE+C+ISRC DV+TLFA +WV ENLQSLELLQVE Sbjct 658 AYQHKSCQN-----------YEVFSSLEICVISRCPDVETLFAANWV-ENLQSLELLQVE 705 Query 713 NCRQVKEIIAEEVVECG-HSEGKDAVISLPQLTRLVLTLLPQVHSVYKGLLVCSSLLWCT 771 +C Q+KE+I EE VE G + EG A I+L Q+ +L+ T LPQ+ S+YKG LVC+SLL CT Sbjct 706 DCGQLKEVITEEFVERGVYPEGISAPINLLQIRQLIFTRLPQMESIYKGQLVCASLLSCT 765 Query 772 FMDCPKLKRLPFSNMD--------RLEWIEGQEKWWDLLEWDEPESKASLRPLFRCKSVD 823 F+DCPKL RLPFS M RLEWIEG++KWW++LEWD+P S+A +PLFRCKS+D Sbjct 766 FLDCPKLTRLPFSCMGNGEETFPWRLEWIEGEKKWWEMLEWDQPGSEALFKPLFRCKSLD 825 One of skill in the art would not recognize that Applicant was in possession of the necessary common attributes or features of the genus of RPS2-like genes nor of the genus of other genes, including pathogen virulence genes, that influence the expression and activity of RPS2-like genes nor genetic elements within the region flanked by Spov3_chr4_93275081 and Spov3_chr4_121142541 that influence susceptibility to a pathogen, in view of the disclosed species. Hence, Applicant has not described S-genes, modified or not, encoding RPS2-like resistance proteins at least 90% identical to SEQ ID NO: 174 providing reduced susceptibility to pathogens in any species of plant, nor factors, genes, or regulatory elements that increase expression or activity of an RPS2-like resistance gene over the full scope of the claims, and the specification fails to provide an adequate written description of the claimed invention. Therefore, given the lack of written description in the specification with regard to the structural and functional characteristics of the claimed compositions, Applicant does not appear to have been in possession of the claimed genus at the time this application was filed. Applicant urges that the amended claims are directed to an RPS2-like resistance protein comprising an amino acid sequence that is at least 90% identical to the sequence of SEQ ID NO: 174. Applicant urges that because numerous sequences homologous to the RPS2-like resistance protein are described in tables 4 & 6 and two sequences have been provided with over 90% sequence identity to SEQ ID NO: 174, the claims are more narrowly tailored to what is described by the specification (Remarks, page 11, paragraphs 2-3). This argument is unpersuasive, because 2 example sequences, which incorporate just 3 amino acid mismatches and a deletion (alignments above, or specification page 80, lines 3-20), do not encompass the full scope of the variation in DNA modifications encompassed by the instant claims. An amino acid sequence at least 90% identical to the sequence of SEQ ID NO: 174 encompasses sequences with as many as 82 amino acid substitutions. Applicant has not described sequences over this full scope that would function to reduce susceptibility to a pathogen in a plant. Moreover, claims 1 & 5-11 do not require modifying the RPS2-like gene directly or introducing it into a plant but encompass modifications or introgressions of other loci or alleles that affect the activity and/or expression of RPS2-like protein. Applicant has not described any other loci or regulatory elements that would influence the function or expression of the recited protein. Thus, one of skill in the art would not reasonably conclude that Applicant was in possession of plants comprising reduced susceptibility to a pathogen over the full scope of the claimed invention. B. Claim 19 recites an F1 progeny plant from the plant of claim 12. First generation progeny of an inbred line may be considered described, because one set of the inherited genome is known in all first-generation progeny. However, because of crossing over, first generation progeny of lines that are not inbred will not necessarily share any common genetic component. The plant of claim 12 is not required to be inbred or even homozygous for the one or more nucleotide modifications. Therefore, a plant that is an F1 progeny of the plant of claim 12 may not share any given trait with the parental plant or with other progeny, including the trait of a modified S-gene encoding an RPS2-like resistant protein or reduced susceptibility to a pathogen. The specification fails to describe the structural features such as traits or genes that distinguish a plant that is an F1 progeny of the plant of claim 12 from other plants that are not F1 progeny of said plant. The specification describes M2 families and seedlings from selfed M1 plants generated by EMS mutation of inbred line B11-509, as well as M3 families obtained by selfing M2 plants (page 77 line 3-13). The specification teaches an EMS22-20 line from an individual mutant M3 plant (page 79, lines 28-29 & page 86 line 32-page 87 line 1; table 7). The specification also describes backcross F2 populations for genetic mapping of the mutation (page 78 lines 1-6). The specification provides prophetic examples of plants of various species that comprise mutant alleles altering expression of the S-gene (examples 9-17) but these examples do not specifically teach progeny descended from the plants comprising the genetic modification. Given the variety of the genus of “progeny” of the plant of claim 12 and the lack of a required shared feature, one of skill in the art would not recognize that Applicant was in possession of the necessary common attributes or features of the genus. Applicant urges that claim 19 has been amended to specify F1 progeny and urges that F1 progeny are described by the specification (Remarks, page 12, paragraph 2). This argument is unpersuasive, because while F1 progeny may be considered described in an inbred line or one homozygous for the trait, the plant of amended claim 12 is not required to be inbred or homozygous for the recited nucleotides modifications. Thus, an F1 progeny would not necessarily share any defining feature with the plant of claim 12 or other F1 progeny. Because there is no structural feature to define an F1 progeny of the plant of claim 12 from an F1 progeny of any other plant, Applicant has not demonstrated possession of F1 progeny over the full scope of the claims. Page 17 of the Office Action mailed 8/4/2025 outlines the instant specification’s description of families of plants derived from an EMS mutation of an inbred line (page 17, paragraph 4) and states that the prophetic examples do not specifically teach progeny descended from plants comprising the genetic modification (page 18, paragraph 1). Claim 12 is not limited to plants derived from the inbred line(s) described in the specification, and so the specification does not provide sufficient Written Description over the full scope of the claimed genus of F1 progeny of a plant of claim 12. Scope of Enablement Claims 1, 5-13, 16-19 & 39 are rejected under 35 U.S.C. 112(a) or 35 U.S.C. 112 (pre-AIA ), first paragraph, because the specification, while being enabling for reduced susceptibility to pathogens in a spinach plant comprising a modified locus encoding a protein with the sequence of SEQ ID NO: 174, does not reasonably provide enablement for any species of plant with reduced susceptibility to any pathogen or encoding a protein with a sequence at least 90% identity to SEQ ID NO: 174 or comprising modifications to other genes that affect the expression or activity of any gene encoding an RPS2-like protein. The specification does not enable any person skilled in the art to which it pertains, or with which it is most nearly connected, to use the invention commensurate in scope with these claims. Due to Applicant' s amendment of the claims, the rejection is modified from the rejection as set forth in the Office action mailed 8/4/2025, as applied to claims 1, 2, 4-7, 9, 10-14, 16, 17 & 19. Applicant' s arguments filed 11/4/2025 have been fully considered but they are not persuasive. Claims 1, 5-13, 16-19 & 39 require a plant comprising an S-gene that encodes an RPS2-like resistance protein comprising an amino acid sequence that is at least 90% identical to SEQ ID NO: 174. Claims 1, 5-11 & 13 further require increasing expression or activity of the gene, and claims 1 & 5-11 require targeted DNA modification or introgressing a gene allele to increase or decrease the activity or expression of the gene. Claim 18 requires a plant comprising nucleotide modifications at a genomic locus flanked by Spov3_chr4_93275081 and Spov3_chr4_121142541, while claim 8 requires modification or an introgressed allele flanked by Spov3_chr4_93275081 and Spov3_chr4_121142541. Claims 12-13, 16-19 & 39 broadly require any plant with reduced susceptibility to a pathogen and any nucleotide modification at a genomic locus encoding S-gene that encodes an RPS2-like resistance protein comprising an amino acid sequence that is at least 90% identical to SEQ ID NO: 174. An RPS2-like resistance protein with 90% identity to the 826 amino acid-long SEQ ID NO: 174 encompasses proteins with 82 amino acid substitutions relative to SEQ ID NO: 174. Claims 1 & 5-11 do not require modifying the RPS2-like gene directly or introducing it into a plant but broadly encompass modifications or interventions to other loci that affect the activity and/or expression of RPS2. Claims 8 & 18 require that the modification or introgressed allele is flanked by Spov3_chr4_93275081 and Spov3_chr4_121142541, a distance of 27,867,460 nucleotides which potentially encompasses undescribed genes or regulatory elements. The instant specification teaches a nucleotide modification resulting in increased expression of a RPS2-like gene in spinach and increased resistance to Peronospora effusa (figure 6, page 77, lines 3-34). The specification also teaches a mapping population for the resistance trait (page 78, lines 1-11). The resistant plants with crossovers or introgressions at the locus read on plants comprising one or more nucleotide modifications at a genomic locus wherein the genomic locus comprises a modified susceptibility gene (as required by claim 12). The specification teaches prophetic examples of plants of various species that comprise mutant alleles altering expression of the S-gene (examples 9-17) and orthologous RPS2-like genes in various species (tables 4 & 6) but these examples do not teach working examples of mutations in the genes resulting plants with increased expression or activity of the gene encoding an RPS2-like resistance protein or reduced susceptibility to a pathogen. The specification also does not teach genes or regulatory elements, and modifications thereto, that affect the activity or expression of RPS2-like genes. This instant specification teaches 9 markers within the chromosomal region flanked by Spov3_chr4_93275081 and Spov3_chr4_121142541 (Table 1). The instant specification teaches three genes were identified in the region of the instant claims (page 36, lines 5-17). The instant specification does not teach non-coding elements or coding genes other than the RPS2-like resistance gene present within the recited region that influence the expression or activity of the RPS2-like resistance protein gene. RPS2 in Arabidopsis is known in the art to induce a defense response in a gene-for-gene interaction (Mauricio et al (2003) Genetics 163: 735–746. Published 2/1/2003, hereafter Mauricio. page 735, left column, paragraph 1). RPS2-like proteins contain a nucleotide-binding site and leucine-rich repeat region (LRR); the LRR determines resistance specificity by recognizing avirulence products of pathogens or their downstream products (Mauricio, page 735, left column paragraph 2-right column paragraph 1). Given their role in pathogen recognition, it is understood in the art that different RPS2-like proteins within a plant do not necessarily respond to a given pathogen in the same way as other RPS2-like proteins if at all. For example, in tea plants exposed to Exobasidium vexans, genes annotated as RPS2-like were upregulated at all time points while others were not upregulated at different infection stages (Jayaswall et al (2016) Scientific Reports. 6:30412. published 7/28/2016: figure 5A, page 11 page 3). In impatiens infected with Plasmopara obducens, not all genes functionally similar to RPS2-like proteins were significantly upregulated in resistant plants, and R genes such as RPS2 exhibit polymorphism regarding their role in defense (Bhattarai et al (2018) International Journal of Molecular Sciences. 19. 2057 (published 7/15/2018) page 12, paragraph 2). Even within species different alleles of RPS2-like genes may provide different levels of resistance or susceptibility. Multiple RPS2 alleles are known from different Arabidopsis ecotypes (Mauricio tables 1, 2) and variation of amino acid residues in the N-terminal end of RPS2 may be consistent with diversifying selection on the gene (Mauricio page 744, right column, paragraph 1). Given that RPS2-like proteins and their alleles are highly variable in structure, in expression patterns, and in pathogen recognition specificity especially across species, and given the few working examples provided by the Applicant, one of ordinary skill in the art would be required to generate and test an undue number of RPS2-like proteins to determine which proteins reduce susceptibility to a pathogen when increased in activity or expression. Thus, claims 1, 5-13, 16-19 & 39 are not enabled over the full scope of increasing the activity or expression of any S-gene encoding an RPS2-like resistance protein that is at least 90% identical to SEQ ID NO: 174 or a plant comprising one or more nucleotide modifications at any locus comprising a modified susceptibility gene at least 90% identical to SEQ ID NO: 174 or progeny thereof in any plant. Applicant urges that claims 1 & 12 have been amended to specify the S-gene encodes an RPS2-like resistance protein comprising an amino acid sequence that is at least 90% identical to the sequence of SEQ ID NO: 174, and so the claims are narrowly tailored to the working examples and do not require testing an undue number of RPS2-like proteins (Remarks, page 12, paragraph 6-page 13, paragraph 1). This argument is unpersuasive, because RPS2-like proteins are highly variable in structure, in expression patterns, and in pathogen recognition specificity especially across species. The two examples in spinach of sequences of RPS2-like proteins within the genus of RPS2-like resistance proteins comprising an amino acid sequence that is at least 90% identical to the sequence of SEQ ID NO: 174 would still require an undue amount of experimentation for one of ordinary skill in the art to generate and test a large number of RPS2-like proteins in different plant species and in response to different pathogens. Conclusion Applicant's amendment necessitated the new ground(s) of rejection presented in this Office action. Accordingly, THIS ACTION IS MADE FINAL. See MPEP § 706.07(a). Applicant is reminded of the extension of time policy as set forth in 37 CFR 1.136(a). A shortened statutory period for reply to this final action is set to expire THREE MONTHS from the mailing date of this action. In the event a first reply is filed within TWO MONTHS of the mailing date of this final action and the advisory action is not mailed until after the end of the THREE-MONTH shortened statutory period, then the shortened statutory period will expire on the date the advisory action is mailed, and any nonprovisional extension fee (37 CFR 1.17(a)) pursuant to 37 CFR 1.136(a) will be calculated from the mailing date of the advisory action. In no event, however, will the statutory period for reply expire later than SIX MONTHS from the mailing date of this final action. Any inquiry concerning this communication or earlier communications from the examiner should be directed to Victoria L DeLeo whose telephone number is (703)756-5998. The examiner can normally be reached M-F 8:00am-4pm EDT. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Bratislav Stankovic can be reached at (571) 270-0305. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /VICTORIA L DELEO/Examiner, Art Unit 1662 /Anne Kubelik/Primary Examiner, Art Unit 1663
Read full office action

Prosecution Timeline

Feb 01, 2024
Application Filed
Aug 04, 2025
Non-Final Rejection mailed — §112
Nov 04, 2025
Response Filed
Apr 29, 2026
Final Rejection mailed — §112
Jun 29, 2026
Response after Non-Final Action

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12668614
USE OF GLYCINE MAX GmSAMMT GENE IN REGULATION OF PROTEIN CONTENT AND/OR YIELD OF PLANT
2y 2m to grant Granted Jun 30, 2026
Patent 12584117
Use of Gene Encoding Gibberellin 3Beta-Hydroxylase of Glycine Max, GmGA3ox1
2y 11m to grant Granted Mar 24, 2026
Patent 12577577
COMPOSITIONS AND METHODS TO INCREASE RESISTANCE TO PHYTOPHTHORA SOJAE IN SOYBEAN
2y 9m to grant Granted Mar 17, 2026
Patent 12545926
NUCLEIC ACID MOLECULES FOR CONFERRING INSECTICIDAL PROPERTIES IN PLANTS
2y 3m to grant Granted Feb 10, 2026
Patent 12522839
USE OF ZLMYB1 AND ZLMYB2 GENES FROM ZIZANIA LATIFOLIA IN INCREASING ANTHOCYANIDIN CONTENT OF RICE SEED
2y 1m to grant Granted Jan 13, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

Strategy Recommendation AI-generated — please review before filing

Get a prosecution strategy drawn from examiner precedents, rejection analysis, and claim mapping.
Typically takes 5-10 seconds — AI-generated, attorney review required before filing

Prosecution Projections

2-3
Expected OA Rounds
37%
Grant Probability
-3%
With Interview (-40.0%)
2y 6m (~0m remaining)
Median Time to Grant
Moderate
PTA Risk
Based on 27 resolved cases by this examiner. Grant probability derived from career allowance rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month