Prosecution Insights
Last updated: April 19, 2026
Application No. 18/297,770

CANOLA WITH HIGH OLEIC ACID

Non-Final OA §102§103§112§DP
Filed
Apr 10, 2023
Examiner
ZHONG, WAYNESHAOBIN
Art Unit
1662
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
Cellectis
OA Round
3 (Non-Final)
72%
Grant Probability
Favorable
3-4
OA Rounds
3y 0m
To Grant
94%
With Interview

Examiner Intelligence

Grants 72% — above average
72%
Career Allow Rate
377 granted / 524 resolved
+11.9% vs TC avg
Strong +22% interview lift
Without
With
+22.3%
Interview Lift
resolved cases with interview
Typical timeline
3y 0m
Avg Prosecution
28 currently pending
Career history
552
Total Applications
across all art units

Statute-Specific Performance

§101
8.0%
-32.0% vs TC avg
§103
29.4%
-10.6% vs TC avg
§102
13.6%
-26.4% vs TC avg
§112
34.3%
-5.7% vs TC avg
Black line = Tech Center average estimate • Based on career data from 524 resolved cases

Office Action

§102 §103 §112 §DP
DETAILED ACTION Notice of Pre-AIA or AIA Status The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . Continued Examination Under 37 CFR 1.114 A request for continued examination under 37 CFR 1.114, including the fee set forth in 37 CFR 1.17(e), was filed in this application after final rejection. Since this application is eligible for continued examination under 37 CFR 1.114, and the fee set forth in 37 CFR 1.17(e) has been timely paid, the finality of the previous Office action has been withdrawn pursuant to 37 CFR 1.114. Applicant's submission filed on 09/10/2025 has been entered. Status of claims Claims 1, 4-5, 9, 18, 20 have been amended. Note: On 8/6/2024, the applicant elected SEQ ID NO: 10 (from SEQ ID NOs: 9-29). In summary, claims 1-20 are examined in the office action. Non-elected species are withdrawn. Claim Objections Claims 1, 4-5, 9, 18, 20 are objected for following informalities: The amended claims use greyish fonts, which are unclear and hard to read, especially when the recitations are underlined. In addition, for example, the amended “wild-type” in claim 1, line 4; the amended “rare-cutting” in claim 4, line 2; claim 5, line 2; claim 9, last para; claim 18, line 4; and claim 20, line 2, should be a one letter -, not a three letter ---. See the requirement of 37 CFR 1.71(a) for “full, clear, and exact terms”. Please file a clearly printed copy of the claims. Appropriate corrections are required. Claim Rejections - 35 USC § 112 Lacking written description The following is a quotation of the first paragraph of 35 U.S.C. 112(a): (a) IN GENERAL—The specification shall contain a written description of the invention, and of the manner and process of making and using it, in such full, clear, concise, and exact terms as to enable any person skilled in the art to which it pertains, or with which it is most nearly connected, to make and use the same, and shall set forth the best mode contemplated by the inventor or joint inventor of carrying out the invention. Claims 1-20 are rejected under 35 U.S.C. 112(a), as failing to comply with the written description requirement. The claim(s) contains subject matter which was not described in the specification in such a way as to reasonably convey to one skilled in the relevant art that the inventor or a joint inventor, or for pre-AIA the inventor(s), at the time the application was filed, had possession of the claimed invention. To claim a genus under the written description requirement, the applicant is required to describe a representative number of species to reflect the variation within the genus or structures sufficient to define the genus. The factors to be considered include disclosure of complete or partial structure, physical and/or chemical properties, functional characteristics, structure/function correlation, methods of making the claimed product, or any combinations thereof. By court’s statement in Regents of the Univ. of Cal. v. Eli Lilly, 119 F.3d 1559, 1566, 43 USPQ2d 1398, 1404 (Fed. Cir. 1997), a written description of an invention “requires a precise definition, such as a structure, formula, or chemical name, of the claimed subject matter sufficient to distinguish it from other materials”; further, a written description of a claimed genus requires a description of a representative number of species of the claimed genus, and one of skill in the art should be able to “visualize or recognize the identity of the members of the genus”. The amended claims 1-8 are broadly drawn to a genus of Brassica plants, plant parts, or plant cells comprising an genus of induced mutations (knockout mutations in one or more FAD2 gene copies, the knockout mutations comprising one or more base pair insertions or deletions within a sequence having at least 90% identity to SEQ ID NO: 1, 2 or 3) as compared to oil produced from a corresponding wild type Brassica plant, plant part, or plant cell, wherein the mutation was induced by one or more rare cuffing endonucleases. The amended and rejoined claim 9-20 are essentially broadly drawn to a genus of methods of making the above mutated Brassica plants of claim 1 by using rare cuffing endonucleases, and selecting the mutant plants producing oil. The claimed specific function is that the oil produced from the plant, plant part, or plant cell has a specific composition (oleic acid content of the oil is increased by at least 25%, and linolenic acid content is increased by at least 30%, as compared to oil produced by the corresponding wild-type Brassica plant). The specific function requires specific genetic structure. In this particular case, the genetic structure refers to specific modifications of the FAD2 genes. The specification describes the structures of SEQ ID NOs: 1-3 in the sequence listing. Regarding claims 5 and 20, by the examiner’s alignment, SEQ ID NO: 10 (elected species, 48 bp) is a fragment of SEQ ID NO: 1 (1155 bp) from 76-123: SEQ ID NO: 10 1 TGCGAGACACCGCCCTTCACTGTCGGAGAACTCAAGAAAGCAATCCCA 48 SEQ ID NO: 1 76 TGCGAGACACCGCCCTTCACTGTCGGAGAACTCAAGAAAGCAATCCCA 123 The specification also describes making 2 lines of T0 Brassica napus plants, each line comprises multiple mutations (Example 4 in pages 35-38): Line 1 (Bn432-a) had mutations in: A 3 bp deletion (SEQ ID NO:53900) and a 6 bp deletion (SEQ ID NO:53901) in the BnaA.FAD2.a gene. The 3 bp deletion corresponded to nucleotides 98-100 of SEQ ID NO:1, and the 6 bp deletion corresponded to nucleotides 97-102 of SEQ ID NO:1. A 3 bp deletion and a 1 bp insertion in one allele of the BnaC.FAD2.a gene (SEQ ID NO:53902) and a 7 bp deletion (SEQ ID NO:53903) in the other allele of the BnaC.FAD2.a gene. The 3 bp deletion corresponded to nucleotides 99-101 of SEQ ID NO:3, and the 1 bp insertion was at nucleotide 99. The 7 bp deletion corresponded to nucleotides 98-104 of SEQ ID NO:3. A 13 bp deletion (SEQ ID NO:53904) in one allele of the BnaC.Fad2.b gene. The 13 bp deletion corresponded to nucleotides 92-104 of SEQ ID NO:2. Line 2 (Bn432-b) had mutations in: A 6 bp deletion and a 50 bp insertion (SEQ ID NO:53905) in both alleles of the BnaA.FAD2.a gene. The 6 bp deletion corresponded to nucleotides 96-101 of SEQ ID NO:1, with the 50 bp fragment inserted at position 96. A 6 bp deletion and a 50 bp insertion (SEQ ID NO:53905) in one allele of the BnaC.FAD2.a gene and an 18 bp deletion and a 166 bp insertion (SEQ ID NO:53906) in the other allele of the BnaC.FAD2.a gene. The 6 bp deletion corresponded to nucleotides 96-101 of SEQ ID NO:3, with the 50 bp fragment inserted at position 96. The 18 bp deletion corresponded to nucleotides 101-118 of SEQ ID NO:3 with the 166 bp fragment inserted at position 101. Applicant then crossed Line 1 (Bn432-a) and Line 2 (Bn432-b) to make knockout mutations in above multiple positions. Applicant achieve the following results (Example 5 in pages 38-39): One 3 gene knockout mutant had 24% increase (the highest) in oleic acid as compared to oil produced by a corresponding wild type Brassica plant in seeds; One 2 gene knockout mutant had 21.9% increase in oleic acid as compared to oil produced by a corresponding wild type Brassica plant in seeds; Another 2 gene knockout mutant had 23.4% increase in oleic acid as compared to oil produced by a corresponding wild type Brassica plant in seeds; One 1 gene knockout mutant had 20.9% increase in oleic acid as compared to oil produced by a corresponding wild type Brassica plant in seeds. The examiner went deeper and found: In Table 15 (p59-62), the last 2 rows are 2 wild types, the oleic acid % are 68.40% and 66.10%. A 25% increase would be 85.5% and 82.6%. None of the knockout mutants reached 85.5% (the highest is 85.0%). Nevertheless, some of the knockout mutants reached higher than 82.6%. It is noticed by the examiner that all of knockout mutants having higher than 82.6% (presumed 25% increase) oleic acid at least have one homozygote knockout in FAD2 genes, FAD2.b (-13/-13) and/or FAD2.a (-3/-3 and/or -6/-6). Some of the knockout mutants also have at least 30% decrease in linolenic acids. For example, the wild-types have 6.50% and 5.20%, while the knockout modified plants have as low as 2.9%. According to the instant sequence listing (8/7/2023), SEQ ID NO: 1 and SEQ ID NO: 3 are FAD2.a genes, SEQ ID NO: 2 is a FAD2.b gene. In summary, from the applicant’s data serving as the description, at the very least: (1) the knockout of SEQ ID NO: 2 requires to be homozygote, and (2) the knockout of SEQ ID NO:1 AND SEQ ID NO: 3 require to be at least heterozygote, in order for the mutant Brassica plant to reach a 25% increase in oleic acid and a 30% decrease in linolenic acid. Both (1) and (2) should be satisfied. However, claims 1 and 9 only require knockout mutations in one or more FAD2 gene copies within a sequence having at least 90% identity to SEQ ID NO: 1, 2 or 3. Prior art also teaches the same such knockout mutations but does not teach the 25% increase in oleic acid and the 30% decrease in linolenic acid. See art rejections below. Hence, neither the specification nor the art describes the structure feature of knockout mutations in one or more FAD2 gene copies within a sequence having at least 90% identity to SEQ ID NO: 1, 2 or 3, is sufficiently associated to 25% increase in oleic acid and 30% decrease in linolenic acid in mutant Brassica plants as compared to that of wild type Brassica plants. Regarding the description of a representative number of species, the only examples of higher than 25% increase in oleic acid and 30% decrease in linolenic acid are that at the very least, (1) the knockout of SEQ ID NO: 2 requires to be homozygote, plus (2) the knockout of SEQ ID NO: 1 AND SEQ ID NO: 3 require to be at least heterozygote. There is no example of knockout mutations in one or more FAD2 gene copies within a sequence having at least 90% identity to SEQ ID NO: 1, 2 or 3, is associated to 25% increase in oleic acid and 30% decrease in linolenic acid. The claimed number is extremely large and heterologous in structure. Therefore, the application has not met either of the two elements of the written description requirement as set forth in the court’s decision in Eli Lilly, and has not shown her/his possession of the claimed genus at the time of the application. Regarding claims 5 and 20, as analyzed above, SEQ ID NO: 10 (elected species) is a fragment of SEQ ID NO: 1 (a FAD2.a sequence). Thus, the claims do not overcome the deficiency of claims 1 and 9. Other dependent claims do not overcome the deficiency. Claim Rejections - 35 USC § 102/103 The following is a quotation of the appropriate paragraphs of 35 U.S.C. 102 that form the basis for the rejections under this section made in this Office action: A person shall be entitled to a patent unless – (a)(2) the claimed invention was described in a patent issued under section 151, or in an application for patent published or deemed published under section 122(b), in which the patent or application, as the case may be, names another inventor and was effectively filed before the effective filing date of the claimed invention. The following is a quotation of 35 U.S.C. 103 which forms the basis for all obviousness rejections set forth in this Office action: A patent for a claimed invention may not be obtained, notwithstanding that the claimed invention is not identically disclosed as set forth in section 102, if the differences between the claimed invention and the prior art are such that the claimed invention as a whole would have been obvious before the effective filing date of the claimed invention to a person having ordinary skill in the art to which the claimed invention pertains. Patentability shall not be negated by the manner in which the invention was made. Claims 1-2, 4, 8 are rejected under 35 U.S.C. 102 (a)(2) as being anticipated by or, in the alternative, under 35 U.S.C. 103 as obvious over Gocal et al (US 20210010013/US application 17040703, effectively filed 4/4/2018). Note: application 17040703 was effectively filed 4/4/2018 as Provisional Application 62652623, which is before the instant effective filing date of 7/9/2018. The amended claim 1 is drawn to Brassica plant, plant part, or plant cell comprising an induced mutation in one or more FAD2 gene copies (knockout mutation in one or more FAD2 gene copies, the knockout mutations comprising one or more base pair insertions or deletions within a sequence having at least 90% identity to SEQ ID NO: 1, 2 or 3), wherein the mutation was induced by one or more rare cutting endonucleases targeted to the one or more FAD2 gene copies. The oil produced from the plant, plant part, or plant cell has increased oleic acid content (by 25%) and decreased linolenic acid content (by 30%) as compared to oil produced from a corresponding wild type Brassica plant, plant part, or plant cell. Gocal et al disclose a sequence (reference SEQ ID NO: 1) from Brassica napus that is 100% identical to instant SEQ ID NO: 1; Gocal et al disclose a sequence (reference SEQ ID NO: 4) from Brassica napus that is 99.7% identical to instant SEQ ID NO: 2; Gocal et al disclose a sequence (reference SEQ ID NO: 2) from Brassica napus that is 100% identical to instant SEQ ID NO: 3. See “Sequence Matches” at the end of office action. Gocal et al characterize instant SEQ ID NO: 1/reference SEQ ID NO: 1 as bnFAD2-1 gene sequence; instant SEQ ID NO: 2/reference SEQ ID NO: 4 as bnFAD2-4 gene sequence; and instant SEQ ID NO: 3/reference SEQ ID NO: 2 as bnFAD2-2 gene sequence (Example 1, [0414]). Gocal et al teach making a construct/vector comprising CRISPR gene and Cas9 gene, to target FAD2 genes in Brassica plant cells/protoplasts, to make site-specific knockout mutations to all FAD2 gene sequences including bnFAD2-1, bnFAD2-2 and bnFAD2-4, and successfully selected a Brassica plant with at least one mutation in one or more FAD2 gene copies by testing each of the targeted FAD2 genes, including bnFAD2-1, bnFAD2-2 and bnFAD2-4 (reference SEQ ID NOs: 1, 2 and 4) ([0341], Examples 1-2, [0414]-[0417], tables 1-2). The mutant cells were successfully regenerated to Brassica plant comprising seeds, the seeds were harvested to do fatty acid analysis ([0416]-[0417]). The selected Brassica plant had increased oleic acid (18:1, 75.31%) in seed oil, higher than that in the seed oil of wild-type plant (61-64% oleic acid) ([0421]-[0422], table 4B). The selected Brassica plant also had decreased linolenic acid (18:3) as low as 2.6%, as compared to the seed oil of wild-type plant (21.26%) ([0422], table 4C). Thus, Gocal et al teach all of the structure limitations of claim 1 (the same Brassica plant cell comprising a knockout mutation in one or more FAD2 gene copies, the knockout mutations comprising one or more base pair insertions or deletions within a sequence having at least 90% identity to SEQ ID NO: 1, 2 or 3), except are silent or do not explicitly teach that the oil produced from the plant cell has increased oleic acid content (by 25%) and decreased linolenic acid content (by 30%) as compared to oil produced from a corresponding wild type Brassica plant cell. However, according to MPEP 2112 III, A REJECTION UNDER 35 U.S.C. 102/103 CAN BE MADE WHEN THE PRIOR ART PRODUCT SEEMS TO BE IDENTICAL EXCEPT THAT THE PRIOR ART IS SILENT AS TO AN INHERENT CHARACTERISTIC. Where applicant claims a composition in terms of a function, property or characteristic and the composition of the prior art is the same as that of the claim but the function is not explicitly disclosed by the reference, the examiner may make a rejection under both 35 U.S.C. 102 and 103, expressed as a 102/103 rejection. “There is nothing inconsistent in concurrent rejections for obviousness under 35 U.S.C. 103 and for anticipation under 35 U.S.C. 102.” In re Best, 562 F.2d 1252, 1255 n.4, 195 USPQ 430, 433 n.4 (CCPA 1977). This same rationale should also apply to product, apparatus, and process claims claimed in terms of function, property or characteristic. Therefore, a 35 U.S.C. 102/103 rejection is appropriate for these types of claims as well as for composition claims. In addition, MPEP 2112 I states that “[T]he discovery of a previously unappreciated property of a prior art composition, or of a scientific explanation for the prior art’s functioning, does not render the old composition patentably new to the discoverer.” Atlas Powder Co. v. Ireco Inc., 190 F.3d 1342, 1347, 51 USPQ2d 1943, 1947 (Fed. Cir. 1999). Thus, the claiming of a new use, new function or unknown property which is inherently present in the prior art does not necessarily make the claim patentable. In re Best, 562 F.2d 1252, 1254, 195 USPQ 430, 433 (CCPA 1977).” In addition, MPEP 2111.04 teaches that "WHEREIN" Claim scope is not limited by claim language that suggests or makes optional but does not require steps to be performed, or by claim language that does not limit a claim to a particular structure. In this particular case, as analyzed above, the applicant only demonstrated the oil composition having a 25% increase in oleic acid and a 30% decrease in linolenic acid by (1) the knockout of SEQ ID NO: 2 requires to be homozygote, and (2) the knockout of SEQ ID NO:1 AND SEQ ID NO: 3 require to be at least heterozygote, but broadly claims but does not demonstrated that wherein the knockout mutations comprising one or more base pair insertions or deletions within a sequence having at least 90% identity to SEQ ID NO: 1, 2 or 3. Thus, the oil composition having a 25% increase in oleic acid and a 30% decrease in linolenic acid is deemed intended use of the knockout mutations comprising one or more base pair insertions or deletions within a sequence having at least 90% identity to SEQ ID NO: 1, 2 or 3. Gocal et al teach the exact modifications of the FAD2 genes/SEQ ID NO: 1, 2 or 3 and in Brassica plant, which is the same as recited in claim 1. The result of increased oleic acid content and decrease linolenic acid should be the same and are inherent from the modification of the FAD2 genes/SEQ ID NO: 1, 2 or 3 in Brassica plant. Regrading dependent claims, Gocal et al teach and demonstrated making knockout mutations in two or more FAD2 genes (Abstract). Specifically, 4 gene copies of knockout mutations are made in Brassica seed by using CRISPR/Cas9 (Example 2, [0415]-[0416]). Accordingly, Gocal et al teach and demonstrated the limitation of instant claims 2, 4 and 8. Therefore, the claims are anticipated by or, in the alternative, as obvious over, Gocal et al. Claim Rejections - 35 USC § 103 The following is a quotation of 35 U.S.C. 103 which forms the basis for all obviousness rejections set forth in this Office action: A patent for a claimed invention may not be obtained, notwithstanding that the claimed invention is not identically disclosed as set forth in section 102, if the differences between the claimed invention and the prior art are such that the claimed invention as a whole would have been obvious before the effective filing date of the claimed invention to a person having ordinary skill in the art to which the claimed invention pertains. Patentability shall not be negated by the manner in which the invention was made. The factual inquiries set forth in Graham v. John Deere Co., 383 U.S. 1, 148 USPQ 459 (1966), that are applied for establishing a background for determining obviousness under 35 U.S.C. 103 are summarized as follows: 1. Determining the scope and contents of the prior art. 2. Ascertaining the differences between the prior art and the claims at issue. 3. Resolving the level of ordinary skill in the pertinent art. 4. Considering objective evidence present in the application indicating obviousness or non-obviousness. Claim 5 is rejected under 35 U.S.C. 103 as being unpatentable over Gocal et al as applied to claims 1 and 4 above, and further in view of sequences disclosed in GenEmbl (for example, DQ518271, DQ518277, DQ518280, and DQ518282, each was published in 2016). As analyzed above, claims 1 and 4 are anticipated by or, in the alternative, as obvious over, Gocal et al. Claim 5 limits claim 4, wherein each of the endonucleases is targeted to a sequence within any of the sequences set forth in SEQ ID NO: 10 (elected species), or to a sequence having at least 90% identity to any of SEQ ID NO: 10. As analyzed above, Gocal et al anticipate claims 1 and 4. As analyzed above, Gocal et al teach Brassica plant having mutations in SEQ ID NO: 1, SEQ ID NO: 3, and a sequence 99.7% identical to SEQ ID NO: 2, but are silent on if the mutations were within SEQ ID NO: 10 or not. By examiner’s alignment, SEQ ID NO: 10 has 48 bases, and is a fragment of SEQ ID NO: 1 and SEQ ID NO: 3 (each 1155 bases) from 76-123. See “Sequence Matches” at the end of office action. Thus, Gocal et al teach that SEQ ID NO: 1 or 3 comprises SEQ ID NO: 10, and that SEQ ID NO: 10 is in the 5’ side of SEQ ID NO: 1 or 3. Gocal et al further suggest making frameshift mutations in SEQ ID NO: 1 or 3 ([0028]). Gocal et al also suggest making repairments/mutations at 5’ end of a target FAD2 sequence, leading to making desired mismatches at 5’ end of a target FAD2 sequence for improving targeting efficiency (Improving Efficiency. 2. In [0298]). Hence, any ordinary skill in the art would have known that a frameshift mutation at 5’-end of an encoding gene would likely lead to encoding a truncated and non-functional peptide, which is an advantage. DQ518271 (2016), DQ518277 (2016), DQ518280 (2016) and DQ518282 (2016) teach that SEQ ID NO: 10 matches 100% in multiple Brassica plant species: at least in Brassica species of napus, carinata, nigra, and oleracea. See “Sequence Matches” at the end of office action. In fact, by examiner’s blast of SEQ ID NO: 10, majority of the matches were published before the instant filing date, and indicated that SEQ ID NO: 10 sequence (100% matches) as a fragment of omega-6 fatty acid desaturase/FAD2 (see attached “NCBI Blast_Nucleotide Sequence_SEQ ID NO10_2024.pdf). Thus, SEQ ID NO: 10 is a fragment of the known Brassica napus FAD2 sequence SEQ ID NO: 1 or 3, and is conserved in multiple Brassica species, and at least is an indicator of FAD2 among Brassica species. Thus, targeting SEQ ID NO: 10 would not only target FAD2 in Brassica napus, but also target FAD2 in other Brassica species, which is another advantage. Hence, SEQ ID NO: 10 is not only a fragment near the 5’ end of the FAD2 sequences, but also is conserved among many Brassica species. An invention would have been obvious to one ordinary skill in the art if any teaching, suggestion or motivation in prior art leading the one to combine the teaching(s) or suggestion(s) of the cited references to arrive the claimed invention. In this case, it would have been obvious to modify the invention of Gocal et al, such that the induced mutation by the endonuclease is targeted to within SEQ ID NO: 10, as suggested by Gocal et al motivated by the sequences disclosed in GenEmbl. One ordinary skill in the art would have been motivated to do so because the sequence is not only a fragment near the 5’ end of the FAD2 sequences (a frameshift mutation at 5’-end of an encoding gene would likely lead to encoding a truncated and non-functional peptide), but also is conserved among many Brassica species (targeting SEQ ID NO: 10 would not only target FAD2 in Brassica napus, but also target FAD2 in other Brassica species). The expectation of success would have been high, because SEQ ID NO: 10 was located in the 5’end of SEQ ID NOs: 1 and 3. Thus, targeting SEQ ID NO: 10 by frameshift mutation would likely lead to encoding a truncated non-functional fragment of SEQ ID NOs: 1 and 3. The method of making mutations to SEQ ID NOs: 1 and 3 had been taught by Gocal et al. Therefore, the claim would have been obvious to one ordinary skill in the art. Claim 6 is rejected under 35 U.S.C. 103 as being unpatentable over Gocal et al as applied to claim 1 above, and further in view of Gocal et al (the same reference). As analyzed above, claim 1 is anticipated by or, in the alternative, as obvious over, Gocal et al. Claim 6 recites that wherein the Brassica plant, plant part, or plant cell of claim 1 does not contain a transgene. Gocal et al is silent if the particular mutant Brassica cell does not contain a transgene. Instant specification does not define “does not contain a transgene”. Gocal et al nevertheless emphasize/suggest and claim that the FAD2 mutant plant cell is non-transgenic, as an embodiment, and teach the method of making such non-transgenic plant ([0005], [0027], claims 1-9). Gocal et al further teach the advantage thereof that the “non-transgenic” plant is considered non-GMO ([0043]), and that in contrast to conventional transgenic GMOs, there is no integration of foreign genetic material, nor is any foreign genetic material left in the plant ([0268]). It would have been prima facie obvious to modify the plant, part or cell of Gocal et al, such that the plant, part or cell does not contain a transgene as emphasized/suggested by Gocal et al. One ordinary skill in the art would have been motivated to do so because such plant is considered non-GMO, and there is no integration of foreign genetic material, nor is any foreign genetic material left in the plant, as taught by Gocal et al. The expectation of success would have been high because the method of making had been taught by Gocal et al. Therefore, the claim would have been obvious to one ordinary skill in the art. Claim 7 is rejected under 35 U.S.C. 103 as being unpatentable over Gocal et al as applied to claim 1 above, and further in view of Ripley et al (US 20100143570, published 6/10/2010, filed 11/4/2009). As analyzed above, claim 1 is anticipated by or, in the alternative, as obvious over, Gocal et al. Claim 7 limits claim 1, wherein the plant, plant part, or plant cell comprises a transgene encoding EPSPS, a PAT and so on. Gocal et al additionally teach that the plant and cell having the FAD2 mutation further comprise a gene modification conferring a resistance to herbicides ([0011]), which is a beneficial trait in the plant, but does not teach the particular transgene(s). Ripley et al teach a Brassica plant comprising a mutated FAD2 gene ([0021]-[2022], claim 12). Ripley et al additionally teach that the plant further comprises particular genes conferring resistance to herbicides including EPSPS gene and PAT gene (“2. Genes that Confer Resistance to an Herbicide:” [0173]-[0174]). Ripley et al teach the method of introducing the herbicide resistance genes into the plant (Example 6, [0122]-[0123]). It would have been prima facie obvious to modify the invention of Gocal et al, such that the plant, part or cell further comprises an herbicide resistance trait as suggested by Gocal et al, and further comprises a specific herbicide resistance trait to EPSPS or PAT as taught by Ripley et al. One ordinary skill in the art would have been motivated to do so because such resistance traits are beneficial to the plant. The expectation of success would have been high because the method of introduction had been taught by Ripley et al. Therefore, the claim would have been obvious to one ordinary skill in the art. Double Patenting The nonstatutory double patenting rejection is based on a judicially created doctrine grounded in public policy (a policy reflected in the statute) so as to prevent the unjustified or improper timewise extension of the “right to exclude” granted by a patent and to prevent possible harassment by multiple assignees. A nonstatutory double patenting rejection is appropriate where the claims at issue are not identical, but at least one examined application claim is not patentably distinct from the reference claim(s) because the examined application claim is either anticipated by, or would have been obvious over, the reference claim(s). See, e.g., In re Berg, 140 F.3d 1428, 46 USPQ2d 1226 (Fed. Cir. 1998); In re Goodman, 11 F.3d 1046, 29 USPQ2d 2010 (Fed. Cir. 1993); In re Longi, 759 F.2d 887, 225 USPQ 645 (Fed. Cir. 1985); In re Van Ornum, 686 F.2d 937, 214 USPQ 761 (CCPA 1982); In re Vogel, 422 F.2d 438, 164 USPQ 619 (CCPA 1970); and In re Thorington, 418 F.2d 528, 163 USPQ 644 (CCPA 1969). A timely filed terminal disclaimer in compliance with 37 CFR 1.321(c) or 1.321(d) may be used to overcome an actual or provisional rejection based on a nonstatutory double patenting ground provided the reference application or patent either is shown to be commonly owned with this application, or claims an invention made as a result of activities undertaken within the scope of a joint research agreement. A terminal disclaimer must be signed in compliance with 37 CFR 1.321(b). The USPTO internet Web site contains terminal disclaimer forms which may be used. Please visit http://www.uspto.gov/forms/. The filing date of the application will determine what form should be used. A web-based eTerminal Disclaimer may be filled out completely online using web-screens. An eTerminal Disclaimer that meets all requirements is auto-processed and approved immediately upon submission. For more information about eTerminal Disclaimers, refer to http://www.uspto.gov/patents/process/file/efs/guidance/eTD-info-I.jsp. Claims 9-15, 18-20 are rejected on the ground of nonstatutory double patenting as being unpatentable over claims 1-8 of US Patent 11624072. The instant application and the US Patent share the same inventors and the same applicant. US Patent 11624072 claims: 1. A method for producing a Brassica plant having increased oleic acid content and decreased linolenic acid content, the method comprising: providing a population of Brassica cells comprising Fatty Acid Desaturase 2 (FAD2) gene copies, contacting the population of Brassica cells with one or more rare-cutting endonucleases targeted to the one or more FAD2 gene copies, wherein the one or more rare-cutting endonucleases are transcription activator-like effector (TALE) nucleases, wherein each of the one or more TALE nucleases is targeted to a sequence within SEQ ID NO:1, or to a sequence having at least 90% identity to a sequence within SEQ ID NO:1; and within the sequence set forth in SEQ ID NO:10, or to a sequence having at least 90% identity to SEQ ID NO:10, regenerating Brassica plants from the population of Brassica cells contacted with the one or more rare-cutting endonucleases, and selecting a Brassica plant with a knockout mutation in two or more FAD2 gene copies, wherein the selected Brassica plant produces oil having increased oleic acid content and decreased linolenic acid content as compared to oil produced by a corresponding wild type Brassica plant, wherein the oleic acid content of the oil is increased by 25% as compared to oil produced by the corresponding wild-type Brassica plant. Although the claims at issue are not identical, they are not patentably distinct from each other because: SEQ ID NO: 1 is identical in the US Patent (reference) and instant application, SEQ ID NO: 10 also is identical in the US Patent and instant application. See “Sequence Matches” at the end of office action. Thus, reference claim 1 teaches instant claims 9 and 18 in a narrower and more specific manner, for example, TALE nuclease is a specific rare-cutting endonuclease. Reference claims 4-7 teach linolenic acid content of in claim 1 in a in a narrower and more specific manner. Thus, the reference US patent recites a species of the genus recited in the instant application. Claims directed to a genus are prima facie obvious over claims directed to species of that genus. The “wherein the linolenic acid content of the oil is decreased by at least 30% as compared to oil produced by the corresponding wild-type Brassica plant” in claims 9 and 18 are deemed intended use. Since the US Patent teaches the same gene modification in a more specific manner, such oil composition is inherent in the reference claims. Regarding dependent claims, reference claim 2 teach instant claim 10. The reference TALE nuclease (a specific rare-cutting endonuclease) is inherently in a transformation vector. Thus, reference claim 1 teaches instant claims 11-13. The SEQ ID NO: 10 of reference claim 1 also teach instant claims 14 and 20. The “two or more FAD2 gene copies” of reference claim 1 also teach instant 15. Reference claims 3 and 8 teach instant claim 19. Therefore, the claims are obvious over each other. Claims 16-17 are rejected on the ground of nonstatutory double patenting as being unpatentable over claims 1-8 of US Patent 11624072, in view of Gocal et al and Ripley et al (See the 103 rejections above). US Patent 11624072 teach instant claims 9 and 15 as analyzed above. US Patent 11624072 does not explicitly teach the limitation of dependent claims 16-17. As analyzed above in the 103 rejection, Gocal et al emphasize/suggest and claim that the FAD2 mutant plant cell is non-transgenic, and teach the method of making such non-transgenic plant ([0005], [0027], claims 1-9). Thus, instant claim 16 is deemed obvious in view of Gocal et al. As analyzed above in the 103 rejection, Ripley et al teach that the plant further comprises particular genes conferring resistance to herbicides including EPSPS gene and PAT gene ([0173]-[0174]). Thus, instant claim 17 is deemed obvious in view of Ripley et al. Therefore, the dependent claims are obvious over the reference claims of the USP. Remarks According to the specification (p20, last para), the term "induced mutation" as used herein refers to a mutation that was introduced by human intervention. An "induced mutation" can be a mutation that was introduced using one or more sequence-specific nucleases for example. Prior art does not teach or suggest making mutations at the specific positions recited in claim 3. Prior art does not teach or suggest the combination of the structures and steps of claims 9-20. Claims 9-20 are rejected in the double patenting rejection as analyzed above. Response to Arguments Claim Rejections Under 35 U.S.C. § 112 The applicant argues that the amended independent claims 1, 9, and 18 reciting "wherein the linolenic acid content of the oil is decreased by at least 30% as compared to oil produced by the corresponding wild-type Brassica plant" would satisfy the written description requirement. The argument is fully considered but not deemed persuasive. The specific oil composition (25% increase in oleic acid and 30% decrease in linolenic acid) is the function of over-expression of FAD2 gene copies in the Brassica plant. The specific function requires specific genetic structure. In this particular case, the genetic structure refers to specific modifications of the FAD2 genes. In addition, in the art, the exact same FAD2 gene modification does not result in the claimed oil composition. Please note that the broadly recited genetic structure does not result in the specific function/result of the specific oil composition (25% increase in oleic acid and 30% decrease in linoleic acid). If the applicant’s broad recitation was deemed satisfying the written description requirement, so would the teaching of the prior art for example, Gocal et al. One should not argue both ways using opposite standards. Gocal et al teach the same genetic structure, thus, would result the same oil composition in Brassica. See the art rejections. Accordingly, neither the applicant nor the art provides written description for using the broadly claimed gene structure to get the function/result of the claimed specific oil composition. Rejections Under 35 U.S.C. 102 and 103 The applicant argues that the amended independent claim 1 reciting "wherein the linolenic acid content of the oil is decreased by at least 30% as compared to oil produced by the corresponding wild-type Brassica plant" would overcome the rejections to claim 1 and dependent claims. As analyzed above, Gocal et al teach the exact gene structures as broadly recited in claim 1, but is silent on the resultant oil composition. Accordingly, Gocal et al teach the oil composition inherently, as analyzed above. Again, as analyzed in the 112(a) rejection, the broadly recited genetic structure does not result in the specific function/result of the specific oil composition (25% increase in oleic acid and 30% decrease in linoleic acid). If the applicant’s broad recitation was deemed satisfying the written description requirement, so would the teaching of the prior art for example, Gocal et al. One should not argue both ways using opposite standards. Gocal et al teach the same genetic structure, thus, would result the same oil composition in Brassica, inherently. Double Patenting Rejection The applicant argues that claims 9-20, as amended, are not taught or suggested by the cited art and are patentably distinct from claims 1-8 of US Patent No. 11,624,072. Further, the present application was filed as a divisional of and before the US Patent No. 11,624,072 issued and claims 1-8 are product claims which were restricted from the USP. The applicant continues to argue that 35 U.S.C. §121 provides statutory protection from double patenting rejections for a divisional application filed as a result of a restriction requirement, stating: A patent issuing on an application with respect to which a requirement for restriction under this section has been made, or on an application filed as a result of such a requirement, shall not be used as a reference either in the Patent and Trademark Office or in the courts against a divisional application or against the original application or any patent issued on either of them, if the divisional application is filed before the issuance of the patent on the other application. As such, Applicant submits that claims 1-8 have "safe harbor" protection from nonstatutory obviousness-type double patenting over US Patent No. 11,624,072. The argument is not applicable, because instant claims 1-8 are not rejected for double patenting. The original instant claims 9-20, claimed essentially the same subject matter as the USP. After the amendment, the USP claims teach the instant claims 9-15, 18-20; and claims 16-17 are deemed obvious. Sequence Matches Against instant SEQ ID NO: 1 US-17-040-703-1 ; Sequence 1, Application US/17040703 ; Publication No. US20210010013A1 ; GENERAL INFORMATION ; APPLICANT: Cibus US LLC ; APPLICANT:Cibus Europe, B.V. ; TITLE OF INVENTION: FAD2 GENES AND MUTATIONS ; FILE REFERENCE: 16507-20002.00 ; CURRENT APPLICATION NUMBER: US/17/040,703 ; CURRENT FILING DATE: 2020-09-23 ; PRIOR APPLICATION NUMBER: PCT/US2019/025881 ; PRIOR FILING DATE: 2019-04-04 ; PRIOR APPLICATION NUMBER: US 62/652,623 ; PRIOR FILING DATE: 2018-04-04 ; NUMBER OF SEQ ID NOS: 54 ; SOFTWARE: FastSEQ for Windows Version 4.0 ; SEQ ID NO 1 ; LENGTH: 1155 ; TYPE: DNA ; ORGANISM: Brassica napus US-17-040-703-1 Query Match 100.0%; Score 1155; DB 84; Length 1155; Best Local Similarity 100.0%; Matches 1155; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 ATGGGTGCAGGTGGAAGAATGCAAGTGTCTCCTCCCTCCAAAAAGTCTGAAACCGACAAC 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 ATGGGTGCAGGTGGAAGAATGCAAGTGTCTCCTCCCTCCAAAAAGTCTGAAACCGACAAC 60 Qy 61 ATCAAGCGCGTACCCTGCGAGACACCGCCCTTCACTGTCGGAGAACTCAAGAAAGCAATC 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 ATCAAGCGCGTACCCTGCGAGACACCGCCCTTCACTGTCGGAGAACTCAAGAAAGCAATC 120 Qy 121 CCACCGCACTGTTTCAAACGCTCGATCCCTCGCTCTTTCTCCTACCTCATCTGGGACATC 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 CCACCGCACTGTTTCAAACGCTCGATCCCTCGCTCTTTCTCCTACCTCATCTGGGACATC 180 Qy 181 ATCATAGCCTCCTGCTTCTACTACGTCGCCACCACTTACTTCCCTCTCCTCCCTCACCCT 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 ATCATAGCCTCCTGCTTCTACTACGTCGCCACCACTTACTTCCCTCTCCTCCCTCACCCT 240 Qy 241 CTCTCCTACTTCGCCTGGCCTCTCTACTGGGCCTGCCAGGGCTGCGTCCTAACCGGCGTC 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 CTCTCCTACTTCGCCTGGCCTCTCTACTGGGCCTGCCAGGGCTGCGTCCTAACCGGCGTC 300 Qy 301 TGGGTCATAGCCCACGAGTGCGGCCACCACGCCTTCAGCGACTACCAGTGGCTGGACGAC 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 TGGGTCATAGCCCACGAGTGCGGCCACCACGCCTTCAGCGACTACCAGTGGCTGGACGAC 360 Qy 361 ACCGTCGGCCTCATCTTCCACTCCTTCCTCCTCGTCCCTTACTTCTCCTGGAAGTACAGT 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 ACCGTCGGCCTCATCTTCCACTCCTTCCTCCTCGTCCCTTACTTCTCCTGGAAGTACAGT 420 Qy 421 CATCGACGCCACCATTCCAACACTGGCTCCCTCGAGAGAGACGAAGTGTTTGTCCCCAAG 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 421 CATCGACGCCACCATTCCAACACTGGCTCCCTCGAGAGAGACGAAGTGTTTGTCCCCAAG 480 Qy 481 AAGAAGTCAGACATCAAGTGGTACGGCAAGTACCTCAACAACCCTTTGGGACGCACCGTG 540 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 481 AAGAAGTCAGACATCAAGTGGTACGGCAAGTACCTCAACAACCCTTTGGGACGCACCGTG 540 Qy 541 ATGTTAACGGTTCAGTTCACTCTCGGCTGGCCTTTGTACTTAGCCTTCAACGTCTCGGGG 600 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 541 ATGTTAACGGTTCAGTTCACTCTCGGCTGGCCTTTGTACTTAGCCTTCAACGTCTCGGGG 600 Qy 601 AGACCTTACGACGGCGGCTTCGCTTGCCATTTCCACCCCAACGCTCCCATCTACAACGAC 660 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 601 AGACCTTACGACGGCGGCTTCGCTTGCCATTTCCACCCCAACGCTCCCATCTACAACGAC 660 Qy 661 CGTGAGCGTCTCCAGATATACATCTCCGACGCTGGCATCCTCGCCGTCTGCTACGGTCTC 720 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 661 CGTGAGCGTCTCCAGATATACATCTCCGACGCTGGCATCCTCGCCGTCTGCTACGGTCTC 720 Qy 721 TACCGCTACGCTGCTGTCCAAGGAGTTGCCTCGATGGTCTGCTTCTACGGAGTTCCTCTT 780 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 721 TACCGCTACGCTGCTGTCCAAGGAGTTGCCTCGATGGTCTGCTTCTACGGAGTTCCTCTT 780 Qy 781 CTGATTGTCAACGGGTTCTTAGTTTTGATCACTTACTTGCAGCACACGCATCCTTCCCTG 840 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 781 CTGATTGTCAACGGGTTCTTAGTTTTGATCACTTACTTGCAGCACACGCATCCTTCCCTG 840 Qy 841 CCTCACTATGACTCGTCTGAGTGGGATTGGTTGAGGGGAGCTTTGGCCACCGTTGACAGA 900 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 841 CCTCACTATGACTCGTCTGAGTGGGATTGGTTGAGGGGAGCTTTGGCCACCGTTGACAGA 900 Qy 901 GACTACGGAATCTTGAACAAGGTCTTCCACAATATCACGGACACGCACGTGGCGCATCAC 960 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 901 GACTACGGAATCTTGAACAAGGTCTTCCACAATATCACGGACACGCACGTGGCGCATCAC 960 Qy 961 CTGTTCTCGACCATGCCGCATTATCATGCGATGGAAGCTACGAAGGCGATAAAGCCGATA 1020 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 961 CTGTTCTCGACCATGCCGCATTATCATGCGATGGAAGCTACGAAGGCGATAAAGCCGATA 1020 Qy 1021 CTGGGAGAGTATTATCAGTTCGATGGGACGCCGGTGGTTAAGGCGATGTGGAGGGAGGCG 1080 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1021 CTGGGAGAGTATTATCAGTTCGATGGGACGCCGGTGGTTAAGGCGATGTGGAGGGAGGCG 1080 Qy 1081 AAGGAGTGTATCTATGTGGAACCGGACAGGCAAGGTGAGAAGAAAGGTGTGTTCTGGTAC 1140 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1081 AAGGAGTGTATCTATGTGGAACCGGACAGGCAAGGTGAGAAGAAAGGTGTGTTCTGGTAC 1140 Qy 1141 AACAATAAGTTATGA 1155 ||||||||||||||| Db 1141 AACAATAAGTTATGA 1155 Against instant SEQ ID NO: 2 RESULT 3 US-14-019-244-7 (NOTE: this sequence has 3 duplicates in the database searched. See complete list at the end of this report) Sequence 7, US/14019244 Publication No. US20140090112A1 GENERAL INFORMATION APPLICANT: DOW AGROSCIENCES LLC APPLICANT: SANGAMO BIOSCIENCES, INC. TITLE OF INVENTION: FAD2 PERFORMANCE LOCI AND CORRESPONDING TARGET SITE SPECIFIC TITLE OF INVENTION: BINDING PROTEINS CAPABLE OF INDUCING TARGETED BREAKS FILE REFERENCE: 8326-4010 CURRENT APPLICATION NUMBER: US/14/019,244 CURRENT FILING DATE: 2013-09-05 PRIOR APPLICATION NUMBER: 61/697,886 PRIOR FILING DATE: 2012-09-07 NUMBER OF SEQ ID NOS: 480 SEQ ID NO 7 LENGTH: 1161 TYPE: DNA ORGANISM: Brassica napus Query Match 99.7%; Score 1151.8; Length 1161; Best Local Similarity 99.8%; Matches 1153; Conservative 0; Mismatches 2; Indels 0; Gaps 0; Qy 1 ATGGGCGCAGGTGGAAGAATGCAAGTCTCTCCTCCCTCCAGCTCCCCCGAAACCAAAACC 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 ATGGGCGCAGGTGGAAGAATGCAAGTCTCTCCTCCCTCCAGCTCCCCCGAAACCAAAACC 60 Qy 61 CTCAAACGCGTCCCCTGCGAGACACCACCCTTCACTCTCGGAGACCTCAAGAAAGCAATC 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 CTCAAACGCGTCCCCTGCGAGACACCACCCTTCACTCTCGGAGACCTCAAGAAAGCAATC 120 Qy 121 CCACCTCACTGCTTCAAACGCTCCATCCCTCGCTCCTTCTCCTACCTCCTCTTCGACATC 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 CCACCTCACTGCTTCAAACGCTCCATCCCTCGCTCCTTCTCCTACCTCCTCTTCGACATC 180 Qy 181 CTCGTCTCCTCCTCCCTCTACCACCTCTCCACAGCCTACTTCCCTCTCCTCCCCCACCCT 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 CTCGTCTCCTCCTCCCTCTACCACCTCTCCACAGCCTACTTCCCTCTCCTCCCCCACCCT 240 Qy 241 CTCCCTTACCTCGCCTGGCCCCTCTACTGGGCCTGCCAAGGCTGCGTCCTAACGGGCCTC 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 CTCCCTTACCTCGCCTGGCCCCTCTACTGGGCCTGCCAAGGCTGCGTCCTAACGGGCCTC 300 Qy 301 TGGGTCATCGCCCACGAATGCGGCCACCACGCCTTCAGCGACCACCAGTGGCTGGACGAC 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 TGGGTCATCGCCCACGAATGCGGCCACCACGCCTTCAGCGACCACCAGTGGCTGGACGAC 360 Qy 361 GCCGTGGGCCTCGTCTTCCACTCCTTCCTCCTCGTCCCTTACTTCTCCTGGAAGTACGGC 420 ||||||||||||||||||||||||||||||||||||||||||||||||||||||||| || Db 361 GCCGTGGGCCTCGTCTTCCACTCCTTCCTCCTCGTCCCTTACTTCTCCTGGAAGTACAGC 420 Qy 421 CATCGACGCCACCATTCCAACACCGGATCCCTCGAGAGGGATGAAGTGCTCGTCCCCAAG 480 |||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||| Db 421 CATCGACGCCACCATTCCAACACCGGATCCCTCGAGAGGGATGAAGTGTTCGTCCCCAAG 480 Qy 481 AAGAAATCCGACATCAAGTGGTACGGAAAGTACCTCAACAACCCGCTAGGACGCACGGTG 540 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 481 AAGAAATCCGACATCAAGTGGTACGGAAAGTACCTCAACAACCCGCTAGGACGCACGGTG 540 Qy 541 ATGCTAACCGTCCAGTTCACGCTCGGCTGGCCGTTGTACTTAGCCTTCAACGTCTCTGGA 600 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 541 ATGCTAACCGTCCAGTTCACGCTCGGCTGGCCGTTGTACTTAGCCTTCAACGTCTCTGGA 600 Qy 601 AGACCTTACAGCGACGGTTTCGCTTGCCATTTCCACCCGAACGCTCCCATCTACAACGAC 660 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 601 AGACCTTACAGCGACGGTTTCGCTTGCCATTTCCACCCGAACGCTCCCATCTACAACGAC 660 Qy 661 CGCGAGCGTCTCCAGATATACATCTCTGACGCTGGCGTCCTCTCCGTATGTTACGGTCTC 720 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 661 CGCGAGCGTCTCCAGATATACATCTCTGACGCTGGCGTCCTCTCCGTATGTTACGGTCTC 720 Qy 721 TACCGCTACGCTGGTTCGCGAGGAGTGGCCTCGATGGTCTGTGTCTACGGAGTTCCGCTT 780 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 721 TACCGCTACGCTGGTTCGCGAGGAGTGGCCTCGATGGTCTGTGTCTACGGAGTTCCGCTT 780 Qy 781 ATGATTGTCAACTGTTTCCTCGTCTTGATCACTTACTTGCAGCACACGCACCCTTCGCTG 840 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 781 ATGATTGTCAACTGTTTCCTCGTCTTGATCACTTACTTGCAGCACACGCACCCTTCGCTG 840 Qy 841 CCTCACTATGATTCTTCGGAGTGGGATTGGTTGAGAGGAGCTTTGGCTACTGTGGATAGA 900 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 841 CCTCACTATGATTCTTCGGAGTGGGATTGGTTGAGAGGAGCTTTGGCTACTGTGGATAGA 900 Qy 901 GACTATGGAATCTTGAACAAGGTGTTTCATAACATCACGGACACGCACGTGGCGCATCAT 960 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 901 GACTATGGAATCTTGAACAAGGTGTTTCATAACATCACGGACACGCACGTGGCGCATCAT 960 Qy 961 CTGTTCTCGACGATGCCGCATTATAACGCGATGGAAGCGACCAAGGCGATAAAGCCGATA 1020 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 961 CTGTTCTCGACGATGCCGCATTATAACGCGATGGAAGCGACCAAGGCGATAAAGCCGATA 1020 Qy 1021 CTTGGAGAGTATTACCAGTTTGATGGAACGCCGGTGGTTAAGGCGATGTGGAGGGAGGCG 1080 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1021 CTTGGAGAGTATTACCAGTTTGATGGAACGCCGGTGGTTAAGGCGATGTGGAGGGAGGCG 1080 Qy 1081 AAGGAGTGTATCTATGTTGAACCGGATAGGCAAGGTGAGAAGAAAGGTGTGTTCTGGTAC 1140 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1081 AAGGAGTGTATCTATGTTGAACCGGATAGGCAAGGTGAGAAGAAAGGTGTGTTCTGGTAC 1140 Qy 1141 AACAATAAGTTATGA 1155 ||||||||||||||| Db 1141 AACAATAAGTTATGA 1155 One of the 3 DUPLICATES: US-17-040-703-4 Filing date in PALM: 2020-09-23 Sequence 4, US/17040703 Publication No. US20210010013A1 GENERAL INFORMATION APPLICANT: Cibus US LLC APPLICANT: Cibus Europe, B.V. TITLE OF INVENTION: FAD2 GENES AND MUTATIONS FILE REFERENCE: 16507-20002.00 CURRENT APPLICATION NUMBER: US/17/040,703 CURRENT FILING DATE: 2020-09-23 PRIOR APPLICATION NUMBER: PCT/US2019/025881 PRIOR FILING DATE: 2019-04-04 PRIOR APPLICATION NUMBER: US 62/652,623 PRIOR FILING DATE: 2018-04-04 NUMBER OF SEQ ID NOS: 54 SEQ ID NO 4 LENGTH: 1155 TYPE: DNA ORGANISM: Brassica napus RESULT 1 JN992609 LOCUS JN992609 1155 bp DNA linear PLN 12-MAY-2012 DEFINITION Brassica napus fatty acid desaturase BnaC.FAD2.b gene, complete cds. ACCESSION JN992609 VERSION JN992609.1 KEYWORDS . SOURCE Brassica napus (rape) ORGANISM Brassica napus Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica. REFERENCE 1 (bases 1 to 1155) AUTHORS Yang,Q., Fan,C., Guo,Z., Qin,J., Wu,J., Li,Q., Fu,T. and Zhou,Y. TITLE Identification of FAD2 and FAD3 genes in Brassica napus genome and development of allele-specific markers for high oleic and low linolenic acid contents JOURNAL Theor. Appl. Genet. (2012) In press PUBMED 22534790 REMARK Publication Status: Available-Online prior to print REFERENCE 2 (bases 1 to 1155) AUTHORS Zhou,Y., Yang,Q. and Fan,C. TITLE Direct Submission JOURNAL Submitted (01-NOV-2011) National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, No. 1, Shizishan Street Hongshan District, Wuhan, Hubei 430070, China REMARK Brassica napus FEATURES Location/Qualifiers source 1..1155 /organism="Brassica napus" /mol_type="genomic DNA" /db_xref="taxon:3708" mRNA <1..>1155 /product="fatty acid desaturase BnaC.FAD2.b" CDS 1..1155 /codon_start=1 /product="fatty acid desaturase BnaC.FAD2.b" /protein_id="AFJ19032.1" /translation="MGAGGRMQVSPPSSSPETKTLKRVPCETPPFTLGDLKKAIPPHC FKRSIPRSFSYLLFDILVSSSLYHLSTAYFPLLPHPLPYLAWPLYWACQGCVLTGLWV IAHECGHHAFSDHQWLDDAVGLVFHSFLLVPYFSWKYGHRRHHSNTGSLERDEVLVPK KKSDIKWYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVSGRPYSDGFACHFHPNAPIY NDRERLQIYISDAGVLSVCYGLYRYAGSRGVASMVCVYGVPLMIVNCFLVLITYLQHT HPSLPHYDSSEWDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYNAMEAT KAIKPILGEYYQFDGTPVVKAMWREAKECIYVEPDRQGEKKGVFWYNNKL Query Match 100.0%; Score 1155; Length 1155; Best Local Similarity 100.0%; Matches 1155; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 ATGGGCGCAGGTGGAAGAATGCAAGTCTCTCCTCCCTCCAGCTCCCCCGAAACCAAAACC 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 ATGGGCGCAGGTGGAAGAATGCAAGTCTCTCCTCCCTCCAGCTCCCCCGAAACCAAAACC 60 Qy 61 CTCAAACGCGTCCCCTGCGAGACACCACCCTTCACTCTCGGAGACCTCAAGAAAGCAATC 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 CTCAAACGCGTCCCCTGCGAGACACCACCCTTCACTCTCGGAGACCTCAAGAAAGCAATC 120 Qy 121 CCACCTCACTGCTTCAAACGCTCCATCCCTCGCTCCTTCTCCTACCTCCTCTTCGACATC 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 CCACCTCACTGCTTCAAACGCTCCATCCCTCGCTCCTTCTCCTACCTCCTCTTCGACATC 180 Qy 181 CTCGTCTCCTCCTCCCTCTACCACCTCTCCACAGCCTACTTCCCTCTCCTCCCCCACCCT 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 CTCGTCTCCTCCTCCCTCTACCACCTCTCCACAGCCTACTTCCCTCTCCTCCCCCACCCT 240 Qy 241 CTCCCTTACCTCGCCTGGCCCCTCTACTGGGCCTGCCAAGGCTGCGTCCTAACGGGCCTC 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 CTCCCTTACCTCGCCTGGCCCCTCTACTGGGCCTGCCAAGGCTGCGTCCTAACGGGCCTC 300 Qy 301 TGGGTCATCGCCCACGAATGCGGCCACCACGCCTTCAGCGACCACCAGTGGCTGGACGAC 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 TGGGTCATCGCCCACGAATGCGGCCACCACGCCTTCAGCGACCACCAGTGGCTGGACGAC 360 Qy 361 GCCGTGGGCCTCGTCTTCCACTCCTTCCTCCTCGTCCCTTACTTCTCCTGGAAGTACGGC 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 GCCGTGGGCCTCGTCTTCCACTCCTTCCTCCTCGTCCCTTACTTCTCCTGGAAGTACGGC 420 Qy 421 CATCGACGCCACCATTCCAACACCGGATCCCTCGAGAGGGATGAAGTGCTCGTCCCCAAG 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 421 CATCGACGCCACCATTCCAACACCGGATCCCTCGAGAGGGATGAAGTGCTCGTCCCCAAG 480 Qy 481 AAGAAATCCGACATCAAGTGGTACGGAAAGTACCTCAACAACCCGCTAGGACGCACGGTG 540 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 481 AAGAAATCCGACATCAAGTGGTACGGAAAGTACCTCAACAACCCGCTAGGACGCACGGTG 540 Qy 541 ATGCTAACCGTCCAGTTCACGCTCGGCTGGCCGTTGTACTTAGCCTTCAACGTCTCTGGA 600 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 541 ATGCTAACCGTCCAGTTCACGCTCGGCTGGCCGTTGTACTTAGCCTTCAACGTCTCTGGA 600 Qy 601 AGACCTTACAGCGACGGTTTCGCTTGCCATTTCCACCCGAACGCTCCCATCTACAACGAC 660 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 601 AGACCTTACAGCGACGGTTTCGCTTGCCATTTCCACCCGAACGCTCCCATCTACAACGAC 660 Qy 661 CGCGAGCGTCTCCAGATATACATCTCTGACGCTGGCGTCCTCTCCGTATGTTACGGTCTC 720 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 661 CGCGAGCGTCTCCAGATATACATCTCTGACGCTGGCGTCCTCTCCGTATGTTACGGTCTC 720 Qy 721 TACCGCTACGCTGGTTCGCGAGGAGTGGCCTCGATGGTCTGTGTCTACGGAGTTCCGCTT 780 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 721 TACCGCTACGCTGGTTCGCGAGGAGTGGCCTCGATGGTCTGTGTCTACGGAGTTCCGCTT 780 Qy 781 ATGATTGTCAACTGTTTCCTCGTCTTGATCACTTACTTGCAGCACACGCACCCTTCGCTG 840 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 781 ATGATTGTCAACTGTTTCCTCGTCTTGATCACTTACTTGCAGCACACGCACCCTTCGCTG 840 Qy 841 CCTCACTATGATTCTTCGGAGTGGGATTGGTTGAGAGGAGCTTTGGCTACTGTGGATAGA 900 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 841 CCTCACTATGATTCTTCGGAGTGGGATTGGTTGAGAGGAGCTTTGGCTACTGTGGATAGA 900 Qy 901 GACTATGGAATCTTGAACAAGGTGTTTCATAACATCACGGACACGCACGTGGCGCATCAT 960 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 901 GACTATGGAATCTTGAACAAGGTGTTTCATAACATCACGGACACGCACGTGGCGCATCAT 960 Qy 961 CTGTTCTCGACGATGCCGCATTATAACGCGATGGAAGCGACCAAGGCGATAAAGCCGATA 1020 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 961 CTGTTCTCGACGATGCCGCATTATAACGCGATGGAAGCGACCAAGGCGATAAAGCCGATA 1020 Qy 1021 CTTGGAGAGTATTACCAGTTTGATGGAACGCCGGTGGTTAAGGCGATGTGGAGGGAGGCG 1080 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1021 CTTGGAGAGTATTACCAGTTTGATGGAACGCCGGTGGTTAAGGCGATGTGGAGGGAGGCG 1080 Qy 1081 AAGGAGTGTATCTATGTTGAACCGGATAGGCAAGGTGAGAAGAAAGGTGTGTTCTGGTAC 1140 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1081 AAGGAGTGTATCTATGTTGAACCGGATAGGCAAGGTGAGAAGAAAGGTGTGTTCTGGTAC 1140 Qy 1141 AACAATAAGTTATGA 1155 ||||||||||||||| Db 1141 AACAATAAGTTATGA 1155 Against instant SEQ ID NO: 3 RESULT 1 US-09-771-904-13 (NOTE: this sequence has 16 duplicates in the database searched. See complete list at the end of this report) Sequence 13, US/09771904 Publication No. US20030131379A1 GENERAL INFORMATION APPLICANT: DeBonte, Lorin R. APPLICANT: Fan, Zhegong APPLICANT: Miao, Guo-Hua TITLE OF INVENTION: FATTY ACID DESATURASES AND MUTANT SEQUENCES THEREOF FILE REFERENCE: 07148-063003 CURRENT APPLICATION NUMBER: US/09/771,904 CURRENT FILING DATE: 2001-01-29 PRIOR APPLICATION NUMBER: US 08/874,109 PRIOR FILING DATE: 1997-06-12 NUMBER OF SEQ ID NOS: 69 SEQ ID NO 13 LENGTH: 1155 TYPE: DNA ORGANISM: Brassica napus FEATURE: NAME/KEY: CDS LOCATION: (1)...(1152) Query Match 100.0%; Score 1155; Length 1155; Best Local Similarity 100.0%; Matches 1155; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 ATGGGTGCAGGTGGAAGAATGCAAGTGTCTCCTCCCTCCAAGAAGTCTGAAACCGACACC 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 ATGGGTGCAGGTGGAAGAATGCAAGTGTCTCCTCCCTCCAAGAAGTCTGAAACCGACACC 60 Qy 61 ATCAAGCGCGTACCCTGCGAGACACCGCCCTTCACTGTCGGAGAACTCAAGAAAGCAATC 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 ATCAAGCGCGTACCCTGCGAGACACCGCCCTTCACTGTCGGAGAACTCAAGAAAGCAATC 120 Qy 121 CCACCGCACTGTTTCAAACGCTCGATCCCTCGCTCTTTCTCCTACCTCATCTGGGACATC 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 CCACCGCACTGTTTCAAACGCTCGATCCCTCGCTCTTTCTCCTACCTCATCTGGGACATC 180 Qy 181 ATCATAGCCTCCTGCTTCTACTACGTCGCCACCACTTACTTCCCTCTCCTCCCTCACCCT 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 ATCATAGCCTCCTGCTTCTACTACGTCGCCACCACTTACTTCCCTCTCCTCCCTCACCCT 240 Qy 241 CTCTCCTACTTCGCCTGGCCTCTCTACTGGGCCTGCCAAGGGTGCGTCCTAACCGGCGTC 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 CTCTCCTACTTCGCCTGGCCTCTCTACTGGGCCTGCCAAGGGTGCGTCCTAACCGGCGTC 300 Qy 301 TGGGTCATAGCCCACGAGTGCGGCCACCACGCCTTCAGCGACTACCAGTGGCTTGACGAC 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 TGGGTCATAGCCCACGAGTGCGGCCACCACGCCTTCAGCGACTACCAGTGGCTTGACGAC 360 Qy 361 ACCGTCGGTCTCATCTTCCACTCCTTCCTCCTCGTCCCTTACTTCTCCTGGAAGTACAGT 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 ACCGTCGGTCTCATCTTCCACTCCTTCCTCCTCGTCCCTTACTTCTCCTGGAAGTACAGT 420 Qy 421 CATCGACGCCACCATTCCAACACTGGCTCCCTCGAGAGAGACGAAGTGTTTGTCCCCAAG 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 421 CATCGACGCCACCATTCCAACACTGGCTCCCTCGAGAGAGACGAAGTGTTTGTCCCCAAG 480 Qy 481 AAGAAGTCAGACATCAAGTGGTACGGCAAGTACCTCAACAACCCTTTGGGACGCACCGTG 540 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 481 AAGAAGTCAGACATCAAGTGGTACGGCAAGTACCTCAACAACCCTTTGGGACGCACCGTG 540 Qy 541 ATGTTAACGGTTCAGTTCACTCTCGGCTGGCCGTTGTACTTAGCCTTCAACGTCTCGGGA 600 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 541 ATGTTAACGGTTCAGTTCACTCTCGGCTGGCCGTTGTACTTAGCCTTCAACGTCTCGGGA 600 Qy 601 AGACCTTACGACGGCGGCTTCGCTTGCCATTTCCACCCCAACGCTCCCATCTACAACGAC 660 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 601 AGACCTTACGACGGCGGCTTCGCTTGCCATTTCCACCCCAACGCTCCCATCTACAACGAC 660 Qy 661 CGCGAGCGTCTCCAGATATACATCTCCGACGCTGGCATCCTCGCCGTCTGCTACGGTCTC 720 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 661 CGCGAGCGTCTCCAGATATACATCTCCGACGCTGGCATCCTCGCCGTCTGCTACGGTCTC 720 Qy 721 TTCCGTTACGCCGCCGCGCAGGGAGTGGCCTCGATGGTCTGCTTCTACGGAGTCCCGCTT 780 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 721 TTCCGTTACGCCGCCGCGCAGGGAGTGGCCTCGATGGTCTGCTTCTACGGAGTCCCGCTT 780 Qy 781 CTGATTGTCAATGGTTTCCTCGTGTTGATCACTTACTTGCAGCACACGCATCCTTCCCTG 840 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 781 CTGATTGTCAATGGTTTCCTCGTGTTGATCACTTACTTGCAGCACACGCATCCTTCCCTG 840 Qy 841 CCTCACTACGATTCGTCCGAGTGGGATTGGTTGAGGGGAGCTTTGGCTACCGTTGACAGA 900 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 841 CCTCACTACGATTCGTCCGAGTGGGATTGGTTGAGGGGAGCTTTGGCTACCGTTGACAGA 900 Qy 901 GACTACGGAATCTTGAACAAGGTCTTCCACAATATTACCGACACGCACGTGGCGCATCAT 960 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 901 GACTACGGAATCTTGAACAAGGTCTTCCACAATATTACCGACACGCACGTGGCGCATCAT 960 Qy 961 CTGTTCTCCACGATGCCGCATTATCACGCGATGGAAGCTACCAAGGCGATAAAGCCGATA 1020 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 961 CTGTTCTCCACGATGCCGCATTATCACGCGATGGAAGCTACCAAGGCGATAAAGCCGATA 1020 Qy 1021 CTGGGAGAGTATTATCAGTTCGATGGGACGCCGGTGGTTAAGGCGATGTGGAGGGAGGCG 1080 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1021 CTGGGAGAGTATTATCAGTTCGATGGGACGCCGGTGGTTAAGGCGATGTGGAGGGAGGCG 1080 Qy 1081 AAGGAGTGTATCTATGTGGAACCGGACAGGCAAGGTGAGAAGAAAGGTGTGTTCTGGTAC 1140 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1081 AAGGAGTGTATCTATGTGGAACCGGACAGGCAAGGTGAGAAGAAAGGTGTGTTCTGGTAC 1140 Qy 1141 AACAATAAGTTATGA 1155 ||||||||||||||| Db 1141 AACAATAAGTTATGA 1155 One of the 16 duplicates: US-17-040-703-2 Filing date in PALM: 2020-09-23 Sequence 2, US/17040703 Publication No. US20210010013A1 GENERAL INFORMATION APPLICANT: Cibus US LLC APPLICANT: Cibus Europe, B.V. TITLE OF INVENTION: FAD2 GENES AND MUTATIONS FILE REFERENCE: 16507-20002.00 CURRENT APPLICATION NUMBER: US/17/040,703 CURRENT FILING DATE: 2020-09-23 PRIOR APPLICATION NUMBER: PCT/US2019/025881 PRIOR FILING DATE: 2019-04-04 PRIOR APPLICATION NUMBER: US 62/652,623 PRIOR FILING DATE: 2018-04-04 NUMBER OF SEQ ID NOS: 54 SEQ ID NO 2 LENGTH: 1155 TYPE: DNA ORGANISM: Brassica napus Against instant SEQ ID NO: 10 SEQ ID NO: 10 is a fragment of SEQ ID NO: 1 or SEQ ID NO: 3 (positions 76-123) Alignment statistics for match #1 Score Expect Identities Gaps Strand 89.8 bits(48) 4e-23 48/48(100%) 0/48(0%) Plus/Plus Query 76 TGCGAGACACCGCCCTTCACTGTCGGAGAACTCAAGAAAGCAATCCCA 123 |||||||||||||||||||||||||||||||||||||||||||||||| Sbjct 1 TGCGAGACACCGCCCTTCACTGTCGGAGAACTCAAGAAAGCAATCCCA 48 SEQ ID NO: 10 is identical in instant application and US Patent 11624072 Sequence 10, US/17259456 Patent No. 11624072 GENERAL INFORMATION APPLICANT: CELLECTIS TITLE OF INVENTION: CANOLA WITH HIGH OLEIC ACID FILE REFERENCE: 36861-0029WO1 CURRENT APPLICATION NUMBER: US/17/259,456 CURRENT FILING DATE: 2021-01-11 PRIOR APPLICATION NUMBER: US 62/695,388 PRIOR FILING DATE: 2018-07-09 NUMBER OF SEQ ID NOS: 53975 SEQ ID NO 10 LENGTH: 48 TYPE: DNA ORGANISM: Artificial FEATURE: OTHER INFORMATION: Target site for BnFAD2_T03 Query Match 100.0%; Score 48; Length 48; Best Local Similarity 100.0%; Matches 48; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 TGCGAGACACCGCCCTTCACTGTCGGAGAACTCAAGAAAGCAATCCCA 48 |||||||||||||||||||||||||||||||||||||||||||||||| Db 1 TGCGAGACACCGCCCTTCACTGTCGGAGAACTCAAGAAAGCAATCCCA 48 SEQ ID NO: 10 against sequences in GenEmbl DQ518277 LOCUS DQ518277 783 bp DNA linear PLN 06-DEC-2016 DEFINITION Brassica napus isolate B.nap2 delta-12 desaturase gene, partial cds. ACCESSION DQ518277 VERSION DQ518277.1 KEYWORDS . SOURCE Brassica napus (rape) ORGANISM Brassica napus Query Match 100.0%; Score 48; DB 385; Length 783; Best Local Similarity 100.0%; Matches 48; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 TGCGAGACACCGCCCTTCACTGTCGGAGAACTCAAGAAAGCAATCCCA 48 |||||||||||||||||||||||||||||||||||||||||||||||| Db 55 TGCGAGACACCGCCCTTCACTGTCGGAGAACTCAAGAAAGCAATCCCA 102 DQ518280 LOCUS DQ518280 783 bp DNA linear PLN 06-DEC-2016 DEFINITION Brassica nigra isolate B.nig1 delta-12 desaturase gene, partial cds. ACCESSION DQ518280 VERSION DQ518280.1 KEYWORDS . SOURCE Brassica nigra (black mustard) ORGANISM Brassica nigra Query Match 100.0%; Score 48; DB 385; Length 783; Best Local Similarity 100.0%; Matches 48; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 TGCGAGACACCGCCCTTCACTGTCGGAGAACTCAAGAAAGCAATCCCA 48 |||||||||||||||||||||||||||||||||||||||||||||||| Db 55 TGCGAGACACCGCCCTTCACTGTCGGAGAACTCAAGAAAGCAATCCCA 102 DQ518271 LOCUS DQ518271 783 bp DNA linear PLN 06-DEC-2016 DEFINITION Brassica carinata delta-12 desaturase gene, partial cds. ACCESSION DQ518271 VERSION DQ518271.1 KEYWORDS . SOURCE Brassica carinata ORGANISM Brassica carinata Query Match 100.0%; Score 48; DB 385; Length 783; Best Local Similarity 100.0%; Matches 48; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 TGCGAGACACCGCCCTTCACTGTCGGAGAACTCAAGAAAGCAATCCCA 48 |||||||||||||||||||||||||||||||||||||||||||||||| Db 55 TGCGAGACACCGCCCTTCACTGTCGGAGAACTCAAGAAAGCAATCCCA 102 DQ518282 LOCUS DQ518282 783 bp DNA linear PLN 06-DEC-2016 DEFINITION Brassica oleracea isolate B.ole1 delta-12 desaturase gene, partial cds. ACCESSION DQ518282 VERSION DQ518282.1 KEYWORDS . SOURCE Brassica oleracea (wild cabbage) ORGANISM Brassica oleracea Query Match 100.0%; Score 48; DB 385; Length 783; Best Local Similarity 100.0%; Matches 48; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 TGCGAGACACCGCCCTTCACTGTCGGAGAACTCAAGAAAGCAATCCCA 48 |||||||||||||||||||||||||||||||||||||||||||||||| Db 55 TGCGAGACACCGCCCTTCACTGTCGGAGAACTCAAGAAAGCAATCCCA 102 Conclusion No claim is allowed. Contact information Any inquiry concerning this communication or earlier communications from the examiner should be directed to WAYNE ZHONG whose telephone number is (571)270-0311. The examiner can normally be reached 8:30am to 5:00pm EST. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Shubo (Joe) Zhou can be reached on 571-272-0724. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /Wayne Zhong/ Primary Examiner, Art Unit 1662
Read full office action

Prosecution Timeline

Apr 10, 2023
Application Filed
Aug 23, 2024
Non-Final Rejection — §102, §103, §112
Dec 26, 2024
Response Filed
Feb 27, 2025
Final Rejection — §102, §103, §112
Sep 10, 2025
Request for Continued Examination
Oct 03, 2025
Response after Non-Final Action
Dec 23, 2025
Non-Final Rejection — §102, §103, §112
Apr 13, 2026
Examiner Interview Summary

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12600978
PROCESS FOR PRODUCING LIPIDS
2y 5m to grant Granted Apr 14, 2026
Patent 12599072
PLANTS AND SEEDS OF HYBRID CORN VARIETY CH010552
2y 5m to grant Granted Apr 14, 2026
Patent 12600976
MAIZE GENE KRN2 AND USES THEREOF
2y 5m to grant Granted Apr 14, 2026
Patent 12593767
PROTOPLAST ISOLATION AND REGENERATION OF PLANTS
2y 5m to grant Granted Apr 07, 2026
Patent 12593793
SOYBEAN VARIETY 01094778
2y 5m to grant Granted Apr 07, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

AI Strategy Recommendation

Get an AI-powered prosecution strategy using examiner precedents, rejection analysis, and claim mapping.
Powered by AI — typically takes 5-10 seconds

Prosecution Projections

3-4
Expected OA Rounds
72%
Grant Probability
94%
With Interview (+22.3%)
3y 0m
Median Time to Grant
High
PTA Risk
Based on 524 resolved cases by this examiner. Grant probability derived from career allow rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month