Prosecution Insights
Last updated: April 19, 2026
Application No. 18/311,409

MURINE ANTI-CD19 CHIMERIC ANTIGEN RECEPTOR FOR TREATING CANCER

Non-Final OA §102
Filed
May 03, 2023
Examiner
METCALF, MATTHEW CURRAN
Art Unit
1647
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
Pell Bio-Med Technology Co. Ltd.
OA Round
1 (Non-Final)
0%
Grant Probability
At Risk
1-2
OA Rounds
3y 2m
To Grant
0%
With Interview

Examiner Intelligence

Grants only 0% of cases
0%
Career Allow Rate
0 granted / 1 resolved
-60.0% vs TC avg
Minimal +0% lift
Without
With
+0.0%
Interview Lift
resolved cases with interview
Typical timeline
3y 2m
Avg Prosecution
15 currently pending
Career history
16
Total Applications
across all art units

Statute-Specific Performance

§101
1.7%
-38.3% vs TC avg
§103
33.9%
-6.1% vs TC avg
§102
13.6%
-26.4% vs TC avg
§112
25.4%
-14.6% vs TC avg
Black line = Tech Center average estimate • Based on career data from 1 resolved cases

Office Action

§102
DETAILED ACTION Notice of Pre-AIA or AIA Status The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . Priority The effective filing date is 03 May 2023. Information Disclosure Statement The information disclosure statements (IDS) submitted on 05 December 2024 and 03 May 2023 are being considered by the examiner. Status of Application, Amendments, and/or Claims Claims 1-20 are the original claims filed on 03 May 2023. Claims 1-20 are pending and the subject of this office action. Claim Rejections - 35 USC § 102 The following is a quotation of the appropriate paragraphs of 35 U.S.C. 102 that form the basis for the rejections under this section made in this Office action: A person shall be entitled to a patent unless – (a)(1) the claimed invention was patented, described in a printed publication, or in public use, on sale, or otherwise available to the public before the effective filing date of the claimed invention. (a)(2) the claimed invention was described in a patent issued under section 151, or in an application for patent published or deemed published under section 122(b), in which the patent or application, as the case may be, names another inventor and was effectively filed before the effective filing date of the claimed invention. Claims 1-20 are rejected under 35 U.S.C. 102 (a1) and (a2) as being anticipated by US 2021/0244759 A1 (herein Gross), which is related to a reference cited, WO2019/068007 A1, in the information disclosure statements (IDS) submitted on 05 December 2024. Regarding claims 1, 4, 6, 8, 12, and 14, Gross teaches a method for treating cancer in a subject having a tumor characterized by a loss of heterozygosity. The method involves administering activating chimeric antigen receptors, recognizing antigens expressed on the surface of tumor cells, inhibitory CARs and protective CARs directed at allelic variants of the same or other cell surface antigens expressed by normal cells but not by the tumor due to loss of heterozygosity ([0055], [0143]-[0145], and figures 1 and 2). In multiple examples an anti-CD19 CAR is used as an activating CAR ([0769] and [0787]). Gross discloses the nucleic acid, SEQ ID NO:1, that was used to encodes the amino acid sequence comprising an anti-CD19 chimeric antigen receptor (SEQ ID NO: 2) ([0797] and figure 21). The amino acid disclosed shares 100% amino acid sequence identity with SEQ ID NO: 17 of the instant application, referenced in instant claim 14. Additionally, this sequence comprises limitations established in instant claims 1, 3, 4, 6, 8, 12, and 14: An anti-CD19 binding domain (instant claim 4, SEQ ID NO: 9) comprising: A heavy chain variable region (claim 3, SEQ ID NO: 7) comprising: CDR1 (instant claim 1, SEQ ID NO: 1) CDR2 (instant claim 1, SEQ ID NO: 2) CDR3 (instant claim 1, SEQ ID NO: 3) A light chain variable region (claim 3, SEQ ID NO: 8) comprising: CDR1 (instant claim 1, SEQ ID NO: 4) CDR2 (instant claim 1, SEQ ID NO: 5) CDR3 (instant claim 1, SEQ ID NO: 6) A 4-1BB costimulatory domain (instant claims 1 and 6, SEQ ID NO: 13) ([0149]) A CD3 zeta intracellular signaling domain (instant claims 1 and 8, SEQ ID NO: 15) ([0284]) A CD8 hinge (instant claim 12, SEQ ID NO: 12) ([0763]). [AltContent: connector] Anti-CD19 binding domain CDRL1 Ref MALPVTALLLPLALLLHAARPDIQMTQTTSSLSASLGDRVTISCRASQDISKYLNWYQQK 60 Instant ---------------------DIQMTQTTSSLSASLGDRVTISCRASQDISKYLNWYQQK 39 *************************************** Anti-CD19 binding domain [AltContent: connector] CDRL2 CDRL3 Ref PDGTVKLLIYHTSRLHSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGNTLPYTFG 120 Instant PDGTVKLLIYHTSRLHSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGNTLPYTFG 99 ************************************************************ Anti-CD19 binding domain [AltContent: connector] CDRH1 Ref GGTKLEITGGGGSGGGGSGGGGSEVKLQESGPGLVAPSQSLSVTCTVSGVSLPDYGVSWI 180 Instant GGTKLEITGGGGSGGGGSGGGGSEVKLQESGPGLVAPSQSLSVTCTVSGVSLPDYGVSWI 159 ************************************************************ CDRH2 Ref RQPPRKGLEWLGVIWGSETTYYNSALKSRLTIIKDNSKSQVFLKMNSLQTDDTAIYYCAK 240 Instant RQPPRKGLEWLGVIWGSETTYYNSALKSRLTIIKDNSKSQVFLKMNSLQTDDTAIYYCAK 219 ************************************************************ [AltContent: connector] Anti-CD19 binding domain CDRH3 CD8 hinge Ref HYYYGGSYAMDYWGQGTSVTVSSTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHT 300 Instant HYYYGGSYAMDYWGQGTSVTVSSTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHT 279 ************************************************************ CD8 hinge 4-1BB Ref RGLDFACDIYIWAPLAGTCGVLLLSLVITLYCKRGRKKLLYIFKQPFMRPVQTTQEEDGC 360 Instant RGLDFACDIYIWAPLAGTCGVLLLSLVITLYCKRGRKKLLYIFKQPFMRPVQTTQEEDGC 339 ************************************************************ 4-1BB | CD3 zeta Ref SCRFPEEEEGGCELRVKFSRSADAPAYKQGQNQLYNELNLGRREEYDVLDKRRGRDPEMG 420 Instant SCRFPEEEEGGCELRVKFSRSADAPAYKQGQNQLYNELNLGRREEYDVLDKRRGRDPEMG 399 ************************************************************ CD3 zeta Ref GKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHM 480 Instant GKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHM 459 ************************************************************ CD3 zeta Ref QALPPR 486 Instant QALPPR 465 ****** Regarding claims 1, 5, 7, 9, 13, and 15, Gross teaches a nucleic acid that encodes a murine anti-CD19 chimeric antigen receptor ([0797], figure 21, and SEQ ID NO: 1). This nucleic acid comprises a sequence that shares 100% sequence identity with SEQ ID NO: 18 of instant claim 15 (see alignment below). The sequence described in SEQ ID NO: 15 of the instant application and SEQ ID NO: 1 of the reference encodes a murine anti-CD19 chimeric antigen receptor, which satisfies all the limitations of claim 1 (see rejections of claims 1, 4, 6, 8, 12, and 14, above). Additionally, this nucleic acid comprises sequence limitations established in instant claims 5 (SEQ ID NO: 10), 7 (SEQ ID NO: 14), 9 (SEQ ID NO: 16), and 13 (SEQ ID NO: 12). Instant ------------------------------------------------------------ 0 Ref atggccttaccagtgaccgccttgctcctgccgctggccttgctgctccacgccgccagg 60 anti-CD19 binding domain Instant ---gacatccagatgacacagactacatcctccctgtctgcctctctgggagacagagtc 57 Ref ccggacatccagatgacacagactacatcctccctgtctgcctctctgggagacagagtc 120 ********************************************************* anti-CD19 binding domain Instant accatcagttgcagggcaagtcaggacattagtaaatatttaaattggtatcagcagaaa 117 Ref accatcagttgcagggcaagtcaggacattagtaaatatttaaattggtatcagcagaaa 180 ************************************************************ anti-CD19 binding domain Instant ccagatggaactgttaaactcctgatctaccatacatcaagattacactcaggagtccca 177 Ref ccagatggaactgttaaactcctgatctaccatacatcaagattacactcaggagtccca 240 ************************************************************ anti-CD19 binding domain Instant tcaaggttcagtggcagtgggtctggaacagattattctctcaccattagcaacctggag 237 Ref tcaaggttcagtggcagtgggtctggaacagattattctctcaccattagcaacctggag 300 ************************************************************ anti-CD19 binding domain Instant caagaagatattgccacttacttttgccaacagggtaatacgcttccgtacacgttcgga 297 Ref caagaagatattgccacttacttttgccaacagggtaatacgcttccgtacacgttcgga 360 ************************************************************ anti-CD19 binding domain Instant ggggggaccaagctggagatcacaggtggcggtggctcgggcggtggtgggtcgggtggc 357 Ref ggggggaccaagctggagatcacaggtggcggtggctcgggcggtggtgggtcgggtggc 420 ************************************************************ anti-CD19 binding domain Instant ggcggatctgaggtgaaactgcaggagtcaggacctggcctggtggcgccctcacagagc 417 Ref ggcggatctgaggtgaaactgcaggagtcaggacctggcctggtggcgccctcacagagc 480 ************************************************************ anti-CD19 binding domain Instant ctgtccgtcacatgcactgtctcaggggtctcattacccgactatggtgtaagctggatt 477 Ref ctgtccgtcacatgcactgtctcaggggtctcattacccgactatggtgtaagctggatt 540 ************************************************************ anti-CD19 binding domain Instan cgccagcctccacgaaagggtctggagtggctgggagtaatatggggtagtgaaaccaca 537 Ref cgccagcctccacgaaagggtctggagtggctgggagtaatatggggtagtgaaaccaca 600 ************************************************************ anti-CD19 binding domain Instant tactataattcagctctcaaatccagactgaccatcatcaaggacaactccaagagccaa 597 Ref tactataattcagctctcaaatccagactgaccatcatcaaggacaactccaagagccaa 660 ************************************************************ anti-CD19 binding domain Instant gttttcttaaaaatgaacagtctgcaaactgatgacacagccatttactactgtgccaaa 657 Ref gttttcttaaaaatgaacagtctgcaaactgatgacacagccatttactactgtgccaaa 720 ************************************************************ anti-CD19 binding domain Instant cattattactacggtggtagctatgctatggactactggggccaaggaacctcagtcacc 717 Ref cattattactacggtggtagctatgctatggactactggggccaaggaacctcagtcacc 780 ************************************************************ CD8 Hinge Instant gtctcctcaACCACTACCCCAGCACCGAGGCCACCCACCCCGGCTCCTACCATCGCCTCC 777 Ref gtctcctcaACCACTACCCCAGCACCGAGGCCACCCACCCCGGCTCCTACCATCGCCTCC 840 ************************************************************ CD8 Hinge Instant CAGCCTCTGTCCCTGCGTCCGGAGGCATGTAGACCCGCAGCTGGTGGGGCCGTGCATACC 837 Ref CAGCCTCTGTCCCTGCGTCCGGAGGCATGTAGACCCGCAGCTGGTGGGGCCGTGCATACC 900 ************************************************************ CD8 Hinge Instant CGGGGTCTTGACTTCGCCTGCGATATCTACATTTGGGCCCCTCTGGCTGGTACTTGCGGG 897 Ref CGGGGTCTTGACTTCGCCTGCGATATCTACATTTGGGCCCCTCTGGCTGGTACTTGCGGG 960 ************************************************************ CD8 Hinge 4-1BB Instant GTCCTGCTGCTTTCACTCGTGATCACTCTTTACTGTaagcgcggtcggaagaagctgctg 957 Ref GTCCTGCTGCTTTCACTCGTGATCACTCTTTACTGTaagcgcggtcggaagaagctgctg 1020 ************************************************************ 4-1BB Instant tacatctttaagcaacccttcatgaggcctgtgcagactactcaagaggaggacggctgt 1017 Ref tacatctttaagcaacccttcatgaggcctgtgcagactactcaagaggaggacggctgt 1080 ************************************************************ 4-1BB CD3 Zeta Instant tcatgccggttcccagaggaggaggaaggcggctgcgaactgcgcgtgaaattcagccgc 1077 Ref tcatgccggttcccagaggaggaggaaggcggctgcgaactgcgcgtgaaattcagccgc 1140 ************************************************************ CD3 Zeta Instant agcgcagatgctccagcctacaagcaggggcagaaccagctctacaacgaactcaatctt 1137 Ref agcgcagatgctccagcctacaagcaggggcagaaccagctctacaacgaactcaatctt 1200 ************************************************************ CD3 Zeta Instant ggtcggagagaggagtacgacgtgctggacaagcggagaggacgggacccagaaatgggc 1197 Ref ggtcggagagaggagtacgacgtgctggacaagcggagaggacgggacccagaaatgggc 1260 ************************************************************ CD3 Zeta Instant gggaagccgcgcagaaagaatccccaagagggcctgtacaacgagctccaaaaggataag 1257 Ref gggaagccgcgcagaaagaatccccaagagggcctgtacaacgagctccaaaaggataag 1320 ************************************************************ CD3 Zeta Instant atggcagaagcctatagcgagattggtatgaaaggggaacgcagaagaggcaaaggccac 1317 Ref atggcagaagcctatagcgagattggtatgaaaggggaacgcagaagaggcaaaggccac 1380 ************************************************************ CD3 Zeta Instant gacggactgtaccagggactcagcaccgccaccaaggacacctatgacgctcttcacatg 1377 Ref gacggactgtaccagggactcagcaccgccaccaaggacacctatgacgctcttcacatg 1440 ************************************************************ CD3 Zeta Instant caggccctgccgcctcgg------------------------------------------ 1395 Ref caggccctgccgcctcggtgagcggccgcaaattccgcccctctccctccccccccccta 1500 ****************** Regarding claim 2, Gross teaches a nucleic acid encoding a murine anti-CD19 chimeric antigen receptor, as discussed for claim 15. The encoded CAR element comprises an anti-CD19 scFv ([0006], [0191], [0263], [0442], and [0797]). Regarding claims 10 and 11, Gross teaches a nucleic acid, reference SEQ ID NO:1, sequentially comprising a murine anti-CD19 chimeric antigen receptor with a single chain antibody fragment (anti-CD19 binding domain), a costimulatory domain (4-1BB), a primary intracellular signaling domain (CD3 zeta), and a CD8 hinge (CD8 hinge) as illustrated by the annotated amino acid sequence shown above ([0284], [0763], and [0149]). Regarding claims 16-18, Gross teaches a vector comprising the nucleic acid encoding an anti-CD19 CAR, in which the vector may be a plasmid, cosmid, or virus ([0123]). Gross further teaches that the vector may comprise an EF1 promoter ([0278]). Regarding claims 19 and 20, Gross teaches the engineering of cells with the described vectors, which includes T-cells, natural killer cells, or cytokine-induced killer cells ([0312] and [0313]). Conclusion All claims are rejected. Any inquiry concerning this communication or earlier communications from the examiner should be directed to MATTHEW CURRAN METCALF whose telephone number is (571)272-5520. The examiner can normally be reached 7:30AM-5:00PM. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Joanne Hama can be reached at (571)272-2911. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /MATTHEW CURRAN METCALF/ Examiner, Art Unit 1647 /JOANNE HAMA/Supervisory Patent Examiner, Art Unit 1647
Read full office action

Prosecution Timeline

May 03, 2023
Application Filed
Jan 22, 2026
Non-Final Rejection — §102 (current)

AI Strategy Recommendation

Get an AI-powered prosecution strategy using examiner precedents, rejection analysis, and claim mapping.
Powered by AI — typically takes 5-10 seconds

Prosecution Projections

1-2
Expected OA Rounds
0%
Grant Probability
0%
With Interview (+0.0%)
3y 2m
Median Time to Grant
Low
PTA Risk
Based on 1 resolved cases by this examiner. Grant probability derived from career allow rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month